Query         gi|254781016|ref|YP_003065429.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 355
No_of_seqs    128 out of 512
Neff          5.8 
Searched_HMMs 39220
Date          Mon May 30 04:29:12 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781016.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01240 mevDPdecarb diphosph 100.0       0       0  725.8  26.4  300   24-325     1-323 (325)
  2 KOG2833 consensus              100.0       0       0  679.9  31.6  307   18-324     2-327 (395)
  3 COG3407 MVD1 Mevalonate pyroph 100.0       0       0  647.0  29.5  300   23-328     5-310 (329)
  4 COG0083 ThrB Homoserine kinase  99.7 2.6E-14 6.6E-19  120.4  22.2  252   45-324    14-274 (299)
  5 PRK01212 homoserine kinase; Pr  99.7 5.2E-14 1.3E-18  118.3  18.9  249   47-326    16-275 (293)
  6 PRK01123 shikimate kinase; Pro  99.6 2.3E-12 5.8E-17  106.9  20.5  228   59-329    28-270 (283)
  7 PRK00128 ipk 4-diphosphocytidy  99.4 1.7E-09 4.2E-14   86.8  24.5  260   28-325     7-270 (281)
  8 PTZ00299 homoserine kinase; Pr  99.4 7.2E-11 1.8E-15   96.4  17.3  292   20-346     4-329 (336)
  9 PTZ00298 mevalonate kinase; Pr  99.4   1E-09 2.6E-14   88.3  23.0  212  107-343    94-323 (328)
 10 PRK04344 consensus              99.4 4.3E-09 1.1E-13   84.0  24.0  267   23-325     2-272 (284)
 11 PRK03188 4-diphosphocytidyl-2-  99.3 1.1E-09 2.7E-14   88.2  20.5  270   25-327     4-279 (299)
 12 PRK03926 mevalonate kinase; Pr  99.3 9.7E-09 2.5E-13   81.5  24.2  261   24-327     3-285 (302)
 13 COG1577 ERG12 Mevalonate kinas  99.3 8.2E-09 2.1E-13   82.0  22.5  253   51-328    22-298 (307)
 14 TIGR00191 thrB homoserine kina  99.2 8.5E-10 2.2E-14   88.9  14.6  263   48-324    14-333 (359)
 15 PRK03817 galactokinase; Provis  99.2 5.5E-07 1.4E-11   69.2  27.0  288   25-340     2-342 (351)
 16 PRK02534 4-diphosphocytidyl-2-  99.2 1.4E-07 3.5E-12   73.4  23.9  283   24-340     6-298 (308)
 17 TIGR00549 mevalon_kin mevalona  99.1 1.9E-08 4.8E-13   79.4  16.1  191   91-304   112-338 (345)
 18 COG1685 Archaeal shikimate kin  99.0 4.3E-07 1.1E-11   69.9  18.6  223   59-329    28-264 (278)
 19 TIGR01920 Shik_kin_archae shik  98.9 9.8E-07 2.5E-11   67.5  20.1  227   59-328    23-270 (273)
 20 PRK00555 galactokinase; Provis  98.9 1.6E-05   4E-10   59.0  28.9  275   22-325     1-339 (363)
 21 PRK05322 galactokinase; Provis  98.7 4.7E-05 1.2E-09   55.7  27.7  302    4-325     2-364 (387)
 22 PRK13412 fkp bifunctional fuco  98.7 1.8E-05 4.6E-10   58.6  19.9  228  104-349   723-970 (974)
 23 PRK05905 hypothetical protein;  98.7 1.9E-05 4.9E-10   58.5  19.8  251   23-313     2-256 (258)
 24 COG1907 Predicted archaeal sug  98.7 3.9E-05   1E-09   56.3  20.9  248   50-319    25-282 (312)
 25 PRK03009 consensus              98.6 1.1E-05 2.8E-10   60.2  17.3  254   30-324    11-267 (287)
 26 COG2605 Predicted kinase relat  98.6 6.6E-05 1.7E-09   54.7  20.6  220  107-339    89-332 (333)
 27 COG0153 GalK Galactokinase [Ca  98.6 0.00011 2.7E-09   53.3  27.4  281   20-325    20-366 (390)
 28 PRK04943 consensus              98.6 2.3E-05   6E-10   57.8  17.9  253   22-326     4-262 (288)
 29 PRK00343 ipk 4-diphosphocytidy  98.5 1.3E-05 3.3E-10   59.7  14.4  248   25-325     4-258 (279)
 30 PRK00650 4-diphosphocytidyl-2-  98.5 3.5E-05   9E-10   56.6  15.9  235   28-315     7-245 (288)
 31 PRK04648 consensus              98.4 1.1E-05 2.7E-10   60.3  13.0  242   27-324    18-271 (295)
 32 COG1947 IspE 4-diphosphocytidy  98.4 4.2E-05 1.1E-09   56.0  16.0  261   23-324     3-271 (289)
 33 PRK05101 galactokinase; Provis  98.4 0.00028 7.1E-09   50.3  30.7  310   10-338     9-372 (382)
 34 TIGR01220 Pmev_kin_Gr_pos phos  98.4   5E-05 1.3E-09   55.5  15.9  274   46-327    18-356 (367)
 35 PRK01726 consensus              98.4 0.00021 5.4E-09   51.2  18.8  251   25-326    25-278 (312)
 36 PRK04181 4-diphosphocytidyl-2-  98.2 0.00024 6.1E-09   50.8  15.4  143   26-177     3-154 (254)
 37 PRK03288 consensus              98.2 0.00044 1.1E-08   48.9  16.4  245   27-324     8-263 (283)
 38 KOG1511 consensus               98.1  0.0013 3.3E-08   45.6  18.5  100  108-219   132-251 (397)
 39 pfam00288 GHMP_kinases_N GHMP   97.8 2.8E-05   7E-10   57.3   4.9   48  110-157     2-49  (67)
 40 COG1829 Predicted archaeal kin  97.8  0.0044 1.1E-07   41.9  18.4  180   49-256    25-212 (283)
 41 TIGR00154 ispE 4-diphosphocyti  97.7  0.0028 7.2E-08   43.3  13.3  239   62-327    40-304 (322)
 42 COG4542 PduX Protein involved   97.1   0.032 8.2E-07   35.9  14.4  184  108-315    84-267 (293)
 43 pfam08544 GHMP_kinases_C GHMP   96.4   0.021 5.4E-07   37.2   7.7   75  239-325     2-79  (82)
 44 PTZ00290 galactokinase; Provis  96.3    0.12 3.1E-06   31.8  20.1  152    4-155    17-199 (468)
 45 KOG1537 consensus               96.0   0.095 2.4E-06   32.6   9.1  200  107-327    94-336 (355)
 46 TIGR00131 gal_kin galactokinas  95.0    0.21 5.4E-06   30.2   8.1  139    8-148     4-170 (500)
 47 COG3890 ERG8 Phosphomevalonate  94.5    0.48 1.2E-05   27.7  13.9  279   24-331     4-325 (337)
 48 TIGR00144 beta_RFAP_syn beta-r  91.6     1.3 3.2E-05   24.8  15.5  280   30-324     9-316 (337)
 49 TIGR02734 crtI_fam phytoene de  74.9     3.2 8.1E-05   22.0   3.0   10  260-269   191-200 (526)
 50 KOG0631 consensus               73.8     7.4 0.00019   19.4   7.2   61  106-166   141-213 (489)
 51 KOG4644 consensus               72.6     7.9  0.0002   19.2  14.9  217   96-324   680-921 (948)
 52 cd06454 KBL_like KBL_like; thi  57.0      15 0.00039   17.2   5.9   73  254-326   259-349 (349)
 53 TIGR00674 dapA dihydrodipicoli  56.2      16  0.0004   17.1   5.0   40  231-270   209-248 (288)
 54 pfam10673 DUF2487 Protein of u  54.2      15 0.00037   17.3   3.1   46  264-311    52-111 (143)
 55 PRK05912 tyrosyl-tRNA syntheta  53.8      17 0.00044   16.9   4.1   63  194-256   213-277 (402)
 56 KOG4520 consensus               47.9      19 0.00049   16.5   2.9   17  155-171   115-131 (238)
 57 TIGR01122 ilvE_I branched-chai  45.8       9 0.00023   18.8   1.0   25  292-319    29-53  (302)
 58 PRK03659 glutathione-regulated  43.2      25 0.00063   15.7   3.0   96  247-354   408-537 (602)
 59 TIGR02397 dnaX_nterm DNA polym  42.7      25 0.00064   15.7   6.9  102   58-171    71-224 (363)
 60 TIGR01219 Pmev_kin_ERG8 phosph  41.7      19 0.00049   16.5   2.1  137  118-256   178-362 (499)
 61 TIGR01325 O_suc_HS_sulf O-succ  41.7      19 0.00048   16.6   2.1  111  182-305   177-311 (386)
 62 PRK08745 ribulose-phosphate 3-  39.5      28 0.00071   15.4   2.9   74  263-353   136-212 (223)
 63 PRK08883 ribulose-phosphate 3-  39.5      28 0.00071   15.4   2.9   42  264-305   133-177 (220)
 64 pfam12017 Transposase_37 Trans  38.0     8.5 0.00022   19.0  -0.2   45  277-327   165-210 (236)
 65 PRK06039 ileS isoleucyl-tRNA s  37.5      27  0.0007   15.4   2.4   25  231-255   884-908 (1042)
 66 PRK05581 ribulose-phosphate 3-  37.1      30 0.00077   15.1   3.1   44  263-306   135-181 (220)
 67 PRK03562 glutathione-regulated  36.9      30 0.00078   15.1   3.1   86  264-354   417-536 (615)
 68 KOG4743 consensus               35.7      12 0.00031   17.9   0.4   11  158-168    16-26  (195)
 69 PTZ00170 D-ribulose-5-phosphat  34.5      29 0.00075   15.2   2.1   42  264-306   140-181 (224)
 70 PRK12864 YciI-like protein; Re  33.3      35 0.00088   14.7   3.9   43  283-325    26-69  (89)
 71 TIGR01239 galT_2 galactose-1-p  33.0      20 0.00051   16.4   1.1   52   67-118   209-273 (502)
 72 cd07922 CarBa CarBa is the A s  32.8      34 0.00086   14.8   2.2   48  221-268    16-70  (81)
 73 COG1541 PaaK Coenzyme F390 syn  32.6      35  0.0009   14.6   2.7   19  121-139   185-203 (438)
 74 PRK13193 pyrrolidone-carboxyla  32.3      25 0.00064   15.7   1.5   33  273-307   110-142 (201)
 75 KOG3282 consensus               32.0      36 0.00092   14.6   6.4   39  267-305   122-160 (190)
 76 TIGR03266 methan_mark_1 putati  32.0      36 0.00093   14.6   6.4   16  247-262   167-182 (376)
 77 TIGR03604 docking_ocin bacteri  31.9      36 0.00093   14.6   7.0   27  115-141   109-135 (377)
 78 PRK00068 hypothetical protein;  31.8      37 0.00093   14.5   4.9   33  224-256   934-966 (978)
 79 pfam04788 DUF620 Protein of un  31.6     9.8 0.00025   18.5  -0.7   63  158-239    24-87  (242)
 80 TIGR01163 rpe ribulose-phospha  31.6      37 0.00094   14.5   3.9  144  191-354    39-213 (216)
 81 pfam07014 Hs1pro-1_C Hs1pro-1   31.3      37 0.00095   14.5   5.7   54  211-265    47-109 (261)
 82 TIGR02683 upstrm_HI1419 probab  31.1      23 0.00059   15.9   1.2   69  218-310     3-74  (95)
 83 pfam01522 Polysacc_deac_1 Poly  31.1      37 0.00096   14.5   2.8   15  270-284   102-116 (123)
 84 PRK06606 branched-chain amino   30.8      30 0.00077   15.1   1.7   42   72-116     5-46  (306)
 85 pfam06434 Aconitase_2_N Aconit  30.7      32 0.00083   14.9   1.9   22  155-177    63-84  (204)
 86 KOG3262 consensus               30.6      38 0.00097   14.4   2.5   68   10-81     57-130 (215)
 87 KOG0616 consensus               30.1      35 0.00089   14.7   1.9   85  198-302   183-268 (355)
 88 PRK13354 tyrosyl-tRNA syntheta  29.3      40   0.001   14.3   4.2   62  195-256   218-281 (405)
 89 PRK13195 pyrrolidone-carboxyla  28.5      32 0.00081   15.0   1.5   24  283-306   122-145 (222)
 90 pfam11159 DUF2939 Protein of u  26.1      45  0.0012   13.9   3.0   33  219-260    10-42  (95)
 91 PRK08005 ribulose-phosphate 3-  25.9      38 0.00097   14.4   1.5   21  333-353   184-204 (210)
 92 COG4012 Uncharacterized protei  25.7      43  0.0011   14.0   1.8   19  292-311   236-254 (342)
 93 cd01576 AcnB_Swivel Aconitase   25.5      46  0.0012   13.8   2.4   32  260-299    25-56  (131)
 94 PRK00125 pyrF orotidine 5'-pho  25.1      17 0.00043   16.9  -0.4   21  311-331   197-217 (277)
 95 TIGR01099 galU UTP-glucose-1-p  24.2      31 0.00079   15.1   0.8   37   94-141    81-120 (270)
 96 COG3345 GalA Alpha-galactosida  23.7      32 0.00081   15.0   0.8   57  278-340   307-377 (687)
 97 COG3603 Uncharacterized conser  23.5      51  0.0013   13.5   5.0   42  285-329    83-126 (128)
 98 pfam12187 VirArc_Nuclease Vira  22.3      31 0.00078   15.1   0.5   34  277-310   141-178 (190)
 99 PRK13194 pyrrolidone-carboxyla  22.2      43  0.0011   14.1   1.2   33  273-307   110-142 (204)
100 PRK12514 RNA polymerase sigma   22.2      54  0.0014   13.4   4.8   29  234-262     5-33  (179)
101 pfam11101 DUF2884 Protein of u  21.8      55  0.0014   13.3   7.0   82   72-165    30-113 (229)
102 COG3433 Aryl carrier domain [S  21.4      52  0.0013   13.5   1.5   23  276-298    28-50  (74)
103 PRK13728 conjugal transfer pro  21.4      55  0.0014   13.3   1.6   14  293-306    99-113 (181)
104 PRK10456 arginine succinyltran  21.3      56  0.0014   13.3   3.2   78  242-321   183-272 (344)
105 pfam07765 KIP1 KIP1-like prote  20.7      57  0.0015   13.2   2.5   41  215-256     7-47  (74)
106 PRK13196 pyrrolidone-carboxyla  20.7      53  0.0014   13.4   1.4   21  286-306   125-145 (212)
107 PRK08091 ribulose-phosphate 3-  20.6      57  0.0015   13.2   3.1   44  263-306   151-197 (235)

