RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781013|ref|YP_003065426.1| phage-associated protein [Candidatus Liberibacter asiaticus str. psy62] (302 letters) >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Score = 29.6 bits (66), Expect = 0.32 Identities = 10/57 (17%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Query: 119 HSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175 H ++ ++E +R Y + +E++ + +N+ P + IKK Sbjct: 1 HHHHMIEYRIEEAVAKYREFY--EFKPVRESAGIEDVKSAIEHTNLKPFATPDDIKK 55 >d1zt2a1 d.264.1.1 (A:3-329) DNA primase small subunit PriA {Sulfolobus solfataricus [TaxId: 2287]} Length = 327 Score = 26.9 bits (59), Expect = 2.5 Identities = 14/91 (15%), Positives = 32/91 (35%), Gaps = 20/91 (21%) Query: 74 VYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEIGEIM--ESIWNKYQSHST-EQLQEIVQ 129 + F+ Y+ + +E+ D+ R E + ++ S S+ E+L++ + Sbjct: 12 IKSFFRNYYLNAELELPKDMELR--------EFALQPFGSDTYVRHLSFSSSEELRDYLV 63 Query: 130 EENKTWRRLY-------DPNDPNTNRTITVE 153 N L+ P+ N + Sbjct: 64 NRNLP-LHLFYSSARYQLPSARNMEEKAWMG 93 >d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 122 Score = 25.1 bits (55), Expect = 6.9 Identities = 5/36 (13%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 98 PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133 ++ + E +M+ +W++ + + Q+ E + Sbjct: 3 TRLGDLER-AVMDHLWSRTEPQTVRQVHEALSARRD 37 >d2o8ra2 d.322.1.2 (A:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} Length = 205 Score = 25.3 bits (55), Expect = 7.1 Identities = 7/83 (8%), Positives = 24/83 (28%), Gaps = 3/83 (3%) Query: 79 KYFDSHPIEVIMDLSF---RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135 ++F ++ + ++ I + + + + + L + + + Sbjct: 19 RFFHEEIFPLLYPMLLLPSKVRTFIRSGRVYLAVRLKEKETDEAYSYALLNVPTDGLPRF 78 Query: 136 RRLYDPNDPNTNRTITVEEITKM 158 L +E+I K Sbjct: 79 VELPRLQTDTFYYYSFLEDIIKE 101 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.134 0.397 Gapped Lambda K H 0.267 0.0543 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,139,225 Number of extensions: 53062 Number of successful extensions: 166 Number of sequences better than 10.0: 1 Number of HSP's gapped: 166 Number of HSP's successfully gapped: 19 Length of query: 302 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 217 Effective length of database: 1,240,546 Effective search space: 269198482 Effective search space used: 269198482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.6 bits)