HHsearch alignment for GI: 254781016 and conserved domain: PRK05905

>PRK05905 hypothetical protein; Provisional.
Probab=98.69  E-value=1.9e-05  Score=58.46  Aligned_cols=251  Identities=13%  Similarity=0.073  Sum_probs=126.9

Q ss_pred             CEEEECCCCEEEEECCCCCCH-HHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHH
Q ss_conf             378974884248811677670-1175789843468127810799997178885799878725665206899999974216
Q gi|254781016|r   23 KSSAFLPSNIALCKYWGKRDS-KLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFR  101 (355)
Q Consensus        23 ~~ta~ap~NIALIKYWGK~d~-~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r  101 (355)
T Consensus         2 k~ks~AKINL~L-~I~~kr~d~G--yH~l~S~f~~i~~l~D~i~i~~~~~~~~~i~~~~~~~~~~~~~~ni~~ka~~~l~   78 (258)
T PRK05905          2 KYKSYAKINLGL-SIYKKCKKVT--KHKLESIFILVENVYDDIEIEKIEKNIDDIHYFDETNEILVYSRLILVKTLEWLR   78 (258)
T ss_pred             CCCCCCCCCCCE-EECCCCCCCC--CEEEEEEEEEECCCCEEEEEEECCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             365355071452-2487788999--6689999999378872999998779987599708876677824699999999998


Q ss_pred             HHCC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH-CCCCCHHHHCCCCHHCCCCCCCC
Q ss_conf             7619--43999985023321101232247999999999981889998899988652-13530343105620025789876
Q gi|254781016|r  102 QFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL-GSGSACRSFYRGFCEWICGTDQN  178 (355)
Q Consensus       102 ~~~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl-GSGSA~RSi~GG~v~W~~g~~~~  178 (355)
T Consensus        79 ~~~~~~~~~~I~l~K~IP~gAGLGGGSSnAAa~L~~L~~~~~l--~~~~l~~ia~~lGs-DVPffl~~~~~a~~~G~GE~  155 (258)
T PRK05905         79 DKYNIKNHFKIKIKKRIPIGSGLGSGSSNAAVLMKWILEFEGI--NEINYKDVVNKLGS-DIPFFLSGYKTAYISDYGSQ  155 (258)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHCC-CCCEEECCCCCEEEECCCCE
T ss_conf             8609998669999945876567787527799999999986599--98999999986189-98879816873899878877


Q ss_pred             CCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             54413101566686421589997287667521056798876185689999730550999999998099999999999999
Q gi|254781016|r  179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA  258 (355)
Q Consensus       179 ~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~da  258 (355)
T Consensus       156 l-----~~l~~~-~~~~~llv~P--~~-~-~ST~~vy~~~~~~~~------~~~~~~~~~~~~~~~~----~~~---~~~  212 (258)
T PRK05905        156 V-----EDLIGQ-FKLTYKVIFM--NV-N-VSTKKVFEKFDDNQH------VIKNNFKTIIKNLKEN----IVV---NIH  212 (258)
T ss_pred             E-----EECCCC-CCCEEEEEEC--CC-C-CCHHHHHHHHCCCCC------CCCCHHHHHHHHHHHH----HHH---CCC
T ss_conf             8-----888778-7752999927--99-9-575999972262444------5631078888766777----763---370


Q ss_pred             HHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHH
Q ss_conf             9899987038995686578899999999997428961999977798179995589
Q gi|254781016|r  259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK  313 (355)
Q Consensus       259 l~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~  313 (355)
T Consensus       213 Ndle~~~~~~~-------P~i~~---~~~~l~~~~~~~~MS-GSGSt~F~i~~~~  256 (258)
T PRK05905        213 NDLQEPCFELY-------PNLLY---KYNELLNDGFYTILS-GAGSSFIVIKKIN  256 (258)
T ss_pred             CCHHHHHHHHC-------HHHHH---HHHHHHCCCCCEEEE-CCCCCEEEEEECC
T ss_conf             17399999879-------79999---999986799838997-6371489999636