No 1  
>TIGR01240 mevDPdecarb diphosphomevalonate decarboxylase; InterPro: IPR005935   Synonyms: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase.   This group of enzymes belongs to the GHMP kinase domain superfamily. GHMP kinases are a unique class of ATP-dependent enzymes (the abbreviation of which refers to the original members: galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase) . Enzymes belonging to this superfamily contain three well-conserved motifs, the second of which has the typical sequence Pro-X-X-X-Gly-Leu-X-Ser-Ser-Ala and is involved in ATP binding . The phosphate binding loop in GHMP kinases is distinct from the classical P-loops found in many ATP/GTP binding proteins. The bound ADP molecule adopts a rare syn conformation and is in the opposite orientation from those bound to the P-loop-containing proteins . GHMP kinases display a distinctly bilobal appearance with their N-terminal subdomains dominated by a mixed beta-sheet flanked on one side by alpha-helices and their C-terminal subdomains containing a four stranded anti-parallel beta-sheet , , , .    Diphosphomevalonate decarboxylase (mevalonate pyrophosphate decarboxylase, (4.1.1.33 from EC) catalyzes the decarboxylation of mevalonate pyrophosphate to isopentyl pyrophosphate (IPP) , the last step in the synthesis of IPP in the mevalonate pathway. Mevalonate is a key intermediate in the biosynthesis of sterols and non-sterol isoprenes in the mevalonate pathway. In mammals, the majority of mevalonate is converted into cholesterol.  ATP + (R)-5-diphosphomevalonate = ADP + phosphate + isopentenyl diphosphate + CO2   ; GO: 0004163 diphosphomevalonate decarboxylase activity, 0008299 isoprenoid biosynthetic process.
Probab=100.00  E-value=0  Score=725.81  Aligned_cols=300  Identities=39%  Similarity=0.614  Sum_probs=283.6

