HHsearch alignment for GI: 254781016 and conserved domain: COG3407

>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism].
Probab=100.00  E-value=0  Score=647.01  Aligned_cols=300  Identities=41%  Similarity=0.657  Sum_probs=279.3

Q ss_pred             CEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEE-EECCC-CCCEEEECCEECCCCCHHHHHHHHHHHHH
Q ss_conf             37897488424881167767011757898434681278107999-97178-88579987872566520689999997421
Q gi|254781016|r   23 KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI-TVIDS-DADCIILNGQKISSQSSFFKKTTQFCDLF  100 (355)
Q Consensus        23 ~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v-~~~~~-~~d~~~lnG~~~~~~~~~~~ri~~~l~~~  100 (355)
T Consensus         5 ~~t~~ay~nialIKywGk~D~~l~iP~~~SiS~t~~df~t~t~~~~~~~~~~~D~~~lNG~~~~~~---~~k~~~~ld~~   81 (329)
T COG3407           5 IITASAYPNIALIKYWGKRDEALNIPLNSSISVTLEDFSTTTTAEELTENDEEDTFILNGELSEDE---NEKARRVLDRF   81 (329)
T ss_pred             CEEEEECCHHHHHHHCCCCCHHHCCCCCCEEEEEECCCCCEEEEEEECCCCCCCEEEECCCCCCHH---HHHHHHHHHHH
T ss_conf             513673523378776142316424778880478841444336778753788762799988227157---89999999999


Q ss_pred             HHHCC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCC
Q ss_conf             67619--4399998502332110123224799999999998188999889998865213530343105620025789876
Q gi|254781016|r  101 RQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN  178 (355)
Q Consensus       101 r~~~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~  178 (355)
T Consensus        82 R~~~~~~~~~~i~s~n~~ptaaGLaSSaag~AAl~~Al~~~~~~~~d~~~lS~~AR~gSGSa~RS~~Gg~~~W~~~~---  158 (329)
T COG3407          82 RKEYGISFKVKIVSYNNFPTAAGLASSAAGAAALAAALNRLYDLDLDDEFLSRIARLGSGSASRSIFGGFVLWEKGE---  158 (329)
T ss_pred             HHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHCCCEEEECCCC---
T ss_conf             87635466079997457876345210188999999999765244788799999987752411454228866730688---


Q ss_pred             CCCEEEEEC--CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             544131015--666864215899972876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  179 GMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       179 ~sds~a~~~--~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
T Consensus       159 g~~~~~~~~~~~~~~~e~~~i~~~~~~~~k~vsS~~gm~~~~~tS~~y~~w~~~~~~~~~~m~~~~~~~Df~~i~~~~e~  238 (329)
T COG3407         159 GEDSAAEQLFRLDLWKELAMIVLVISPKKKKVSSREGMQLTAETSPFYDAWLEHSEEDLEEMKEAIREKDFEKIGELAEN  238 (329)
T ss_pred             CCCCCEEEECCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             87521012023467623142799974556778736877777770727899999888759999999861479999999986


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             999899987038995686578899999999997428961999977798179995589899999997632100
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITII  328 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~~  328 (355)
T Consensus       239 dsl~mHA~l~~s~p~~~y~~~~s~~ii~~v~~~r~~g~~~~fT~DaGPnV~v~~~~~~l~~~~~~~~~~~~~  310 (329)
T COG3407         239 DSLEMHATLMSSGPPFFYLTDESLRIIEFVHELRKEGNAVYFTMDAGPNVKVITLEENLIDLLEILKTLECI  310 (329)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEEECCCHHHHHHHHHHCCCC
T ss_conf             599999998456996399883189999999998733884699972799659997215489999987313565