HHsearch alignment for GI: 254781016 and conserved domain: COG0153

>COG0153 GalK Galactokinase [Carbohydrate transport and metabolism].
Probab=98.61  E-value=0.00011  Score=53.27  Aligned_cols=281  Identities=19%  Similarity=0.222  Sum_probs=154.2

Q ss_pred             CCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEE-ECCEECCC-----CCHHHHHH
Q ss_conf             7763789748842488116776701175789843468127810799997178885799-87872566-----52068999
Q gi|254781016|r   20 INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII-LNGQKISS-----QSSFFKKT   93 (355)
Q Consensus        20 ~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~-lnG~~~~~-----~~~~~~ri   93 (355)
T Consensus        20 ~~~~~~~~aPGRvNLIGEHtDYn~G~VlP~A------i-n~~t~v~v~~r~d~~v~l~s~n~~~~~~~~~~~~d~~~~~~   92 (390)
T COG0153          20 VEPTVTAFAPGRVNLIGEHTDYNGGFVLPCA------I-NYGTYVAVAKRDDGKVRLYSANFGNAGDIFFLLLDIAKEKI   92 (390)
T ss_pred             CCCCEEECCCCEEEEECCCEECCCCEEEEEE------E-ECCEEEEEEECCCCEEEEEECCCCCCCCEEECCHHHCCCCC
T ss_conf             3764576178558860122212686678889------6-05428999973685599996787633424304433144531


Q ss_pred             HHHHHHHHH------HCCC---EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC----CCC
Q ss_conf             999742167------6194---399998502332110123224799999999998188999889998865213----530
Q gi|254781016|r   94 TQFCDLFRQ------FSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS----GSA  160 (355)
Q Consensus        94 ~~~l~~~r~------~~~~---~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS----GSA  160 (355)
T Consensus        93 ~~W~nYvkgvi~~l~~~g~~~~G~~i~i~gnIP~GaGLSSSAAleva~~~al~~l~~~~~~k~~la~i~q~AEn~fvGvn  172 (390)
T COG0153          93 DDWANYVKGVIKALQKRGYAFTGLDIVISGNIPIGAGLSSSAALEVAVALALQRLFNLPLDKAELAKIAQVAENQFVGVN  172 (390)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             10332478999999865877677059996678888886726899999999999973899988899999999875134776


Q ss_pred             ------HHHHCC---CCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHH----H------HHH-
Q ss_conf             ------343105---62002578987654413101566686421589997287667521056798----8------761-
Q gi|254781016|r  161 ------CRSFYR---GFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEI----T------RHH-  220 (355)
Q Consensus       161 ------~RSi~G---G~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~----~------v~t-  220 (355)
T Consensus       173 ~G~mDQ~~s~~G~~~~al~ld~----~~l~~~~~~----~p~~~~~ivI~ns~vkr~la~seYn~Rr~ece~A~~~l~~~  244 (390)
T COG0153         173 CGIMDQLASAFGKKDHALLLDC----RTLEYEPVP----FPVGGVSIVIVNSNVKRELADSEYNERRAECEEAAEFLGVS  244 (390)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEC----CCCCEEEEC----CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7508899998687784899973----666268730----47664599996379766542347899999999999999875


Q ss_pred             ---------------------CHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             ---------------------85689999730---550999999998099999999999999989998703899568657
Q gi|254781016|r  221 ---------------------SPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ  276 (355)
Q Consensus       221 ---------------------Sp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~  276 (355)
T Consensus       245 ~~~L~d~~~~~~~~~~~~i~~~~~~~rRa~hvv~En~Rvl~a~~Al~~~dl~~fG~Lm~~SH~slrddyevt~p------  318 (390)
T COG0153         245 IKSLRDVTDEEFAALQAEIEVDPKIARRARHVVTENQRVLEAAKALRSGDLTEFGELMNESHESLRDDYEVTCP------  318 (390)
T ss_pred             HHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCH------
T ss_conf             50354337999996452414466888999999867778999999987188999999999989988743566566------


Q ss_pred             HHHHHHHHHHHHHHHCCC-EEEEEECCCC--EEEEEECHHHHHHHHHHHHHC
Q ss_conf             889999999999742896-1999977798--179995589899999997632
Q gi|254781016|r  277 KETIQGMERVWDARQQSI-PIYFTLDAGP--NLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       277 ~~t~~ii~~v~~~R~~g~-~v~fT~DAGP--Nv~il~~~~~~~~i~~~l~~i  325 (355)
T Consensus       319 -ElD~lve~a~~~--~G~~GaRmT-GaGfGGc~IaLv~~~~v~~~~e~v~~~  366 (390)
T COG0153         319 -ELDTLVEIALAA--GGAYGARMT-GAGFGGCVIALVPNDDVEAVAEAVAEE  366 (390)
T ss_pred             -HHHHHHHHHHHC--CCCCCCEEC-CCCCCCEEEEEECHHHHHHHHHHHHHH
T ss_conf             -289999999872--786501203-788785599993220279999999876