Q ss_pred             EEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECC--CCEEEEEE-ECCC-CCCEEEECCEECCCCCHHHHHHHHHHHH
Q ss_conf             789748842488116776701175789843468127--81079999-7178-8857998787256652068999999742
Q gi|254781016|r   24 SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHIT-VIDS-DADCIILNGQKISSQSSFFKKTTQFCDL   99 (355)
Q Consensus        24 ~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~--~~T~T~v~-~~~~-~~d~~~lnG~~~~~~~~~~~ri~~~l~~   99 (355)
                      ++++||.|||+||||||+|++++||.|+|||+||+.  ++|+|+|. +.|. ..|+|||||.+++..+  .+||.++||.
T Consensus         1 ~~vtay~NIA~iKYWGK~n~~l~lP~nsSiSlTL~~dd~~T~Tsv~f~~d~~~~D~fylnG~lq~~~~--~~k~s~~ld~   78 (325)
T TIGR01240         1 AKVTAYVNIALIKYWGKKNEKLILPTNSSISLTLEQDDLYTLTSVAFLADEFERDEFYLNGVLQDEKD--NEKVSNILDD   78 (325)
T ss_pred             CEEECCHHHEEHCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCCCCEEEECCCCCCHHH--HHHHHHHHHH
T ss_conf             92214102000002576242114874564257634764302123356288631012477573787034--5589999998


Q ss_pred             HHHHC--------------CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHC
Q ss_conf             16761--------------9439999850233211012322479999999999818899988999886521353034310
Q gi|254781016|r  100 FRQFS--------------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFY  165 (355)
Q Consensus       100 ~r~~~--------------~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~  165 (355)
                      +|+..              ..+++|+|+|||||||||||||||||||+.|++++|++++|..+||++||.||||||||+|
T Consensus        79 fRq~~~~~~skdaslPtlsqWk~~~~s~Nn~PTAAGLaSSasGlaALv~A~~~l~~l~ld~~~lsr~Ar~gSGSacRS~F  158 (325)
T TIGR01240        79 FRQEAKESESKDASLPTLSQWKVKVVSQNNVPTAAGLASSASGLAALVSACDKLYKLQLDDKELSRIARKGSGSACRSLF  158 (325)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCHHHHC
T ss_conf             62221122222125641000046788507862144466689999999999999970798878999886421673003205


Q ss_pred             CCCHHCCCCCCCCCCCEEEEECCCC--CCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHH-HHHHHHHH
Q ss_conf             5620025789876544131015666--86421589997287667521056798876185689999730550-99999999
Q gi|254781016|r  166 RGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAI  242 (355)
Q Consensus       166 GG~v~W~~g~~~~~sds~a~~~~~~--~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~-~~~~~~ai  242 (355)
                      ||||.|.+|.++|+.+++++++++.  |+++.++++||++.+|+||||+||++||+||.+|++|++++..+ +..|++||
T Consensus       159 Gg~vaWekG~~edd~ss~a~~v~~dS~~~~ma~~~lv~nd~KK~vSSr~GM~ltv~TS~~f~ew~e~v~~dr~~~m~~ai  238 (325)
T TIGR01240       159 GGYVAWEKGKDEDDLSSAAVKVEDDSDEDKMAMVVLVVNDIKKDVSSREGMKLTVETSELFKEWVESVVIDRFEVMKKAI  238 (325)
T ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             88000027767678874036567778500110777763136887453035688898777642234310005899999997


Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHH--CCCEEEEEECCCCEEEEEECHHHHHHHHH
Q ss_conf             8099999999999999989998703899568657889999999999742--89619999777981799955898999999
Q gi|254781016|r  243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQ  320 (355)
Q Consensus       243 ~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~--~g~~v~fT~DAGPNv~il~~~~~~~~i~~  320 (355)
                      +++||+.||+.+|.|++.|||+|+++.|||.||+++|+++|++|+++|+  +|++|||||||||||+|||.++|+-++.+
T Consensus       239 k~kdF~~~g~~t~~n~l~mHaTtl~a~PPf~Y~~~~S~~a~~av~~lrqfy~g~~~yfTmDAGPNvkvl~l~~~ls~l~e  318 (325)
T TIGR01240       239 KTKDFEKLGKETEANSLSMHATTLDAQPPFSYLSDESKKAMEAVKELRQFYEGIICYFTMDAGPNVKVLVLEEDLSKLAE  318 (325)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCEEEEEECCCHHHHHH
T ss_conf             32128999999987456520000147748000384468999999999887388136874158885388762323689999


Q ss_pred             HHHHC
Q ss_conf             97632
Q gi|254781016|r  321 FFPEI  325 (355)
Q Consensus       321 ~l~~i  325 (355)
                      +|..+
T Consensus       319 ~~~Kl  323 (325)
T TIGR01240       319 TLTKL  323 (325)
T ss_pred             HHHHC
T ss_conf             98430


No 2  
>KOG2833 consensus
Probab=100.00  E-value=0  Score=679.89  Aligned_cols=307  Identities=35%  Similarity=0.580  Sum_probs=282.8

Q ss_pred             CCCCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEE--CCCCEEEEEEECCC-CCCEEEECCEECCCCCHHHHHHH
Q ss_conf             7877637897488424881167767011757898434681--27810799997178-88579987872566520689999
Q gi|254781016|r   18 PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQKISSQSSFFKKTT   94 (355)
Q Consensus        18 ~~~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL--~~~~T~T~v~~~~~-~~d~~~lnG~~~~~~~~~~~ri~   94 (355)
                      ++.....||.+|.|||+||||||||+.+|||.|+|||+||  |.+.|.|++..+++ ++|++||||++.+..+++++++.
T Consensus         2 ~k~~~~~t~taPvNIAvIKYWGKRD~~l~LP~N~SISvTL~~D~L~t~Tt~~~s~~fe~dr~wLNGk~~~i~~~R~q~cl   81 (395)
T KOG2833           2 DKPVAEVTATAPVNIAVIKYWGKRDEELNLPTNDSISVTLSQDDLCTLTTAVVSPSFEEDRMWLNGKEVPISNKRYQRCL   81 (395)
T ss_pred             CCCEEEEEECCCCEEEEEEECCCCCHHHCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCEEEECCCCCCCCCHHHHHHH
T ss_conf             97403676316623666541244413213777770688853553144578884266445417887822136637899999


Q ss_pred             HHHHHHHHHC-----------CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHH
Q ss_conf             9974216761-----------94399998502332110123224799999999998188999889998865213530343
Q gi|254781016|r   95 QFCDLFRQFS-----------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRS  163 (355)
Q Consensus        95 ~~l~~~r~~~-----------~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RS  163 (355)
                      +-+++.+...           .++++|.|.|||||||||||||+|||||++|++++|+++.+.++||++||+||||||||
T Consensus        82 ~e~r~~~~d~~~~~~~~~~~~~~~lHI~S~nNFPtAAGLASSAAG~Aalv~alarly~l~~~~~els~iAR~GSGSACRS  161 (395)
T KOG2833          82 REIRRLARDREESEASLPSNGPLKLHIASVNNFPTAAGLASSAAGFAALVLALARLYGLDDSPEELSRIARQGSGSACRS  161 (395)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCHHHHH
T ss_conf             99999865323311256767871178874378830320011024089999999998589999899999986148604554


Q ss_pred             HCCCCHHCCCCCCCCCCCEEEEECC--CCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHH-HHHHHHHHHH
Q ss_conf             1056200257898765441310156--668642158999728766752105679887618568999973-0550999999
Q gi|254781016|r  164 FYRGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQ  240 (355)
Q Consensus       164 i~GG~v~W~~g~~~~~sds~a~~~~--~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~-~~~~~~~~~~  240 (355)
                      +|||||.|+.|..+||+||.|++..  .|||+++++|+|+++.+|+++||+||+++|+||++|+.|+++ ++.++.+|.+
T Consensus       162 l~GG~V~W~mG~~~DGsDsvAvq~~p~~~W~el~ililVvs~~~K~t~ST~GM~~sveTS~L~qhRi~~vVP~Ri~~m~e  241 (395)
T KOG2833         162 LYGGFVAWEMGELDDGSDSVAVQIAPSSHWPELRILILVVSDAKKKTGSTEGMRRSVETSQLLQHRIESVVPQRIQQMRE  241 (395)
T ss_pred             HCCCEEEEECCCCCCCCCEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             30453677315645787503787035347873189999960553344661888988887699999998664799999999


Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHH--HCCCEEEEEECCCCEEEEEECHHHHHHH
Q ss_conf             99809999999999999998999870389956865788999999999974--2896199997779817999558989999
Q gi|254781016|r  241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETI  318 (355)
Q Consensus       241 ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R--~~g~~v~fT~DAGPNv~il~~~~~~~~i  318 (355)
                      ||+++||+.|++++|.|+|++||+||++.||++||++.+++||.+|++++  .+++.++||||||||.+++++++++.++
T Consensus       242 aI~~rDF~~FA~lTm~DSNqFHAvclDT~PPI~YmNd~S~~iI~~vh~~N~~~G~t~vAYTFDAGPNAvl~~l~e~~~~~  321 (395)
T KOG2833         242 AIRERDFESFAKLTMKDSNQFHAVCLDTFPPIFYLNDTSWRIISLVHEFNASAGGTRVAYTFDAGPNAVLIVLEENVSQL  321 (395)
T ss_pred             HHHHCCHHHHHHHHHHCCHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCEEEEEHHHHHHHH
T ss_conf             99865778877777613124564423158974785364079999999987516971689883389862899836409999


Q ss_pred             HHHHHH
Q ss_conf             999763
Q gi|254781016|r  319 KQFFPE  324 (355)
Q Consensus       319 ~~~l~~  324 (355)
                      .+.+-.
T Consensus       322 l~~~~~  327 (395)
T KOG2833         322 LAAVLK  327 (395)
T ss_pred             HHHHHH
T ss_conf             999998


No 3  
>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism]
Probab=100.00  E-value=0  Score=647.01  Aligned_cols=300  Identities=41%  Similarity=0.657  Sum_probs=279.3

