HHsearch alignment for GI: 254781016 and conserved domain: PRK03288

>PRK03288 consensus.
Probab=98.19  E-value=0.00044  Score=48.93  Aligned_cols=245  Identities=13%  Similarity=0.068  Sum_probs=128.7

Q ss_pred             ECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECC--EECCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             748842488116776701175789843468127810799997178885799878--725665206899999974216761
Q gi|254781016|r   27 FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG--QKISSQSSFFKKTTQFCDLFRQFS  104 (355)
Q Consensus        27 ~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG--~~~~~~~~~~~ri~~~l~~~r~~~  104 (355)
T Consensus         8 PAKINL~L-~V~gkR~DG--YH~i~S~~~~id-l~D~i~i~~--~~~~~i~~~~~~~~~~~~~---Nlv~ka~~~l~~~~   78 (283)
T PRK03288          8 PAKLNLFL-YITGQRADG--YHTLQTLFQFLD-YGDTLTIEP--RDDGEIRLLTPVEGVENED---NLIVRAARLLMKTA   78 (283)
T ss_pred             CEEEECCC-CCCCCCCCC--CCEEEEEEEECC-CCCEEEEEE--CCCCCEEEECCCCCCCCCC---CHHHHHHHHHHHHH
T ss_conf             01581140-338869999--872578999817-882999999--8999789955876787754---18999999999976


Q ss_pred             --------CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCC
Q ss_conf             --------943999985023321101232247999999999981889998899988652135303431056200257898
Q gi|254781016|r  105 --------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD  176 (355)
Q Consensus       105 --------~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~  176 (355)
T Consensus        79 ~~~~~~~~~~g~~I~l~KnIPv~AGLGGGSSdAAa~L~~L~~l~~l~ls~~~l~~ia~~iGaDVPffl~~~-~a~~~G~G  157 (283)
T PRK03288         79 ADSGRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSDDELAELGLTLGADVPVFVRGH-AAFAEGVG  157 (283)
T ss_pred             HHHCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCEECCC-CEEEECCC
T ss_conf             44024566666079994367644567877615999999999985899999999999998589831054277-58998288


Q ss_pred             CCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             76544131015666864215899972876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  177 QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       177 ~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
T Consensus       158 e~l~---~~~~----~~~~--~llv~P--~~~vST~~vy~~~---~~~~---~~~~~~~~~~l~~~~~Ndle~~a---~~  217 (283)
T PRK03288        158 EILT---PVDP----PEKW--YLVAHP--GVSIPTPVIFKDP---ELPR---NTPKRSIETLLKCEFSNDCEVIA---RK  217 (283)
T ss_pred             CEEE---ECCC----CCCE--EEEECC--CCCCCHHHHHCCC---CCCC---CCCCCCHHHHHHCHHCCCHHHHH---HH
T ss_conf             6814---7677----8756--999899--9997828984494---4467---87534899997371106469999---87


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECH-HHHHHHHHHHHH
Q ss_conf             99989998703899568657889999999999742896199997779817999558-989999999763
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH-KIEETIKQFFPE  324 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~-~~~~~i~~~l~~  324 (355)
T Consensus       218 ~------------------~peI~~~~~---~l~~~~~-~~MS-GSGSt~Fglf~~~~~A~ki~~~~p~  263 (283)
T PRK03288        218 R------------------FREVDAALS---WLLEYAP-SRLT-GTGACVFAEFDTESEARQVLEQAPE  263 (283)
T ss_pred             H------------------HHHHHHHHH---HHHCCCC-CCEE-CHHHEEEEEECCHHHHHHHHHHCCC
T ss_conf             5------------------599999999---9855398-7122-6404179998999999999996886