HHsearch alignment for GI: 254781016 and conserved domain: PRK01726

>PRK01726 consensus.
Probab=98.40  E-value=0.00021  Score=51.15  Aligned_cols=251  Identities=14%  Similarity=0.090  Sum_probs=137.0

Q ss_pred             EEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             89748842488116776701175789843468127810799997178885799878725665206899999974216761
Q gi|254781016|r   25 SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFS  104 (355)
Q Consensus        25 ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~  104 (355)
T Consensus        25 ~aPAKINL~L-~V~gkR~DG--YH~L~Sl~~~i-dl~D~i~i~~--~~~~~i~~~~~~~~i~~~-~Nli~kA~~~l~~~~   97 (312)
T PRK01726         25 PSPAKLNLFL-YINGKRPDG--YHELQTLFQFL-DFGDWLDISI--REDNQIVLTPEIPNLKTE-DNLIYRAAKLLQQKT   97 (312)
T ss_pred             ECCEEECCCC-CCCCCCCCC--CCEEEEEEEEE-CCCCEEEEEE--CCCCCEEEECCCCCCCCC-CCHHHHHHHHHHHHH
T ss_conf             4630480450-207828999--85268999994-6896999999--689978993678999886-759999999999976


Q ss_pred             CC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCE
Q ss_conf             94--3999985023321101232247999999999981889998899988652135303431056200257898765441
Q gi|254781016|r  105 KV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS  182 (355)
Q Consensus       105 ~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds  182 (355)
T Consensus        98 ~~~~~~~I~l~KnIPvgAGLGGGSSdAAavL~~Ln~l~~l~ls~~~L~~ia~~iGADVPffl~~~~a~-~~GiGE~l~--  174 (312)
T PRK01726         98 NCQLGANIHLDKILPMGGGVGGGSSNAATALVALNYLWQTNLSIDELAKLGLTLGADVPIFVHGHAAF-AEGVGEKIT--  174 (312)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEEEECCCEE-EECCCCEEE--
T ss_conf             99876389997378665677754346999999999984469998999999986189816686177789-988986820--


Q ss_pred             EEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             31015666864215899972876675210567988761856899997305509999999980999999999999999899
Q gi|254781016|r  183 FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH  262 (355)
Q Consensus       183 ~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mH  262 (355)
T Consensus       175 -~i~~----~~~~--~lLv~P--~i~vST~~vf~~~~l-~-----~~~~~~~~~~~l~~~~~NDL--------------E  225 (312)
T PRK01726        175 -YCEP----PEKW--FVVLKP--DDSISTAVIFQDPNL-P-----RNTPKKSLEQLLSEPYKNDC--------------E  225 (312)
T ss_pred             -ECCC----CCCE--EEEECC--CCCCCCHHHHHCCCC-C-----CCCCHHHHHHHHHHHHCCCH--------------H
T ss_conf             -6677----7666--999899--998687799709675-5-----47631149999860611644--------------8


Q ss_pred             HHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHHCC
Q ss_conf             9870389956865788999999999974289619999777981799955-898999999976321
Q gi|254781016|r  263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPEIT  326 (355)
Q Consensus       263 a~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~i~  326 (355)
T Consensus       226 ~~a~~~-------~PeI~~i~~~L~~~---~~-arMS-GSGST~FglF~sk~eA~ki~~~~p~~~  278 (312)
T PRK01726        226 KVVINH-------YSEVEEALNWLLQY---AP-ARLT-GTGACVFAEFDHEASAQAVFRQKPEAF  278 (312)
T ss_pred             HHHHHH-------CHHHHHHHHHHHHC---CC-CEEE-CCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             999986-------89999999998613---89-8367-538049999799999999998689764