Q ss_pred             CEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEE-EECCC-CCCEEEECCEECCCCCHHHHHHHHHHHHH
Q ss_conf             37897488424881167767011757898434681278107999-97178-88579987872566520689999997421
Q gi|254781016|r   23 KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI-TVIDS-DADCIILNGQKISSQSSFFKKTTQFCDLF  100 (355)
Q Consensus        23 ~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v-~~~~~-~~d~~~lnG~~~~~~~~~~~ri~~~l~~~  100 (355)
                      ++|++||+||||||||||+|+.+|+|.|||||+||++++|+|++ ++.++ ++|+|||||++.+..   .+|+.+++|.+
T Consensus         5 ~~t~~ay~nialIKywGk~D~~l~iP~~~SiS~t~~df~t~t~~~~~~~~~~~D~~~lNG~~~~~~---~~k~~~~ld~~   81 (329)
T COG3407           5 IITASAYPNIALIKYWGKRDEALNIPLNSSISVTLEDFSTTTTAEELTENDEEDTFILNGELSEDE---NEKARRVLDRF   81 (329)
T ss_pred             CEEEEECCHHHHHHHCCCCCHHHCCCCCCEEEEEECCCCCEEEEEEECCCCCCCEEEECCCCCCHH---HHHHHHHHHHH
T ss_conf             513673523378776142316424778880478841444336778753788762799988227157---89999999999


Q ss_pred             HHHCC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCC
Q ss_conf             67619--4399998502332110123224799999999998188999889998865213530343105620025789876
Q gi|254781016|r  101 RQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN  178 (355)
Q Consensus       101 r~~~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~  178 (355)
                      |+..+  ++++|+|+||||||+||||||||||||++|+.+++++++|..++|++||+||||||||+||||+.|..|.   
T Consensus        82 R~~~~~~~~~~i~s~n~~ptaaGLaSSaag~AAl~~Al~~~~~~~~d~~~lS~~AR~gSGSa~RS~~Gg~~~W~~~~---  158 (329)
T COG3407          82 RKEYGISFKVKIVSYNNFPTAAGLASSAAGAAALAAALNRLYDLDLDDEFLSRIARLGSGSASRSIFGGFVLWEKGE---  158 (329)
T ss_pred             HHHHCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHHHHCCCEEEECCCC---
T ss_conf             87635466079997457876345210188999999999765244788799999987752411454228866730688---


Q ss_pred             CCCEEEEEC--CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             544131015--666864215899972876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  179 GMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       179 ~sds~a~~~--~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      |.++++++.  .+.|+++.+++++++.++|+++||+||+.++.|||||++|++.+..++++|+++++++||++|++++|+
T Consensus       159 g~~~~~~~~~~~~~~~e~~~i~~~~~~~~k~vsS~~gm~~~~~tS~~y~~w~~~~~~~~~~m~~~~~~~Df~~i~~~~e~  238 (329)
T COG3407         159 GEDSAAEQLFRLDLWKELAMIVLVISPKKKKVSSREGMQLTAETSPFYDAWLEHSEEDLEEMKEAIREKDFEKIGELAEN  238 (329)
T ss_pred             CCCCCEEEECCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             87521012023467623142799974556778736877777770727899999888759999999861479999999986


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             999899987038995686578899999999997428961999977798179995589899999997632100
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITII  328 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~~  328 (355)
                      |+++|||++|++.|||+||+++|+++|++|+++|++|.+|||||||||||+|+|++++++.+.+++.....+
T Consensus       239 dsl~mHA~l~~s~p~~~y~~~~s~~ii~~v~~~r~~g~~~~fT~DaGPnV~v~~~~~~l~~~~~~~~~~~~~  310 (329)
T COG3407         239 DSLEMHATLMSSGPPFFYLTDESLRIIEFVHELRKEGNAVYFTMDAGPNVKVITLEENLIDLLEILKTLECI  310 (329)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEEECCCHHHHHHHHHHCCCC
T ss_conf             599999998456996399883189999999998733884699972799659997215489999987313565


No 4  
>COG0083 ThrB Homoserine kinase [Amino acid transport and metabolism]
Probab=99.70  E-value=2.6e-14  Score=120.44  Aligned_cols=252  Identities=20%  Similarity=0.156  Sum_probs=170.8

Q ss_pred             HCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCE---ECCCCCH--HHHHHHHHHHHHHHHCCCEEEEEEECCCCCC
Q ss_conf             1757898434681278107999971788857998787---2566520--6899999974216761943999985023321
Q gi|254781016|r   45 LNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ---KISSQSS--FFKKTTQFCDLFRQFSKVYFLIETSNNIPTK  119 (355)
Q Consensus        45 l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~---~~~~~~~--~~~ri~~~l~~~r~~~~~~~~I~S~N~fPta  119 (355)
                      +.=|=-+++.+-|+.+.+.+.++..+  ..++...|.   .++.++.  ..+-+.++++.+....  .++|+-+|++|.+
T Consensus        14 NlGpGFD~lGlAl~~~~~~~v~~~~~--~~~i~~~g~~~~~iP~~~~n~~~~~~~~~~~~~~~~~--~~~i~i~k~IP~~   89 (299)
T COG0083          14 NLGPGFDVLGLALDLYNDVVVVEVVD--KFEIEVEGEGADKIPLDPENLVYQAALKFLEALGIEA--GVKIRIEKGIPLG   89 (299)
T ss_pred             CCCCCCCCEEEECCCCCCEEEEEECC--CEEEEEECCCCCCCCCCCCEEHHHHHHHHHHHHCCCC--CEEEEEECCCCCC
T ss_conf             46777000012014557279997047--3799983465667999830009999999999829986--5799997699877


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCC---CCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCC-CCE
Q ss_conf             101232247999999999981889998899988652135---3034310562002578987654413101566686-421
Q gi|254781016|r  120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSG---SACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP-DLR  195 (355)
Q Consensus       120 aGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSG---SA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~-dl~  195 (355)
                      .||+|||+..+|-..|++++++.+++.+++-.+|-.++|   ..+.|++||++++..   .++..+..++    |+ ++.
T Consensus        90 rGLGSSaAsiVAal~aan~l~~~~L~~~~ll~~a~~~EgHpDNVapa~lGG~~l~~~---~~~~~~~~v~----~~~~~~  162 (299)
T COG0083          90 RGLGSSAASIVAALAAANELAGLPLSKEELLQLALEIEGHPDNVAPAVLGGLVLVEE---ESGIISVKVP----FPSDLK  162 (299)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHCCEEEEEE---CCCCEEEECC----CCCCEE
T ss_conf             787589999999999999984599989999999997558971077776078799861---5873479715----876468


