BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] gi|254040692|gb|ACT57488.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 134 bits (336), Expect = 5e-30, Method: Composition-based stats. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH Sbjct: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 Query: 61 NKILLKEYSSDNNNNKKL 78 NKILLKEYSSDNNNNKKL Sbjct: 61 NKILLKEYSSDNNNNKKL 78 >gi|150395842|ref|YP_001326309.1| peptidoglycan binding domain-containing protein [Sinorhizobium medicae WSM419] gi|150027357|gb|ABR59474.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium medicae WSM419] Length = 312 Score = 110 bits (275), Expect = 6e-23, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 9/79 (11%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57 + F ++ +NA+W Q G+HPSP+ TR P + R+ G V + TF +E+ G Sbjct: 55 VVFSFVAANAMWYQHGRHPSPLLRTRVPLVSPEVAERLAAAKGEPVQQRNVTTFVIEREG 114 Query: 58 DQHNKILLKEYSSDNNNNK 76 + +++ + D +N + Sbjct: 115 ETP----VRDAAPDGSNER 129 >gi|307304332|ref|ZP_07584084.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti BL225C] gi|307319437|ref|ZP_07598864.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti AK83] gi|306894809|gb|EFN25568.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti AK83] gi|306902800|gb|EFN33393.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti BL225C] Length = 319 Score = 98.7 bits (244), Expect = 2e-19, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 9/79 (11%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57 + F ++ +NA+W Q G HPSP+ TR P + R+ G V + TF +E+ G Sbjct: 55 VVFSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREG 114 Query: 58 DQHNKILLKEYSSDNNNNK 76 D + ++ +N + Sbjct: 115 DAKAG----DAATAGSNER 129 >gi|195970188|ref|NP_385109.2| hypothetical protein SMc00060 [Sinorhizobium meliloti 1021] gi|187904159|emb|CAC45575.2| Hypothetical protein SMc00060 [Sinorhizobium meliloti 1021] Length = 319 Score = 98.7 bits (244), Expect = 2e-19, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 9/79 (11%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57 + F ++ +NA+W Q G HPSP+ TR P + R+ G V + TF +E+ G Sbjct: 55 VVFSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREG 114 Query: 58 DQHNKILLKEYSSDNNNNK 76 D + ++ +N + Sbjct: 115 DAKAG----DAATAGSNER 129 >gi|227821338|ref|YP_002825308.1| putative peptidoglycan-binding protein [Sinorhizobium fredii NGR234] gi|227340337|gb|ACP24555.1| putative peptidoglycan-binding protein [Sinorhizobium fredii NGR234] Length = 326 Score = 98.3 bits (243), Expect = 3e-19, Method: Composition-based stats. Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57 + F ++ +NA+W Q G HPSP+ TR P + R+ +G V K TF +E+ G Sbjct: 59 VVFSFVAANAMWYQHGNHPSPLLRTRVPLVGPEVAERLAAANGEAVEPRKVTTFVIEREG 118 Query: 58 DQHNKILLKEYSSDNNNNKKL 78 + ++ + + ++ +++ L Sbjct: 119 EARSEQVKEAPAAQGESSENL 139 >gi|218674837|ref|ZP_03524506.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli GR56] Length = 318 Score = 96.4 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 F+ F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 68 FVIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 125 >gi|86356893|ref|YP_468785.1| putative peptidoglycan-binding protein (cell wall degradation activity) [Rhizobium etli CFN 42] gi|86280995|gb|ABC90058.1| putative peptidoglycan-binding protein (cell wall degradation activity) [Rhizobium etli CFN 42] Length = 296 Score = 96.4 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKD--KGITFKVEKVGD 58 F+ F ++ +NALW Q G HP PIF TR PQS + LG+ + TF++E+ D Sbjct: 47 FVIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPADEQPADVTTFRIERPED 104 >gi|241203749|ref|YP_002974845.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240857639|gb|ACS55306.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 317 Score = 95.2 bits (235), Expect = 3e-18, Method: Composition-based stats. Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGDQH 60 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 69 VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPRDTA 127 Query: 61 NKILLKEYSSDNNNNKKL 78 ++ +L Sbjct: 128 TTNATPAPAAPGQQPSQL 145 >gi|116251151|ref|YP_766989.1| peptidoglycan binding transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] gi|115255799|emb|CAK06880.1| putative peptidoglycan binding transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 317 Score = 94.5 bits (233), Expect = 4e-18, Method: Composition-based stats. Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGDQH 60 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 69 VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPQDTA 127 Query: 61 NKILLKEYSSDNNNNKKL 78 ++ +L Sbjct: 128 TTNATPAPAAPGQQPSQL 145 >gi|190890966|ref|YP_001977508.1| peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CIAT 652] gi|218516730|ref|ZP_03513570.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli 8C-3] gi|190696245|gb|ACE90330.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CIAT 652] Length = 318 Score = 94.5 bits (233), Expect = 5e-18, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 69 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125 >gi|218661838|ref|ZP_03517768.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli IE4771] Length = 318 Score = 94.1 bits (232), Expect = 5e-18, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 + F ++ +NALW Q G HP PI TR PQS + LG+ + +G TF++E+ D Sbjct: 69 VIFSFVAANALWYQPGLHPHPILRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125 >gi|327193899|gb|EGE60774.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli CNPAF512] Length = 318 Score = 94.1 bits (232), Expect = 5e-18, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 69 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125 >gi|218508965|ref|ZP_03506843.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli Brasil 5] Length = 272 Score = 93.3 bits (230), Expect = 1e-17, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 23 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 79 >gi|209548488|ref|YP_002280405.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534244|gb|ACI54179.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 307 Score = 92.9 bits (229), Expect = 1e-17, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58 + F ++ +NALW Q G HP PIF TR PQS + LG+ + +G TF++E+ D Sbjct: 58 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 114 >gi|222085301|ref|YP_002543831.1| peptidoglycan-binding protein (cell wall degradation activity) [Agrobacterium radiobacter K84] gi|221722749|gb|ACM25905.1| peptidoglycan-binding protein (cell wall degradation activity) [Agrobacterium radiobacter K84] Length = 280 Score = 84.1 bits (206), Expect = 6e-15, Method: Composition-based stats. Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 13/80 (16%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTRHPQSY-----RIFLGSGSEVSKDKGITFKVEKV 56 F F ++ +NALW Q G HPSP+ TR P + R G + TF++E+ Sbjct: 74 FAVFGFVTANALWYQVGIHPSPLLRTREPGAPYQIPGRKAFLLGQQADTGNVTTFRIERQ 133 Query: 57 GDQHNKILLKEYSSDNNNNK 76 E S+D +N+ Sbjct: 134 DS--------EASNDAASNQ 145 >gi|315122514|ref|YP_004063003.1| hypothetical protein CKC_03830 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495916|gb|ADR52515.1| hypothetical protein CKC_03830 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 138 Score = 77.1 bits (188), Expect = 6e-13, Method: Composition-based stats. Identities = 44/79 (55%), Positives = 55/79 (69%), Gaps = 3/79 (3%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVS---KDKGITFKVEKVGDQ 59 + F WIL NALWNQ GKHPSPIFTTRH QS RI LGS ++K +TFKV+++GD+ Sbjct: 40 VIFLWILFNALWNQKGKHPSPIFTTRHSQSNRIILGSNHNSKDFFQEKSMTFKVKRMGDR 99 Query: 60 HNKILLKEYSSDNNNNKKL 78 ++ ILL + SS N K