BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] (116 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 241 bits (616), Expect = 2e-66, Method: Compositional matrix adjust. Identities = 116/116 (100%), Positives = 116/116 (100%) Query: 1 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKP 60 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKP Sbjct: 1 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMTATSGTVGYASNLCNAKP 60 Query: 61 EICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH 116 EICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH Sbjct: 61 EICLLWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYPPPLPSHH 116 >gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Score = 23.5 bits (49), Expect = 1.1, Method: Compositional matrix adjust. Identities = 10/45 (22%), Positives = 19/45 (42%) Query: 65 LWKKIMRNVKRHTLNGAKIVYGFAKSALEKNERESVAIHSKNEYP 109 +W+ I R +RH L + + N+ + I +N +P Sbjct: 9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWP 53 >gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 154 Score = 23.1 bits (48), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 77 TLNGAKIVYGFAKSALEKNERESVAIHSKNE 107 TLNG I+ G AK + NE I S+N+ Sbjct: 5 TLNGLSILGGKAKPCDDPNEALLERIPSQNK 35 >gi|254781213|ref|YP_003065626.1| head-to-tail joining protein, putative [Candidatus Liberibacter asiaticus str. psy62] Length = 556 Score = 21.6 bits (44), Expect = 4.7, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 80 GAKIVYGFAKSALEKNERESVAI 102 G K++ KSAL +NE E I Sbjct: 191 GDKVLSSKMKSALARNENERFTI 213 >gi|254781165|ref|YP_003065578.1| pyridoxamine 5'-phosphate oxidase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 21.2 bits (43), Expect = 5.9, Method: Compositional matrix adjust. Identities = 7/20 (35%), Positives = 11/20 (55%) Query: 55 LCNAKPEICLLWKKIMRNVK 74 L N K +C WK + R ++ Sbjct: 75 LENPKASLCFHWKSLARQLR 94 >gi|254780851|ref|YP_003065264.1| hypothetical protein CLIBASIA_03730 [Candidatus Liberibacter asiaticus str. psy62] Length = 64 Score = 20.8 bits (42), Expect = 8.1, Method: Compositional matrix adjust. Identities = 8/43 (18%), Positives = 24/43 (55%) Query: 1 MFWIAKKFFWISVLLIVLSNVYAQPFLEETEKGKKTEITDFMT 43 +FW + + W++++ ++N+Y Q + +K + ++ + T Sbjct: 2 LFWRREIYRWVNLVTGKIANLYLQKIETKDDKFEYCDVWNGQT 44 >gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Score = 20.4 bits (41), Expect = 9.0, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 40 DFMTATSGTVGYASNLCNAKP 60 DF+ S +GY S C+ P Sbjct: 399 DFIEKFSAQIGYLSQHCSLFP 419 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.133 0.408 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,061 Number of Sequences: 1233 Number of extensions: 2499 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 116 length of database: 328,796 effective HSP length: 63 effective length of query: 53 effective length of database: 251,117 effective search space: 13309201 effective search space used: 13309201 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)