RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >gnl|CDD|30809 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 201 Score = 145 bits (367), Expect = 9e-36 Identities = 58/206 (28%), Positives = 95/206 (46%), Gaps = 10/206 (4%) Query: 13 AELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRN 72 +A++L E A+ F + L+SG SP Y+D R ++ +I A+ + Sbjct: 3 KRELAELLLEKGALKFGE---FTLSSGRKSPYYVDLRLFLTGPELLQLIAFALAEIIKEA 59 Query: 73 IGFESIDIIAGGETAGIPFATLLAERLN--LPMIYVRKKSKKHGQKSQIEGHLFKGARVL 130 + F D++AG GIP A A L PM YVRK++K HG IEG KG +V+ Sbjct: 60 LEF---DVVAGPALGGIPLAAATALALAHLPPMAYVRKEAKDHGTGGLIEGGEVKGEKVV 116 Query: 131 VIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWND 190 V+ED++T G S+ E V+ +R++G + + +E +KL L T +D Sbjct: 117 VVEDVITTGGSILEAVEALREAGAEVVGVAVIVDRQ--SGAKEVLKEYGVKLVSLVTLSD 174 Query: 191 ILTIAEKLKIFNHDVLEEVRCFLDNP 216 +L + + + L + Sbjct: 175 LLEVLYEAGDIPLEELAIPAEAYRSR 200 >gnl|CDD|30849 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism]. Length = 179 Score = 58.8 bits (142), Expect = 1e-09 Identities = 28/126 (22%), Positives = 49/126 (38%), Gaps = 14/126 (11%) Query: 47 DCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYV 106 I+ + ++ + + ID I E GIP A +A L +P + V Sbjct: 23 ILFVDITLLLGDPELLAKLIDELAERYKDDGIDKIVTIEARGIPLAAAVALELGVPFVPV 82 Query: 107 RKKSK-----------KHGQKSQIEGH---LFKGARVLVIEDLVTLGNSMFEFVKVIRDS 152 RKK K +E H L G RVL+++DL+ G + ++++ + Sbjct: 83 RKKGKLPEESVVETYYLEYGSETLELHKDALKPGDRVLIVDDLLATGGTALALIELLEQA 142 Query: 153 GGIIQD 158 G + Sbjct: 143 GAEVVG 148 >gnl|CDD|143924 pfam00156, Pribosyltran, Phosphoribosyl transferase domain. This family includes a range of diverse phosphoribosyl transferase enzymes. This family includes: Adenine phosphoribosyltransferase EC:2.4.2.7. Hypoxanthine-guanine-xanthine phosphoribosyltransferase. Hypoxanthine phosphoribosyltransferase EC:2.4.2.8. Ribose-phosphate pyrophosphokinase i EC:2.7.6.1. Amidophosphoribosyltransferase EC:2.4.2.14. Orotate phosphoribosyltransferase EC:2.4.2.10. Uracil phosphoribosyltransferase EC:2.4.2.9. Xanthine-guanine phosphoribosyltransferase EC:2.4.2.22. In Arabidopsis, At the very N-terminus of this domain is the ATP-GTP-binding domain. Length = 123 Score = 58.5 bits (142), Expect = 1e-09 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 10/90 (11%) Query: 75 FESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSK-------KHGQKSQIEGHLF--- 124 D+I G GIP AT LA L +P++ VRK+ + G+ + L Sbjct: 25 GIDPDVIVGIARGGIPLATALARELGIPLVLVRKRISLPSSIKSRGGESVTLLSRLPELL 84 Query: 125 KGARVLVIEDLVTLGNSMFEFVKVIRDSGG 154 KG RVL+++D++ G ++ V++++ +G Sbjct: 85 KGKRVLIVDDVLDTGGTLRAAVELLKKAGA 114 >gnl|CDD|31197 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism]. Length = 203 Score = 49.9 bits (119), Expect = 5e-07 Identities = 28/118 (23%), Positives = 60/118 (50%), Gaps = 9/118 (7%) Query: 44 LYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPM 103 + ID R + I + A ++ + FE +D++ G +G+P AT++A L + Sbjct: 54 IKIDWRSIGKSGSRLRYISEAMADMIMEKVSFE-VDVVVGIAISGVPLATMVAYELGKEL 112 Query: 104 -IYVRKKSKKHGQKSQIEGHL------FKGARVLVIEDLVTLGNSMFEFVKVIRDSGG 154 IY +K +K G + +G R ++++D++T G+++ E ++ +++ GG