L Sbjct: 100 YDTILLHDSSSVEKNKKLL 118 >gi|325292299|ref|YP_004278163.1| peptidoglycan binding protein [Agrobacterium sp. H13-3] gi|325060152|gb|ADY63843.1| putative peptidoglycan binding protein [Agrobacterium sp. H13-3] Length = 307 Score = 77.1 bits (188), Expect = 7e-13, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLG--SGSEV-SKDKGITFKVEKVGDQ 59 + F ++ +NALW Q G HPSP TR + G + + ++ TF++E+ + Sbjct: 47 VVFGFVAANALWYQPGVHPSPFLRTRDAANPNGIAGYRAAEPLGTQGHVTTFRIERPSET 106 >gi|15888260|ref|NP_353941.1| putative peptidoglycan binding protein [Agrobacterium tumefaciens str. C58] gi|15155918|gb|AAK86726.1| putative peptidoglycan binding protein [Agrobacterium tumefaciens str. C58] Length = 306 Score = 77.1 bits (188), Expect = 8e-13, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSK----DKGITFKVEKVGD 58 + F ++ +NALW Q G HP+P TR ++ G TF++E+ + Sbjct: 50 VVFGFVAANALWYQPGVHPTPFLRTRDAENPNGIAGY-RPTEPLGTHGNVTTFRIERPAE 108 >gi|222147979|ref|YP_002548936.1| hypothetical protein Avi_1306 [Agrobacterium vitis S4] gi|221734967|gb|ACM35930.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 374 Score = 70.2 bits (170), Expect = 8e-11, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 9 LSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGS----EVSKDKGITFKVEKV 56 +NA W Q G+HPSP TR P + LG S + D TF++++ Sbjct: 54 AANAFWYQPGRHPSPFLRTRDPHDFTAMLGLNSNHSLKPDPDDVTTFRIQRQ 105 >gi|163759055|ref|ZP_02166141.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43] gi|162283459|gb|EDQ33744.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43] Length = 320 Score = 67.1 bits (162), Expect = 8e-10, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 9/66 (13%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS---------GSEVSKDKGITFKV 53 + F +I +NALW+Q G HP+PI TR + ++V TF++ Sbjct: 35 VIFSFISANALWSQPGNHPAPILKTREVGPPTAHALTPVADTAAPAVADVPARSVTTFRI 94 Query: 54 EKVGDQ 59 E+ + Sbjct: 95 ERSDET 100 >gi|218458840|ref|ZP_03498931.1| putative peptidoglycan binding (cell wall degradation) protein [Rhizobium etli Kim 5] Length = 236 Score = 64.0 bits (154), Expect = 6e-09, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query: 17 TGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGDQ 59 G HP PI TR PQS + LG+ + +G TF++E+ D Sbjct: 1 PGLHPHPILRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPEDA 44 >gi|304393565|ref|ZP_07375493.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130] gi|303294572|gb|EFL88944.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130] Length = 262 Score = 47.5 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 5/69 (7%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTR----HPQSYRIFLGSGSEVSKDKGITFKVEKVGD 58 + I++NA+W Q GKHP+P+F+TR P S + + + T V D Sbjct: 39 VMMAAIVTNAVWYQPGKHPAPLFSTRVAAVEPTSKSVPAIKTVKTTSVNPATKVVTAE-D 97 Query: 59 QHNKILLKE 67 ++ +L+E Sbjct: 98 AASREVLRE 106 >gi|118593468|ref|ZP_01550848.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614] gi|118433947|gb|EAV40605.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614] Length = 259 Score = 42.5 bits (98), Expect = 0.021, Method: Composition-based stats. Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Query: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRH-PQSYRIFLGSGSE--VSKDKGITFKVEKVG 57 M L C I++NA+ Q G+HP+P+FTTR P S ++ G + + T ++ Sbjct: 43 MGLTACLIVANAVGLQPGRHPAPLFTTRDRPDSMQLPEPDGRSPGLQVQEISTLVLDLQI 102 Query: 58 DQHNKILLKEYSSDNNN 74 KI L E D N Sbjct: 103 SLR-KIGLYEGPLDGLN 118 >gi|294851948|ref|ZP_06792621.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026] gi|294820537|gb|EFG37536.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026] Length = 338 Score = 41.3 bits (95), Expect = 0.040, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|17987639|ref|NP_540273.1| peptidoglycan binding domain-containing protein [Brucella melitensis bv. 1 str. 16M] gi|260545698|ref|ZP_05821439.1| peptidoglycan-binding domain 1 protein [Brucella abortus NCTC 8038] gi|260563641|ref|ZP_05834127.