HHsearch alignment for GI: 254781016 and conserved domain: PRK05322

>PRK05322 galactokinase; Provisional.
Probab=98.73  E-value=4.7e-05  Score=55.72  Aligned_cols=302  Identities=14%  Similarity=0.103  Sum_probs=154.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCC-CEEEEEEE-CCC--CCC--EEE
Q ss_conf             488988887403467877637897488424881167767011757898434681278-10799997-178--885--799
Q gi|254781016|r    4 SLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL-GTITHITV-IDS--DAD--CII   77 (355)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~-~T~T~v~~-~~~--~~d--~~~   77 (355)
T Consensus         2 ~~~~l~~~F~~~fg~~p~--~~~~APGRVnLiGeHtDY~gg~Vlp~AI~~~~~ia~~~~~d~~i~i~s~~~~~~~~~~~~   79 (387)
T PRK05322          2 NKEELKKKFAEVFGEEED--RVFFSPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKKVRLYSANFEDLGIIEFD   79 (387)
T ss_pred             CHHHHHHHHHHHHCCCCC--EEEECCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEECCCCCCCEEEEE
T ss_conf             889999999998689989--899764763656144305998179588003749999988998799998988877549987


Q ss_pred             ECCEECCCCCHHHHHHHHHHHHHHHH-CC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             87872566520689999997421676-19--4399998502332110123224799999999998188999889998865
Q gi|254781016|r   78 LNGQKISSQSSFFKKTTQFCDLFRQF-SK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVAR  154 (355)
Q Consensus        78 lnG~~~~~~~~~~~ri~~~l~~~r~~-~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lAR  154 (355)
T Consensus        80 ~~~~~~~~~~~W~~Yv~Gvi~~l~~~g~~~~~G~d~~I~s~IP~gaGLSSSAAl~va~~~al~~~~~~~l~~~ela~la~  159 (387)
T PRK05322         80 LDDLSYDKEDDWANYPKGVLKYLQEAGYKIDHGFDLYIYGNIPNGAGLSSSASIELLTGVILKDLFNLDLDRLDLVKLGQ  159 (387)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             33258788766677999999999973998778738999578888777530889999999999997389999999999999


Q ss_pred             HCC----CCCH------HHHCCCC--HHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCH----------
Q ss_conf             213----5303------4310562--00257898765441310156668642158999728766752105----------
Q gi|254781016|r  155 LGS----GSAC------RSFYRGF--CEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSRE----------  212 (355)
Q Consensus       155 lGS----GSA~------RSi~GG~--v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~----------  212 (355)
T Consensus       160 ~aE~~~~G~~~GiMDQ~as~~g~~~~al~iD-~--~~l~~~~~p~~--~~~~--~~vi~~s~~~~~l~~s~Yn~R~~ec~  232 (387)
T PRK05322        160 KVENEFIGVNSGIMDQFAIGMGKKDHAILLD-T--NTLEYEYVPLD--LGDY--VIVIMNTNKRRELADSKYNERRAECE  232 (387)
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCEEEEEC-C--CCCCEEEECCC--CCCC--EEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             9988871698742346777742577488622-7--88843661257--8882--79998579764346321256899999


Q ss_pred             -HHHHHHH---------H-------------CHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -6798876---------1-------------85689999730---55099999999809999999999999998999870
Q gi|254781016|r  213 -AMEITRH---------H-------------SPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI  266 (355)
Q Consensus       213 -gm~~~v~---------t-------------Sp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~  266 (355)
T Consensus       233 ~a~~~l~~~~~i~~l~~~~~~~~~~~~~~l~~~~~~~Ra~Hvv~En~Rv~~a~~aL~~~d~~~~G~Lm~~sH~sLrd~ye  312 (387)
T PRK05322        233 KALKELQKKLDIKSLGELTEEEFDEYSYLIKDETLLKRARHAVTENQRTLKAVKALKAGDLEKFGRLMNASHVSLRDDYE  312 (387)
T ss_pred             HHHHHHHHHCCCHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999876249423552999999988754256888999999998779999999998669999999999998999998662


Q ss_pred             CCCCCEEEECHHHHHHHHHHHHHH-HCCC-EEEEEECCC--CEEEEEECHHHHHHHHHHHHHC
Q ss_conf             389956865788999999999974-2896-199997779--8179995589899999997632
Q gi|254781016|r  267 AASPPLLYWQKETIQGMERVWDAR-QQSI-PIYFTLDAG--PNLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       267 ~s~P~~~Y~~~~t~~ii~~v~~~R-~~g~-~v~fT~DAG--PNv~il~~~~~~~~i~~~l~~i  325 (355)
T Consensus       313 vS~-------~el---D~Lv~~a~~~~Ga~GARmt-G~GfGGc~vaLv~~~~~~~~~~~v~~~  364 (387)
T PRK05322        313 VTG-------LEL---DTLVEAAWKQPGVLGARMT-GAGFGGCAIAIVKKDEVEAFKENVGKA  364 (387)
T ss_pred             CCC-------HHH---HHHHHHHHHCCCCEECEEE-CCCCCEEEEEEECHHHHHHHHHHHHHH
T ss_conf             798-------889---9999998763897377362-488822699996277899999999999