Sbjct: 113 AIYHPRKHRKDEGA-GKGGSISSNFASVEGKRCVIVDDVITTGSTIKETIEQLKEEGG 169 >gnl|CDD|36924 KOG1712, KOG1712, KOG1712, Adenine phosphoribosyl transferases [Nucleotide transport and metabolism]. Length = 183 Score = 43.3 bits (102), Expect = 5e-05 Identities = 29/135 (21%), Positives = 49/135 (36%), Gaps = 17/135 (12%) Query: 70 LRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIE--------- 120 R ID+IAG E G F +A L + +RK K G+ Sbjct: 52 YRETFEMKIDVIAGLEARGFLFGPSIALALGAGFVPIRKPGKLPGEVISESYELEYGEDR 111 Query: 121 -----GHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARF 175 G + G RV+V++DL+ G ++ +++ G + + PE+ R Sbjct: 112 FEMQKGAIKPGQRVVVVDDLLATGGTLAAATELLERVGAEV---VECACVIELPELKGRE 168 Query: 176 RENNIKLHYLATWND 190 + L L + Sbjct: 169 KLKGKPLFSLLEYQS 183 >gnl|CDD|30383 COG0034, PurF, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]. Length = 470 Score = 36.3 bits (84), Expect = 0.008 Identities = 24/126 (19%), Positives = 51/126 (40%), Gaps = 23/126 (18%) Query: 51 LISFVRARSMIMDLTAKTVLRNIGFE-------SIDIIAGGETAGIPFATLLAERLNLPM 103 + F R S+I ++ + +G + D++ +G P A A +P Sbjct: 250 YVYFARPDSVIDGISVYEARKRMGEKLAEEIPVEADVVIPVPDSGRPAAIGYARASGIPY 309 Query: 104 -------IYVRKKSKKHGQKSQIEG---------HLFKGARVLVIEDLVTLGNSMFEFVK 147 YV + Q+ + +G + KG RV++++D + G + V+ Sbjct: 310 EEGLIKNRYVGRTFIMPTQELREKGVRLKLNPVREVVKGKRVVLVDDSIVRGTTSRRIVQ 369 Query: 148 VIRDSG 153 ++R++G Sbjct: 370 MLREAG 375 >gnl|CDD|35792 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]. Length = 474 Score = 35.3 bits (81), Expect = 0.013 Identities = 26/125 (20%), Positives = 49/125 (39%), Gaps = 23/125 (18%) Query: 52 ISFVRARSMIMDLTAKTVLRNIGF-------ESIDIIAGGETAGIPFATLLAERLNLPMI 104 + F R S+ + TV G D++ +G A A + LP Sbjct: 259 VYFARPDSIFEGQSVYTVRLQCGEQLATEAPVDADVVIPVPDSGTTAALGYAAKSGLPYQ 318 Query: 105 YVRKKSKKHG----QKSQIEGHL------------FKGARVLVIEDLVTLGNSMFEFVKV 148 V +++ G + +Q L F+G RV++++D + G + VK+ Sbjct: 319 EVLIRNRYVGRTFIEPNQRIRQLGVKKKLGPLRQNFEGKRVVLVDDSIVRGTTSSPIVKM 378 Query: 149 IRDSG 153 +R++G Sbjct: 379 LREAG 383 >gnl|CDD|36591 KOG1377, KOG1377, KOG1377, Uridine 5'- monophosphate synthase/orotate phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 261 Score = 31.1 bits (70), Expect = 0.27 Identities = 22/121 (18%), Positives = 39/121 (32%), Gaps = 10/121 (8%) Query: 33 PYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPF- 91 P+ L S S ++ D L + + + A + + F I G + G P Sbjct: 53 PFILKSKTHSDIFFDFS-LFNSGKDLRALAQAYAFLIFEDRKFFDIGNTVGLQYKGGPLK 111 Query: 92 ATLLAERLNLPMI--------YVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMF 143 A+ +N + RK K HG+ + L+ D ++ Sbjct: 112 IASWADLVNAHGVPGRGIIKGLNRKLLKDHGEGGVLLLAELSSKGSLITGDYTEAATAIA 171 Query: 144 E 144 E Sbjct: 172 E 172 >gnl|CDD|32417 COG2236, COG2236, Predicted phosphoribosyltransferases [General function prediction only]. Length = 192 Score = 30.7 bits (69), Expect = 0.31 Identities = 25/177 (14%), Positives = 59/177 (33%), Gaps = 14/177 (7%) Query: 49 RKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNL-PMIYVR 107 + +S+ + L K + I IA G G+ A +L++ L + P+ ++ Sbjct: 4 KLYVSWEEIHRLCRALAEKIRASGFKPDVIVAIARG---GLIPARILSDFLGVKPLYSIK 60 Query: 108 