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1 str. 16M] gi|260566833|ref|ZP_05837303.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 4 str. 40] gi|261757799|ref|ZP_06001508.1| peptidoglycan-binding domain 1 protein [Brucella sp. F5/99] gi|265999562|ref|ZP_05466915.2| peptidoglycan binding domain-containing protein [Brucella melitensis bv. 2 str. 63/9] gi|17983350|gb|AAL52537.1| peptidoglycan binding domain containing protein [Brucella melitensis bv. 1 str. 16M] gi|260097105|gb|EEW80980.1| peptidoglycan-binding domain 1 protein [Brucella abortus NCTC 8038] gi|260153657|gb|EEW88749.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1 str. 16M] gi|260156351|gb|EEW91431.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 4 str. 40] gi|261737783|gb|EEY25779.1| peptidoglycan-binding domain 1 protein [Brucella sp. F5/99] gi|263094677|gb|EEZ18456.1| peptidoglycan binding domain-containing protein [Brucella melitensis bv. 2 str. 63/9] gi|326408602|gb|ADZ65667.1| Putative peptidoglycan binding domain 1 [Brucella melitensis M28] gi|326538323|gb|ADZ86538.1| peptidoglycan-binding domain 1 protein [Brucella melitensis M5-90] Length = 299 Score = 41.3 bits (95), Expect = 0.040, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 24 LVVMGFVSANALWYQPEAHDAVFFRTR 50 >gi|306842151|ref|ZP_07474820.1| peptidoglycan binding domain-containing protein [Brucella sp. BO2] gi|306287738|gb|EFM59169.1| peptidoglycan binding domain-containing protein [Brucella sp. BO2] Length = 322 Score = 41.3 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 47 LVVMGFVSANALWYQPEAHDAVFFRTR 73 >gi|62289545|ref|YP_221338.1| peptidoglycan-binding protein [Brucella abortus bv. 1 str. 9-941] gi|62195677|gb|AAX73977.1| hypothetical peptidoglycan-binding protein [Brucella abortus bv. 1 str. 9-941] Length = 322 Score = 41.3 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 47 LVVMGFVSANALWYQPEAHDAVFFRTR 73 >gi|23501467|ref|NP_697594.1| peptidoglycan-binding protein [Brucella suis 1330] gi|82699474|ref|YP_414048.1| peptidoglycan binding domain-containing protein [Brucella melitensis biovar Abortus 2308] gi|148560514|ref|YP_001258575.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840] gi|161618553|ref|YP_001592440.1| peptidoglycan binding domain-containing protein [Brucella canis ATCC 23365] gi|189023802|ref|YP_001934570.1| peptidoglycan binding domain 1 [Brucella abortus S19] gi|225627085|ref|ZP_03785123.1| peptidoglycan-binding protein [Brucella ceti str. Cudo] gi|225852107|ref|YP_002732340.1| peptidoglycan-binding domain 1 protein [Brucella melitensis ATCC 23457] gi|254688863|ref|ZP_05152117.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6 str. 870] gi|254696994|ref|ZP_05158822.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2 str. 86/8/59] gi|254701373|ref|ZP_05163201.1| Peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str. 513] gi|254703918|ref|ZP_05165746.1| Peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str. 686] gi|254707706|ref|ZP_05169534.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M163/99/10] gi|254709711|ref|ZP_05171522.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis B2/94] gi|254712866|ref|ZP_05174677.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1] gi|254716780|ref|ZP_05178591.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1] gi|254729895|ref|ZP_05188473.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4 str. 292] gi|256031202|ref|ZP_05444816.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M292/94/1] gi|256044287|ref|ZP_05447191.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1 str. Rev.1] gi|256060710|ref|ZP_05450874.1| Peptidoglycan-binding domain 1 protein [Brucella neotomae 5K33] gi|256113120|ref|ZP_05453997.