Q ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             58999728766752105679887618568999973055099999999809999999999999998999870389956865
Q gi|254781016|r  196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW  275 (355)
Q Consensus       196 ~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~  275 (355)
                      .++++.+.+    .||..+......+--++.- -..-.+..-++.|+.++| ..++..+|+|  .+|.-.+..-      
T Consensus       163 ~v~~iP~~e----~sT~~aR~vLP~~~~~~da-V~n~s~~a~lv~al~~~~-~~l~~~~~~D--~ihepyR~~L------  228 (299)
T COG0083         163 LVVVIPNFE----VSTAEARKVLPKSYSRKDA-VFNLSRAALLVAALLEGD-PELLRAMMKD--VIHEPYRAKL------  228 (299)
T ss_pred             EEEEECCCC----CCHHHHHHHCCCCCCHHHH-HHHHHHHHHHHHHHHCCC-HHHHHHHHCC--CCCHHHHHHH------
T ss_conf             999908965----6579999746566888999-999999999999997699-9999987036--0104666532------


Q ss_pred             CHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHHHHHHHHHHHHH
Q ss_conf             7889999999999742896199997779817999558989999999763
Q gi|254781016|r  276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE  324 (355)
Q Consensus       276 ~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~  324 (355)
                      -|..-++.+   -..+.|--..+=-.|||.+..||.+.+.+.+.+.+.+
T Consensus       229 ~P~~~~v~~---~a~~~gA~g~~lSGAGPTi~al~~~~~~e~~~~~~~~  274 (299)
T COG0083         229 VPGYAEVRE---AALEAGALGATLSGAGPTVFALADESDAEKAAALLEE  274 (299)
T ss_pred             CCCHHHHHH---HHHHCCCEEEEEECCCCEEEEEECCCHHHHHHHHHHH
T ss_conf             701899999---9864796599996478707998454206679999999


No 5  
>PRK01212 homoserine kinase; Provisional
Probab=99.65  E-value=5.2e-14  Score=118.31  Aligned_cols=249  Identities=19%  Similarity=0.159  Sum_probs=157.3

Q ss_pred             CCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCE---ECCCCCHHHHHHHHHHHHHHHHCCC--EEEEEEECCCCCCCH
Q ss_conf             57898434681278107999971788857998787---2566520689999997421676194--399998502332110
Q gi|254781016|r   47 LPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ---KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAG  121 (355)
Q Consensus        47 lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~---~~~~~~~~~~ri~~~l~~~r~~~~~--~~~I~S~N~fPtaaG  121 (355)
                      =|=-++|.+-|+ +|-+.+++..+   +.+.+.|.   ..+..++  .-+.+....+.+..+.  .++|+-++++|.++|
T Consensus        16 G~GFD~lg~Al~-l~d~v~v~~~~---~~~~~~g~~~~~lP~d~~--Nlv~~a~~~~~~~~g~~~g~~I~i~k~IP~~~G   89 (293)
T PRK01212         16 GPGFDSLGLALS-LYDEVTVEEAD---FSLEVEGEFADKLPLDEE--NLVYQAALKFLEKLGKPPGLRLELEKNIPLGRG   89 (293)
T ss_pred             CCCHHHHHCCCC-CCCEEEEEECC---CEEEEEECCCCCCCCCCC--CHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC
T ss_conf             737466654567-77599999868---789998168666999998--179999999999839998879999718986566


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCC---CHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCCEEEE
Q ss_conf             12322479999999999818899988999886521353---034310562002578987654413101566686421589
Q gi|254781016|r  122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGS---ACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL  198 (355)
Q Consensus       122 LASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGS---A~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i  198 (355)
                      |+||||..+|...+++++++++++.+++-.+|..+-|-   .+.+++||++....+.   +.....++..   +++..++
T Consensus        90 LGsssa~aaa~l~a~n~l~~~~ls~~eL~~lA~~~e~H~DNv~P~~~GG~~~~~~~~---~~~~~~~~~~---~~~~~vl  163 (293)
T PRK01212         90 LGSSAASIVAALVAANELLGLPLSKEELLQLAGEGEGHPDNVAPALLGGLVLALEEN---GVISVKIPVF---DDWKWVV  163 (293)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCEEECCEEEEECCC---CEEEEECCCC---CCEEEEE
T ss_conf             575188999999999998179989899999999842676655774526778996279---6489974788---7648999


Q ss_pred             EEECCCCCCCCCCHHHHHHHHH-CHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECH
Q ss_conf             9972876675210567988761-856899997305509999999980999999999999999899987038995686578
Q gi|254781016|r  199 LKIIDREKKIGSREAMEITRHH-SPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK  277 (355)
Q Consensus       199 ~iv~~~~K~vsSt~gm~~~v~t-Sp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~  277 (355)
                      ++.+.+    .||.-+...... -++ ...+ ..-.+...+..++.++|++.+++..+ |  .||+-....      +-|
T Consensus       164 ~~P~~~----vsT~~aR~~Lp~~~~~-~dav-~~~~~~~~l~~al~~~d~~~l~~~~~-D--~lhep~r~~------liP  228 (293)
T PRK01212        164 AIPGIE----LSTAEARAVLPKQYSR-KDAV-FNSSRLALLVAALYTGDYELAGAAMK-D--VLHEPYRAK------LIP  228 (293)
T ss_pred             EECCCC----CCHHHHHHHCCCCCCH-HHHH-HHHHHHHHHHHHHHCCCHHHHHHHHC-C--HHHHHHHHH------HCC
T ss_conf             948967----4489999856032887-8988-65534378899998399999998740-0--223567876------385


Q ss_pred             HHHHHHHHHHHHHHCC-CEEEEEECCCCEEEEEECHHH-HHHHHHHHHHCC
Q ss_conf             8999999999974289-619999777981799955898-999999976321
Q gi|254781016|r  278 ETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKI-EETIKQFFPEIT  326 (355)
Q Consensus       278 ~t~~ii~~v~~~R~~g-~~v~fT~DAGPNv~il~~~~~-~~~i~~~l~~i~  326 (355)
                      +..++.+.   +++.| ..++.+ .+||.|.-||..++ ++.|.+.+.+..
T Consensus       229 ~~~~i~~~---~~~~GA~~~~lS-GSGptv~al~~~~~~A~~i~~~l~~~~  275 (293)
T PRK01212        229 GFAEVRQA---ALEAGALGAGIS-GAGPTVFALCDKEDAAEAVADALEKAF  275 (293)
T ss_pred             CHHHHHHH---HHHCCCCEEEEE-CHHHHEEEEECCHHHHHHHHHHHHHHH
T ss_conf             69999999---997899789998-741112489778899999999999976


No 6  
>PRK01123 shikimate kinase; Provisional
Probab=99.57  E-value=2.3e-12  Score=106.87  Aligned_cols=228  Identities=18%  Similarity=0.240  Sum_probs=131.5