KKSKKHGQKSQIEGHL--------FKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDG 159 + + E + G +VL+++D+V G ++ ++ ++ Sbjct: 61 VEHYDETAERDGEAKVKYPITIDPLSGKKVLIVDDIVDTGETLELALEELKKLAPAEVRT 120 Query: 160 IGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNP 216 L + + D+ + LKI E +++ Sbjct: 121 AVLQYKKSPDYYGEEVTAWAWIIFPWNRKEDLADL--ILKILPEKGDEVEDEWIEYY 175 >gnl|CDD|32248 COG2065, PyrR, Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 179 Score = 29.0 bits (65), Expect = 1.2 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query: 49 RKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERL 99 ++++ R I + + + RN G +++ ++ G +T G+P A LAER+ Sbjct: 4 KEILDEAAIRRTITRIAHEIIERNKGLDNL-VLVGIKTRGVPLAERLAERI 53 >gnl|CDD|48481 cd01908, YafJ, Glutamine amidotransferases class-II (Gn-AT)_YafJ-type. YafJ is a glutamine amidotransferase-like protein of unknown function found in prokaryotes, eukaryotes and archaea. YafJ has a conserved structural fold similar to those of other class II glutamine amidotransferases including lucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS). The YafJ fold is also somwhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.. Length = 257 Score = 28.8 bits (64), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 6/53 (11%) Query: 158 DGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVR 210 DG G+ +Y+ P R+R L W+DI + I + VL VR Sbjct: 42 DGWGIGWYEGKGGRPFRYRSP------LPAWSDINLESLARPIKSPLVLAHVR 88 >gnl|CDD|30915 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]. Length = 225 Score = 27.9 bits (62), Expect = 2.5 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 63 DLTAKTVLRNIGFESIDIIA---GGETAGIPFATLLAERLNLPMIYVRKKSKKHGQ 115 D T + VL G + D + G + A L + +P + R ++ +H + Sbjct: 52 DATDEDVLEEAGIDDADAVVAATGNDEVNSVLALLALKEFGVPRVIARARNPEHEK 107 >gnl|CDD|38577 KOG3367, KOG3367, KOG3367, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 216 Score = 27.4 bits (60), Expect = 3.2 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 17/104 (16%) Query: 66 AKTVLRNIGFESIDIIAGGETAGIPFATLLAERL-------NLPMIY--VRKKSKKHGQK 116 AK +++ IG + I I G F L ERL LPM +R KS + Q Sbjct: 50 AKDIMKEIGNKPI-IFLCVLKGGYKFFADLVERLKNRNSDRPLPMTVDFIRAKSYCNDQS 108 Query: 117 S---QIEG----HLFKGARVLVIEDLVTLGNSMFEFVKVIRDSG 153 + QI G G VL++ED+V G ++ + ++ Sbjct: 109 TGDIQIIGGDDLSTLTGKNVLIVEDIVDTGRTLSTLLSHMKAYK 152 >gnl|CDD|176470 cd01598, PurB, PurB_like adenylosuccinases (adenylsuccinate lyase, ASL). This subgroup contains EcASL, the product of the purB gene in Escherichia coli, and related proteins. It is a member of the Lyase class I family of the Lyase_I superfamily. Members of the Lyase class I family function as homotetramers to catalyze similar beta-elimination reactions in which a Calpha-N or Calpha-O bond is cleaved with the subsequent release of fumarate as one of the products. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two non-sequential steps in the de novo purine biosynthesis pathway: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). Length = 425 Score = 26.4 bits (59), Expect = 6.7 Identities = 10/12 (83%), Positives = 10/12 (83%) Query: 63 DLTAKTVLRNIG 74 DLT TVLRNIG Sbjct: 314 DLTDSTVLRNIG 325 >gnl|CDD|33202 COG3395, COG3395, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 413 Score = 26.5 bits (58), Expect = 6.7 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 56 RARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLP 102 +++ DL + V R + I+AGGET+G L A + Sbjct: 330 AVEALLGDLARRLVARGVRRL---IVAGGETSGAVLGQLGATGFRIG 373 >gnl|CDD|107251 cd01538, PBP1_ABC_xylose_binding, Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR. Length = 288 Score = 26.4 bits (59), Expect = 6.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Query: 115 QKSQIEGHLFKGARVLVI 132 Q SQIE + KG VLVI Sbjct: 44 QISQIENMIAKGVDVLVI 61 >gnl|CDD|30979 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism]. Length = 178 Score = 26.2 bits (58), Expect = 7.2 Identities = 16/75 (21%), Positives = 32/75 (42%), Gaps = 9/75 (12%) Query: 88 GIPFATLLAERLNLPMI--YVRKKSKKHGQKSQIE-------GHLFKGARVLVIEDLVTL 138 PF L ++ P+ ++ S G S E KG VL++ED++ Sbjct: 46 SFPFMADLIRAIDFPLEVDFMHVSSYGGGTSSSGEVKILKDLDEDIKGRDVLIVEDIIDS 105 Query: 139 GNSMFEFVKVIRDSG 153 G ++ + ++++ G Sbjct: 106 GLTLSKVRDLLKERG 120 >gnl|CDD|30169 cd01714, ETF_beta, The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria. The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The beta subunit protein is distantly related to and forms a heterodimer with the alpha subunit.. Length = 202 Score = 25.9 bits (57), Expect = 8.6 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Query: 65 TAKTVLRNIGFESIDIIAGG------ETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQ 118 TAK + I +D+I G +T + LLAE L P I K + G K Sbjct: 96 TAKALAAAIKKIGVDLILTGKQSIDGDTGQVGP--LLAELLGWPQITYVSKIEIEGGKVT 153 Query: 119 IEGHLFKGARVL 130 +E L G + Sbjct: 154 VERELEGGVETV 165 >gnl|CDD|153087 cd01678, PFL1, Pyruvate formate lyase 1. Pyruvate formate lyase catalyzes a key step in anaerobic glycolysis, the conversion of pyruvate and CoenzymeA to formate and acetylCoA. The PFL mechanism involves an unusual radical cleavage of pyruvate in which two cysteines and one glycine form radicals that are required for catalysis. PFL has a ten-stranded alpha/beta barrel domain that is structurally similar to those of all three ribonucleotide reductase (RNR) classes as well as benzylsuccinate synthase and B12-independent glycerol dehydratase. Length = 738 Score = 26.2 bits (58), Expect = 8.8 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 7/43 (16%) Query: 146 VKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATW 188 VK IRD G+ D ++I + P R+ ++ + +A W Sbjct: 531 VKPIRDEDGLAVD------FEIEGDFP-RYGNDDDRADDIAVW 566 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.142 0.418 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,862,195 Number of extensions: 153326 Number of successful extensions: 497 Number of sequences better than 10.0: 1 Number of HSP's gapped: 491 Number of HSP's successfully gapped: 26 Length of query: 228 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 138 Effective length of database: 4,318,927 Effective search space: 596011926 Effective search space used: 596011926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 56 (25.4 bits)