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 3 str. Ether] gi|256159300|ref|ZP_05457095.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M490/95/1] gi|256254610|ref|ZP_05460146.1| Peptidoglycan-binding domain 1 protein [Brucella ceti B1/94] gi|256257111|ref|ZP_05462647.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 9 str. C68] gi|256369017|ref|YP_003106525.1| peptidoglycan-binding protein, putative [Brucella microti CCM 4915] gi|260168338|ref|ZP_05755149.1| peptidoglycan-binding protein, putative [Brucella sp. F5/99] gi|260754347|ref|ZP_05866695.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6 str. 870] gi|260757566|ref|ZP_05869914.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4 str. 292] gi|260761391|ref|ZP_05873734.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2 str. 86/8/59] gi|260883372|ref|ZP_05894986.1| peptidoglycan binding domain-containing protein [Brucella abortus bv. 9 str. C68] gi|261218577|ref|ZP_05932858.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1] gi|261221785|ref|ZP_05936066.1| peptidoglycan binding domain-containing protein [Brucella ceti B1/94] gi|261315200|ref|ZP_05954397.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M163/99/10] gi|261317243|ref|ZP_05956440.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis B2/94] gi|261320574|ref|ZP_05959771.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1] gi|261324701|ref|ZP_05963898.1| peptidoglycan binding domain-containing protein [Brucella neotomae 5K33] gi|261751911|ref|ZP_05995620.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str. 513] gi|261754569|ref|ZP_05998278.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str. 686] gi|265988282|ref|ZP_06100839.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M292/94/1] gi|265990698|ref|ZP_06103255.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1 str. Rev.1] gi|265994530|ref|ZP_06107087.1| peptidoglycan binding domain-containing protein [Brucella melitensis bv. 3 str. Ether] gi|265997749|ref|ZP_06110306.1| peptidoglycan binding domain-containing protein [Brucella ceti M490/95/1] gi|297247958|ref|ZP_06931676.1| peptidoglycan-binding protein [Brucella abortus bv. 5 str. B3196] gi|23347371|gb|AAN29509.1| peptidoglycan-binding protein, putative [Brucella suis 1330] gi|82615575|emb|CAJ10558.1| Putative peptidoglycan binding domain 1 [Brucella melitensis biovar Abortus 2308] gi|148371771|gb|ABQ61750.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840] gi|161335364|gb|ABX61669.1| Peptidoglycan-binding domain 1 protein [Brucella canis ATCC 23365] gi|189019374|gb|ACD72096.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19] gi|225617920|gb|EEH14964.1| peptidoglycan-binding protein [Brucella ceti str. Cudo] gi|225640472|gb|ACO00386.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis ATCC 23457] gi|255999177|gb|ACU47576.1| peptidoglycan-binding protein, putative [Brucella microti CCM 4915] gi|260667884|gb|EEX54824.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4 str. 292] gi|260671823|gb|EEX58644.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2 str. 86/8/59] gi|260674455|gb|EEX61276.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6 str. 870] gi|260872900|gb|EEX79969.1| peptidoglycan binding domain-containing protein [Brucella abortus bv. 9 str. C68] gi|260920369|gb|EEX87022.1| peptidoglycan binding domain-containing protein [Brucella ceti B1/94] gi|260923666|gb|EEX90234.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1] gi|261293264|gb|EEX96760.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1] gi|261296466|gb|EEX99962.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis B2/94] gi|261300681|gb|EEY04178.1| peptidoglycan binding domain-containing protein [Brucella neotomae 5K33] gi|261304226|gb|EEY07723.