HHsearch alignment for GI: 254781016 and conserved domain: PRK00555

>PRK00555 galactokinase; Provisional.
Probab=98.88  E-value=1.6e-05  Score=59.02  Aligned_cols=275  Identities=15%  Similarity=0.105  Sum_probs=144.0

Q ss_pred             CCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCE-------------EEECCEECCCCCH
Q ss_conf             637897488424881167767011757898434681278107999971788857-------------9987872566520
Q gi|254781016|r   22 EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC-------------IILNGQKISSQSS   88 (355)
Q Consensus        22 ~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~-------------~~lnG~~~~~~~~   88 (355)
T Consensus         1 ~~~~~sAPGRVnliGEH~DY~gG~VLp~------AI~-~~~--~v~~~~~~~~~i~~~s~~~~~~~~~~~~~~~~~-~~~   70 (363)
T PRK00555          1 MTVSYAAPGRINLIGEHTDYNLGFALPI------ALP-QRT--VVTFTPEHTGAITARSDRADGSVRIPLDTTPGQ-VTG   70 (363)
T ss_pred             CCEEEECCCCEEEEECCEEECCCEEEEE------EHH-HCE--EEEEEECCCCEEEEEECCCCCCEEEECCCCCCC-CCC
T ss_conf             9269976665897628757899746947------820-128--999998899869999768898679867768776-622


Q ss_pred             HHHHHHHHHHHHHHH----CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC----C--
Q ss_conf             689999997421676----194399998502332110123224799999999998188999889998865213----5--
Q gi|254781016|r   89 FFKKTTQFCDLFRQF----SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS----G--  158 (355)
Q Consensus        89 ~~~ri~~~l~~~r~~----~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS----G--  158 (355)
T Consensus        71 W~~y~~gv~~~l~~~g~~~~g~~~~I~s--~IP~gaGLSSSAAl~va~~~al~~~~~~~~~~~ela~la~~aE~~~~G~~  148 (363)
T PRK00555         71 WAAYAAGVIWALRGAGHPVPGGAMSITS--DVEIGSGLSSSAALECAVLGAVGAATGTRIDRLEQARLAQRAENDYVGAP  148 (363)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEC--CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             7899999999999718998885289977--88876674418999999999999970899999999999999997517888


Q ss_pred             ----CCHHHHCCC---CHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHH-------HHH--------
Q ss_conf             ----303431056---2002578987654413101566686421589997287667521056-------798--------
Q gi|254781016|r  159 ----SACRSFYRG---FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREA-------MEI--------  216 (355)
Q Consensus       159 ----SA~RSi~GG---~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~g-------m~~--------  216 (355)
T Consensus       149 ~GiMDQ~as~~g~~g~al~id~----~~l~~~~v~~~~~~--~~~~~vi~dS~~~~~~~~~~y~~R~~ec~~aa~~l~~~  222 (363)
T PRK00555        149 TGLLDQLAALFGAPKTALLIDF----RDLTVRPVAFDPDA--CGVVLLLMDSRARHRHAGGEYAARRASCERAAADLGVS  222 (363)
T ss_pred             CCCHHHHHHHCCCCCEEEEECC----CCCCEECCCCCCCC--CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCH
T ss_conf             7505478886278883987326----78853214447776--77699997667644345323589999999999985912


Q ss_pred             -------------HHHHCHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHH
Q ss_conf             -------------876185689999730---5509999999980999999999999999899987038995686578899
Q gi|254781016|r  217 -------------TRHHSPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETI  280 (355)
Q Consensus       217 -------------~v~tSp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~  280 (355)
T Consensus       223 ~lr~~~~~~l~~l~~~~~~~~~~Ra~hv~~E~~RV~~~~~al~~~d~~~~G~Lm~~SH~Slrd~yevS~-------~elD  295 (363)
T PRK00555        223 SLRAVQDRGLAALGAIADPIDARRARHVLTENQRVLDFVAALADSDFTAAGQILTASHASMRDDFAITT-------ERID  295 (363)
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC-------HHHH
T ss_conf             354420768999875058888888888888888999999998739999999999999999998651796-------8799


Q ss_pred             HHHHHHHHHHHCC-CEEEEEECC--CCEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9999999974289-619999777--98179995589899999997632
Q gi|254781016|r  281 QGMERVWDARQQS-IPIYFTLDA--GPNLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       281 ~ii~~v~~~R~~g-~~v~fT~DA--GPNv~il~~~~~~~~i~~~l~~i  325 (355)
T Consensus       296 ---~lv~~a~~~Ga~GARlt-GaGfGGc~vaLv~~~~~~~~~~~v~~~  339 (363)
T PRK00555        296 ---LIADSAVRAGALGARMT-GGGFGGCVIALVPADRARDVADTVRRA  339 (363)
T ss_pred             ---HHHHHHHHCCCCEEEEE-CCCCCEEEEEEECHHHHHHHHHHHHHH
T ss_conf             ---99999997699278897-378874899996687899999999999