BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] (228 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 469 bits (1206), Expect = e-134, Method: Compositional matrix adjust. Identities = 228/228 (100%), Positives = 228/228 (100%) Query: 1 MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSM 60 MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSM Sbjct: 1 MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSM 60 Query: 61 IMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIE 120 IMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIE Sbjct: 61 IMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIE 120 Query: 121 GHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNI 180 GHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNI Sbjct: 121 GHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNI 180 Query: 181 KLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE 228 KLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE Sbjct: 181 KLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE 228 >gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Score = 28.1 bits (61), Expect = 0.13, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Query: 84 GETAGIPFATL----LAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLV 131 G G PFA A++ LP+I + K+S H Q + EG F G +++ Sbjct: 339 GAIFGCPFADQRDMDFAKKYGLPIIPIMKRSINHSQDIE-EGKAFSGDGIMI 389 >gi|254780323|ref|YP_003064736.1| ATP/ADP translocase [Candidatus Liberibacter asiaticus str. psy62] Length = 491 Score = 26.2 bits (56), Expect = 0.56, Method: Compositional matrix adjust. Identities = 25/109 (22%), Positives = 47/109 (43%), Gaps = 11/109 (10%) Query: 106 VRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFE----FVKVIRDSGGIIQDGIG 161 VR+ +Q G + ++ I ++ LG+++ + F I I+ G G Sbjct: 300 VRQLYPTQNSYAQFMGQFIQWTGIVTIVFMI-LGSNILKSFRWFTSAIITPLMILITGGG 358 Query: 162 LFFYDIFPEVPARFRENNIKL------HYLATWNDILTIAEKLKIFNHD 204 F + IF + F E+ IKL +L + ++L+ A K +F+ Sbjct: 359 FFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDST 407 >gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Score = 24.6 bits (52), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 16/116 (13%) Query: 81 IAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGN 140 I GG + GI LNL ++ K G+K +I + K L+ ++ + Sbjct: 181 IPGGASVGI---------LNLSELF--SKVMGSGRKKKIRMSVQKCYPELMRDE----SD 225 Query: 141 SMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAE 196 + + V RDS ++++ G+ F D F ++ AR N I + D+L + E Sbjct: 226 RLIDMDTVHRDSIQMVEN-YGIVFLDEFDKIVARDSGNGIGVSREGVQRDLLPLVE 280 >gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 23.9 bits (50), Expect = 2.8, Method: Compositional matrix adjust. Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 11/77 (14%) Query: 123 LFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKL 182 + KG + L +E +TLG FE +++ + GL +Y+ + RF + Sbjct: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKA--------GLDYYNHNIDTSERFYPHVTTT 179 Query: 183 HYLATWNDILTIAEKLK 199 H T+ D L E ++ Sbjct: 180 H---TFEDRLQTLENVR 193 >gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Score = 23.9 bits (50), Expect = 2.8, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 140 NSMFEFVKVIRDSGGIIQDGIGLF 163 N+M E VK+I D ++Q G+ F Sbjct: 203 NAMLEEVKLIPDVNNVVQSGLVTF 226 >gi|254780781|ref|YP_003065194.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 285 Score = 23.5 bits (49), Expect = 3.4, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Query: 119 IEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPE----VPAR 174 IE + F GAR ++E + S+ I S II G Y P VP Sbjct: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243 Query: 175 FRENNIK 181 + N+K Sbjct: 244 YPSINLK 250 >gi|254780998|ref|YP_003065411.1| hypothetical protein CLIBASIA_04495 [Candidatus Liberibacter asiaticus str. psy62] Length = 146 Score = 23.5 bits (49), Expect = 3.5, Method: Compositional matrix adjust. Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 8/77 (10%) Query: 5 YFPQQNIIAELVAKMLFEIKAVNFSPENP----YHLTSG--IVSPLYIDCRKLISFVRAR 58 Y QNI+A ++K+ I+ N ++P Y ++ + LYI K I + Sbjct: 38 YMTDQNIVAGCMSKLWMVIEWENKGDQDPIMIFYAVSDSQIVCGLLYI--VKSIYAHKKI 95 Query: 59 SMIMDLTAKTVLRNIGF 75 S I+ + + T+L+++G Sbjct: 96 SEILKMDSLTILQHLGL 112 >gi|254780872|ref|YP_003065285.1| 3-demethylubiquinone-9 3-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 22.3 bits (46), Expect = 6.8, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 105 YVRKKSKKHGQKSQIEGHLFKGARV 129 Y++ K +H Q + H FKG R+ Sbjct: 46 YIQDKIMQHFQCKSDDTHPFKGLRI 70 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.142 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 148,125 Number of Sequences: 1233 Number of extensions: 6153 Number of successful extensions: 28 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 12 length of query: 228 length of database: 328,796 effective HSP length: 71 effective length of query: 157 effective length of database: 241,253 effective search space: 37876721 effective search space used: 37876721 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 37 (18.9 bits)