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M163/99/10] gi|261741664|gb|EEY29590.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str. 513] gi|261744322|gb|EEY32248.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str. 686] gi|262552217|gb|EEZ08207.1| peptidoglycan binding domain-containing protein [Brucella ceti M490/95/1] gi|262765643|gb|EEZ11432.1| peptidoglycan binding domain-containing protein [Brucella melitensis bv. 3 str. Ether] gi|263001482|gb|EEZ14057.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1 str. Rev.1] gi|264660479|gb|EEZ30740.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis M292/94/1] gi|297175127|gb|EFH34474.1| peptidoglycan-binding protein [Brucella abortus bv. 5 str. B3196] Length = 338 Score = 41.3 bits (95), Expect = 0.046, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|163842856|ref|YP_001627260.1| peptidoglycan binding domain-containing protein [Brucella suis ATCC 23445] gi|163673579|gb|ABY37690.1| Peptidoglycan-binding domain 1 protein [Brucella suis ATCC 23445] Length = 338 Score = 41.3 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|306845192|ref|ZP_07477768.1| peptidoglycan binding domain-containing protein [Brucella sp. BO1] gi|306274351|gb|EFM56158.1| peptidoglycan binding domain-containing protein [Brucella sp. BO1] Length = 338 Score = 41.3 bits (95), Expect = 0.047, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|254693344|ref|ZP_05155172.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3 str. Tulya] gi|261213593|ref|ZP_05927874.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3 str. Tulya] gi|260915200|gb|EEX82061.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3 str. Tulya] Length = 338 Score = 41.3 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|254718729|ref|ZP_05180540.1| Peptidoglycan-binding domain 1 protein [Brucella sp. 83/13] gi|265983705|ref|ZP_06096440.1| peptidoglycan-binding domain 1 protein [Brucella sp. 83/13] gi|306838707|ref|ZP_07471542.1| peptidoglycan binding domain-containing protein [Brucella sp. NF 2653] gi|264662297|gb|EEZ32558.1| peptidoglycan-binding domain 1 protein [Brucella sp. 83/13] gi|306406194|gb|EFM62438.1| peptidoglycan binding domain-containing protein [Brucella sp. NF 2653] Length = 338 Score = 40.9 bits (94), Expect = 0.051, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89 >gi|90419110|ref|ZP_01227021.1| peptidoglycan-binding protein [Aurantimonas manganoxydans SI85-9A1] gi|90337190|gb|EAS50895.1| peptidoglycan-binding protein [Aurantimonas manganoxydans SI85-9A1] Length = 249 Score = 39.8 bits (91), Expect = 0.11, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 3 LFFCWILSNALWNQTGKHPSPIFTTRHPQSY 33 + F + NA+ +Q G HPSP TR P Sbjct: 35 ILFGGVAINAM-HQPGPHPSPFLATREPGKG 64 >gi|319784577|ref|YP_004144053.1| peptidoglycan-binding domain 1 protein [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170465|gb|ADV14003.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 265 Score = 39.4 bits (90), Expect = 0.15, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Query: 7 WILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKI 63 ++ +NALW Q H F TR + + TF + + I Sbjct: 48 YVSANALWYQPFPHAGAFFATR----SIAGFPHATPDEPE--TTFNIVRPSGAPAPI 98 >gi|239831438|ref|ZP_04679767.1| peptidoglycan binding domain-containing protein [Ochrobactrum intermedium LMG 3301] gi|239823705|gb|EEQ95273.1| peptidoglycan binding domain-containing protein [Ochrobactrum intermedium LMG 3301] Length = 123 Score = 39.4 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F TR Sbjct: 47 LVVMSFVSANALWYQPEAHNAVFFRTR 73 >gi|153010008|ref|YP_001371223.1| peptidoglycan-binding domain-containing protein [Ochrobactrum anthropi ATCC 49188] gi|151561896|gb|ABS15394.1| Peptidoglycan-binding domain 1 protein [Ochrobactrum anthropi ATCC 49188] Length = 328 Score = 39.0 