Q ss_pred             CCCEEEEEEECCCCCC-EEEECCEECCCCCHHHHHHHHHHHHHHHHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             7810799997178885-79987872566520689999997421676194--39999850233211012322479999999
Q gi|254781016|r   59 HLGTITHITVIDSDAD-CIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA  135 (355)
Q Consensus        59 ~~~T~T~v~~~~~~~d-~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~A  135 (355)
                      ++.|+.+|+..+.+.. .....+.+... ..   -+.+..+.+.+..+.  .++|+.+.++|.++||+|||+..+|+..|
T Consensus        28 dL~~~a~v~~~~~~~~~~~~~~~~~~~~-~~---l~~~~~~~~~~~~~i~~g~~i~i~s~IP~~~GL~SSSA~a~A~i~a  103 (283)
T PRK01123         28 DLKTTATVELSDSGSKIKGEVSGYPDAD-TR---LVERCVELVLERFGIDYGGTVRTESEIPVASGLKSSSAAANALVLA  103 (283)
T ss_pred             CCEEEEEEEECCCCCCCCCCCCCCCCCC-HH---HHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             6459999998777764442005788756-38---9999999999862998775999955898667853789999999999


Q ss_pred             HHHHHCCCCCHHHHHHHHHHC--------CC---CCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCC
Q ss_conf             999818899988999886521--------35---3034310562002578987654413101566686421589997287
Q gi|254781016|r  136 LFRIYSIPEKSESLSRVARLG--------SG---SACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR  204 (355)
Q Consensus       136 l~~~~~~~~~~~~lS~lARlG--------SG---SA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~  204 (355)
                      ++++++.+++..++-++|-..        +|   -+|-|++||+++-...     ..  .+....+. +..++|++.  .
T Consensus       104 ~~~~~~~~Ls~~ei~~la~ea~~~~g~siTGa~DDa~As~~GG~~ltdn~-----~~--~ii~~~~~-~~~~vV~ip--~  173 (283)
T PRK01123        104 TLDALGEKLDDLDILRLGVKASKEAGVTVTGAFDDACASYFGGVCVTDNR-----EM--KILKRDEV-EGPVVVLIP--P  173 (283)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHCCCEEEEECC-----CC--EEEECCCC-CCCEEEEEC--C
T ss_conf             99985899899999999999862078152367511667744977998188-----74--36651489-985899989--9


Q ss_pred             CCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHH
Q ss_conf             66752105679887618568999973055099999999809999999999999998999870389956865788999999
Q gi|254781016|r  205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME  284 (355)
Q Consensus       205 ~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~  284 (355)
                      .+...++.--.+.           +.....++.+.+.+.++|+..        ++.++.+...+-  +-|  |  .   +
T Consensus       174 ~~~~t~~~~~~~~-----------~~i~~~~~~a~~~~~~g~~~~--------Am~~Ngl~~~~~--l~~--~--~---~  225 (283)
T PRK01123        174 EKAFSANVDVERM-----------KLIAPYVEMAFELALAGDYFK--------AMTLNGLLYSSA--LGF--P--T---E  225 (283)
T ss_pred             CCCCCCCCCHHHH-----------HHHHHHHHHHHHHHHCCCHHH--------HHHHHHHHHHHH--CCC--C--H---H
T ss_conf             7773762767888-----------774389999999987798989--------987502642454--179--8--7---9


Q ss_pred             HHHHHHHCC-CEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCCCC
Q ss_conf             999974289-619999777981799955898999999976321003
Q gi|254781016|r  285 RVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIID  329 (355)
Q Consensus       285 ~v~~~R~~g-~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~~~  329 (355)
                      .+.+..+.| ..+..| .+||.|+.||.+++.+.|++.+.+.+.+.
T Consensus       226 ~~~~al~~GAlga~iS-GsGPsi~al~~~e~~~~v~ea~~~~G~vi  270 (283)
T PRK01123        226 PILDALEAGAVGAGLS-GTGPSYVALFDEENPEEVKEAWSKYGKVI  270 (283)
T ss_pred             HHHHHHHCCCEEEEEE-CCCCEEEEEECCCCHHHHHHHHHHCCCEE
T ss_conf             9999997598499982-68987999980776799999998679889


No 7  
>PRK00128 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=99.40  E-value=1.7e-09  Score=86.84  Aligned_cols=260  Identities=16%  Similarity=0.180  Sum_probs=155.8

Q ss_pred             CCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCC-
Q ss_conf             4884248811677670117578984346812781079999717888579987872566520689999997421676194-
Q gi|254781016|r   28 LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV-  106 (355)
Q Consensus        28 ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~-  106 (355)
                      |-.|+-| +=-|||+.-  .-.-.|+=.++| ++-+-+++..+..+..+..+|...+..+.  .-|.+.++.+++..+. 
T Consensus         7 AKINL~L-~V~~kr~dG--yH~l~sl~~~i~-l~D~i~i~~~~~~~i~~~~~~~~~p~~~~--Nlv~ka~~~l~~~~~~~   80 (281)
T PRK00128          7 AKINLSL-DVLGKREDG--YHEVEMIMTTID-LADRLEIEKLKEDKIVVESNSGYVPNDER--NLAYKAAKLLKERYNIK   80 (281)
T ss_pred             CCEECCE-ECCCCCCCC--CCEEEEEEEEEC-CCCEEEEEECCCCCEEEEECCCCCCCCCC--CHHHHHHHHHHHHHCCC
T ss_conf             5583443-028838999--883568999916-87299999978998899978887888985--69999999999974999


Q ss_pred             -EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEEE
Q ss_conf             -3999985023321101232247999999999981889998899988652135303431056200257898765441310
Q gi|254781016|r  107 -YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV  185 (355)
Q Consensus       107 -~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a~  185 (355)
                       .+.|.-+-|+|.+|||++++|-.||+..+++++++++++.+++..+|+.....-.-.++||.+.. .|.++.   -  .
T Consensus        81 ~~~~I~l~K~IP~gaGLGGGSSdAAa~L~~ln~l~~~~ls~~eL~~la~~iGaDVpffl~g~~a~~-~G~Ge~---i--~  154 (281)
T PRK00128         81 KGVRITIDKNIPVAAGLAGGSSDAAATLRGLNKLWNLGLSLEELAEIGLKIGSDVPFCIYGGTALA-TGRGEK---I--T  154 (281)
T ss_pred             CCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCHHCCCCEEE-ECCCCE---E--E
T ss_conf             874899985798667778512889999999999847999999999999872788441104775698-558967---6--7


