RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) >gnl|CDD|128336 smart00020, Tryp_SPc, Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues. Length = 229 Score = 28.0 bits (63), Expect = 0.56 Identities = 18/70 (25%), Positives = 26/70 (37%), Gaps = 16/70 (22%) Query: 6 CWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILL 65 W+L+ A H P + R+ LGS S ++G KV KV H Sbjct: 36 RWVLTAA-------HC---VYGSDPSNIRVRLGSHDLSSGEEGQVIKVSKVI-IHPN--- 81 Query: 66 KEYSSDNNNN 75 Y+ +N Sbjct: 82 --YNPSTYDN 89 >gnl|CDD|181819 PRK09395, actP, acetate permease; Provisional. Length = 551 Score = 26.5 bits (59), Expect = 1.7 Identities = 8/23 (34%), Positives = 10/23 (43%) Query: 8 ILSNALWNQTGKHPSPIFTTRHP 30 ILS +W H IF +P Sbjct: 479 ILSPTVWVDILGHEKAIFPYEYP 501 >gnl|CDD|179879 PRK04792, tolB, translocation protein TolB; Provisional. Length = 448 Score = 26.1 bits (58), Expect = 2.0 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Query: 14 WNQTGKHPSPIFTTRH---PQSYRIFLGSGS 41 W+ GK S IFT+ PQ YR+ L SG Sbjct: 313 WHPDGK--SLIFTSERGGKPQIYRVNLASGK 341 >gnl|CDD|178107 PLN02489, PLN02489, homocysteine S-methyltransferase. Length = 335 Score = 25.7 bits (57), Expect = 2.5 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Query: 5 FCWILSNALWNQTGKHPS--PIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 F ++ G+ S PI SY +L GSE S D G + +EK+ D H Sbjct: 112 FWDKCQKGSTSRPGRELSYRPILVAASIGSYGAYLADGSEYSGDYGPSVTLEKLKDFH 169 >gnl|CDD|151526 pfam11081, DUF2890, Protein of unknown function (DUF2890). This family is conserved in dsDNA adenoviruses of vertebrates. The function is not known. Length = 172 Score = 24.5 bits (53), Expect = 5.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Query: 14 WNQTGKHPSP 23 W+QTG+ P+P Sbjct: 93 WDQTGRFPNP 102 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.135 0.419 Gapped Lambda K H 0.267 0.0738 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,203,314 Number of extensions: 57903 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 8 Length of query: 78 Length of database: 5,994,473 Length adjustment: 48 Effective length of query: 30 Effective length of database: 4,957,289 Effective search space: 148718670 Effective search space used: 148718670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)