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NALW Q H + F+TR Sbjct: 47 LVVMSFVSANALWYQPEAHKAVFFSTR 73 >gi|328544565|ref|YP_004304674.1| peptidoglycan binding domain protein [polymorphum gilvum SL003B-26A1] gi|326414307|gb|ADZ71370.1| Putative peptidoglycan binding domain protein [Polymorphum gilvum SL003B-26A1] Length = 229 Score = 38.6 bits (88), Expect = 0.25, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 6/53 (11%) Query: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKV 53 M L C I++NA+ Q G+HP+P+ TR R + + T V Sbjct: 22 MALTGCLIVANAVGLQPGRHPAPLLITR----ERPAAIA--TAEERTVATLPV 68 >gi|254501042|ref|ZP_05113193.1| Putative peptidoglycan binding domain protein [Labrenzia alexandrii DFL-11] gi|222437113|gb|EEE43792.1| Putative peptidoglycan binding domain protein [Labrenzia alexandrii DFL-11] Length = 249 Score = 38.6 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 20/29 (68%) Query: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRH 29 M L C I++NAL Q G+HP+P +TTR Sbjct: 38 MGLTACLIVANALGLQPGRHPAPYYTTRD 66 >gi|110633235|ref|YP_673443.1| peptidoglycan binding domain-containing protein [Mesorhizobium sp. BNC1] gi|110284219|gb|ABG62278.1| Peptidoglycan-binding domain 1 [Chelativorans sp. BNC1] Length = 266 Score = 38.6 bits (88), Expect = 0.30, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 2 FLFFCWILSNALWNQTGKHPSPIFTTR 28 + ++ +NAL+ Q HPS +TR Sbjct: 48 LVSLAFVSANALFYQPQVHPSAFLSTR 74 >gi|13476355|ref|NP_107925.1| hypothetical protein mlr7650 [Mesorhizobium loti MAFF303099] gi|14027116|dbj|BAB54070.1| mlr7650 [Mesorhizobium loti MAFF303099] Length = 270 Score = 36.7 bits (83), Expect = 1.00, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Query: 7 WILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 ++ +NALW Q H F TR+ F G S + T + + Sbjct: 48 YVSANALWYQPFPHAGAFFATRN------FQGFPHTASDEPETTINIVRPNAAP 95 >gi|260462409|ref|ZP_05810617.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium opportunistum WSM2075] gi|259031903|gb|EEW33171.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium opportunistum WSM2075] Length = 278 Score = 36.7 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Query: 7 WILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKI 63 ++ +NALW Q H F TR F G + + T + + I Sbjct: 48 YVSANALWYQPFPHAGAFFATRS------FQGFPHTATDEPETTINIVRPNAAPAPI 98 >gi|323137203|ref|ZP_08072282.1| Peptidoglycan-binding domain 1 protein [Methylocystis sp. ATCC 49242] gi|322397561|gb|EFY00084.1| Peptidoglycan-binding domain 1 protein [Methylocystis sp. ATCC 49242] Length = 238 Score = 35.2 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 20/32 (62%) Query: 8 ILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS 39 + NAL+ Q G+HP+P+F+T P + + + Sbjct: 63 VPMNALFFQDGRHPAPLFSTHLPVAEKTETAA 94 >gi|170751051|ref|YP_001757311.1| peptidoglycan binding domain-containing protein [Methylobacterium radiotolerans JCM 2831] gi|170657573|gb|ACB26628.1| Peptidoglycan-binding domain 1 protein [Methylobacterium radiotolerans JCM 2831] Length = 241 Score = 35.2 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 6 CWILSNALWNQTGKHPSPIF 25 ++ NAL QTG+HP+PI Sbjct: 63 GFVCVNALGYQTGRHPAPIL 82 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.301 0.124 0.341 Lambda K H 0.267 0.0370 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 510,548,783 Number of Sequences: 14124377 Number of extensions: 11836425 Number of successful extensions: 46771 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 46712 Number of HSP's gapped (non-prelim): 46 length of query: 78 length of database: 4,842,793,630 effective HSP length: 49 effective length of query: 29 effective length of database: 4,150,699,157 effective search space: 120370275553 effective search space used: 120370275553 T: 11 A: 40 X1: 16 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.8 bits) S2: 75 (33.6 bits)