HHsearch alignment for GI: 254781016 and conserved domain: PRK03009

>PRK03009 consensus.
Probab=98.64  E-value=1.1e-05  Score=60.16  Aligned_cols=254  Identities=16%  Similarity=0.150  Sum_probs=130.3

Q ss_pred             CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCC--E
Q ss_conf             84248811677670117578984346812781079999717888579987872566520689999997421676194--3
Q gi|254781016|r   30 SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--Y  107 (355)
Q Consensus        30 ~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~--~  107 (355)
T Consensus        11 INL~L-~V~~kr~DG--yH~l~Sl~~~i-~l~D~i~i~~~~~~~~~~~~~~~~i~~~~---Nlv~kA~~~l~~~~~~~~~   83 (287)
T PRK03009         11 LNLFL-HVTGRRPDG--YHLLQTVFQLL-DWGDTLHFTLRDDGKVARVTDVPGVPEES---DLVVRAARLLQAHTGTRLG   83 (287)
T ss_pred             EECCC-CCCCCCCCC--CCEEEEEEEEC-CCCCEEEEEECCCCCEEECCCCCCCCCCC---CHHHHHHHHHHHHHCCCCC
T ss_conf             70250-248868999--87067899980-67869999988899479625777898866---5999999999985399885


Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEEEEC
Q ss_conf             99998502332110123224799999999998188999889998865213530343105620025789876544131015
Q gi|254781016|r  108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF  187 (355)
Q Consensus       108 ~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a~~~  187 (355)
T Consensus        84 ~~I~l~KnIPv~AGLGGGSSdAAa~L~~Ln~l~~l~ls~~~l~~ia~~lGADVPffl~~~~-a~~~G~Ge~l~---~l~~  159 (287)
T PRK03009         84 VDIEIDKRLPMGGGLGGGSSDAATTLLALNRLWGLDLPRAELQSLALKLGADVPFFVFGKN-AFAEGIGEALT---AVEL  159 (287)
T ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCEECCCC-EEEECCCCCCE---ECCC
T ss_conf             4999980687656778775379999999999707999999999998763998230322776-79985884640---7478


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             66686421589997287667521056798876185689999730550999999998099999999999999989998703
Q gi|254781016|r  188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA  267 (355)
Q Consensus       188 ~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~  267 (355)
T Consensus       160 ----~~~~--~llv~P--~~~iST~~vy~~~~-----~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~---~NdLe~~a~~  221 (287)
T PRK03009        160 ----PPRW--FLVVTP--RVHVPTAEIFSDES-----LTR-DTKPITIADFL-AQQTSDAGWPDSFG---RNDLQPVVTS  221 (287)
T ss_pred             ----CCCE--EEEECC--CCCCCHHHHHHCCH-----HCC-CCCCCCHHHHH-HHHCCCHHHHHHHC---CCCCHHHHHH
T ss_conf             ----9747--999859--99846799974502-----025-67766687887-52332455678754---7875899987


Q ss_pred             CCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHH
Q ss_conf             89956865788999999999974289619999777981799955-8989999999763
Q gi|254781016|r  268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPE  324 (355)
Q Consensus       268 s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~  324 (355)
T Consensus       222 ~-------~PeI~~i~~~---l~~~~-~a~MS-GSGSt~Fglf~~~~~A~~a~~~l~~  267 (287)
T PRK03009        222 K-------YAEVARAVEW---LYNLT-PARMT-GSGACVFAAFKSKAEAEAAQAKLPA  267 (287)
T ss_pred             H-------CHHHHHHHHH---HHCCC-CEEEE-CCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             4-------8899999999---86789-71877-7150288998999999999986887