Q ss_pred             ECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             15666864215899972876675210567988761856899997305509999999980999999999999999899987
Q gi|254781016|r  186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM  265 (355)
Q Consensus       186 ~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~  265 (355)
                      ++. ..+++.+  ++|..+. .+ ||.-+-+...-+.       ....+...+..++.++|+..+.+...+   .+-..-
T Consensus       155 ~l~-~~~~~~~--vLv~P~~-~v-sT~~vy~~~~~~~-------~~~~~~~~~~~~l~~~d~~~~~~~l~N---dle~~a  219 (281)
T PRK00128        155 PLK-PPPSCWV--VLAKPDI-GV-STKDVYKNLDLDK-------IYHPDTEKLIEAIENGDYQGICASMGN---VLEPVT  219 (281)
T ss_pred             ECC-CCCCCEE--EEECCCC-CC-CHHHHHHHCCCCC-------CCCCCHHHHHHHHHCCCHHHHHHHHHH---HHHHHH
T ss_conf             888-7888589--9988999-97-8699998528002-------678776889998862899999886340---379999


Q ss_pred             HCCCCCEEEECHHHHHHHHHHHHHHHCCC-EEEEEECCCCEEEEEECH-HHHHHHHHHHHHC
Q ss_conf             03899568657889999999999742896-199997779817999558-9899999997632
Q gi|254781016|r  266 IAASPPLLYWQKETIQGMERVWDARQQSI-PIYFTLDAGPNLKLLFTH-KIEETIKQFFPEI  325 (355)
Q Consensus       266 ~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~-~v~fT~DAGPNv~il~~~-~~~~~i~~~l~~i  325 (355)
                      ..-       .|+-.++.+..   ++.|- .+..| ..||.|+-+|.. ++++++.+.|+..
T Consensus       220 ~~~-------~P~i~~i~~~l---~~~Ga~~~~mS-GSGst~Falf~~~~~A~~~~~~Lk~~  270 (281)
T PRK00128        220 LKK-------HPEIAKIKERM---LKFGADGALMS-GSGPTVFGLFDDESRAQRIYNGLKGF  270 (281)
T ss_pred             HHH-------CHHHHHHHHHH---HHCCCCEEEEE-CCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             985-------95999999999---85799858987-72121899989999999999986714


No 8  
>PTZ00299 homoserine kinase; Provisional
Probab=99.40  E-value=7.2e-11  Score=96.37  Aligned_cols=292  Identities=15%  Similarity=0.163  Sum_probs=169.8

Q ss_pred             CCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEE---CCCCC-H-HHHHHH
Q ss_conf             776378974884248811677670117578984346812781079999717888579987872---56652-0-689999
Q gi|254781016|r   20 INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK---ISSQS-S-FFKKTT   94 (355)
Q Consensus        20 ~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~---~~~~~-~-~~~ri~   94 (355)
                      ...+.+.++|.-+|           +.=|=-++|.+-|+ .|.+.+++.  .+...+.+.|+.   .+..+ . ..+-+.
T Consensus         4 ~~~kV~V~VPATsA-----------NLGpGFD~LGlAL~-ly~ev~v~~--~~~~~i~i~g~g~~~ip~d~~Nlv~~a~~   69 (336)
T PTZ00299          4 LPKKVVLRVPATTA-----------NIGPAYDTLGMALS-IFMELTVEH--ADAFSMTVEGEGSEHISTDEDNMVVQACR   69 (336)
T ss_pred             CCCEEEEEECCCHH-----------HCCCCHHHHHHHCC-CCCEEEEEE--CCCCEEEEEECCCCCCCCCCCCHHHHHHH
T ss_conf             89759999674446-----------44523675253036-774899998--89717999706777799996114999999


Q ss_pred             HHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCC---CHHHHHHHHHHCCC---CCHHHHCCCC
Q ss_conf             99742167619439999850233211012322479999999999818899---98899988652135---3034310562
Q gi|254781016|r   95 QFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE---KSESLSRVARLGSG---SACRSFYRGF  168 (355)
Q Consensus        95 ~~l~~~r~~~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~---~~~~lS~lARlGSG---SA~RSi~GG~  168 (355)
                      ..++.+-......++|+-+|++|.+.||+|||++..|-..+.+.+.++.+   +.+++-.+|-.++|   ..+.++||||
T Consensus        70 ~~~~~~~~~~~~~~~i~i~~~IP~~rGLGSSAaAiVaG~~aan~L~g~~l~~~~~~~ll~~a~~~EgHPDNVAPAllGG~  149 (336)
T PTZ00299         70 LAFEEYAHKSMPPLKFIMHSNIPYGCGCGSSSAAAVAGFVAGMKLCGLTMETENEEALLQAIAKFEGHPDNAAPAIYGGI  149 (336)
T ss_pred             HHHHHHCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCE
T ss_conf             99998569788963899836888766751388999999999998626887755899999987621689745543245886


Q ss_pred             HH-CCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             00-25789876544131015666864215899972876675210567988761856899997305509999999980999
Q gi|254781016|r  169 CE-WICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDF  247 (355)
Q Consensus       169 v~-W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df  247 (355)
                      ++ |...  ......+.++.+   +++..++++.+.+-+  .||+.+.......--++.=+ ..-.++.-+..++..+|+
T Consensus       150 ~l~~~~~--~~~~~~~~ip~p---~~l~~Vv~iP~~~~~--lsT~~AR~vLP~~v~~~daV-~n~~r~a~lv~al~~~d~  221 (336)
T PTZ00299        150 QLVYKKD--NGRFLTYRVPTP---PNLSVVLFVPHNKMK--ANTHVTRNLIPTSVSLEDAV-FNISRTSILVLALSTGDL  221 (336)
T ss_pred             EEEEECC--CCCEEEEECCCC---CCCEEEEEECCCCCE--ECHHHHHHHCCCCCCHHHHH-HHHHHHHHHHHHHHCCCH
T ss_conf             9999728--982799977999---884899997897633--06899996586768899999-999999999999954989


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCC-CEEEEEECCCCEEEEEEC------------HHH
Q ss_conf             9999999999998999870389956865788999999999974289-619999777981799955------------898
Q gi|254781016|r  248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFT------------HKI  314 (355)
Q Consensus       248 ~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g-~~v~fT~DAGPNv~il~~------------~~~  314 (355)
                      +.+. .+ .|  ++|+-.+..     -+-|...++.+..   .+.| +.++.+ .|||.|.-||.            ++.
T Consensus       222 ~ll~-~~-~D--~ihepyR~~-----~LiP~~~~v~~~a---~~aGA~g~~iS-GAGPTi~Al~~g~~~~~~~~~~~~~~  288 (336)
T PTZ00299        222 RMLK-SC-SD--KLHEQQRSD-----ALFPHFRPCVKAA---REAGAHYAFLS-GAGPSVCALVGGRHGDPLTQPREERK  288 (336)
T ss_pred             HHHH-HC-CC--EEECCCHHH-----HCCCCHHHHHHHH---HHCCCEEEEEE-CHHHHHHEEECCCCCCCCCCCCHHHH
T ss_conf             8997-48-73--486520233-----2262799999999---87899499997-64222442621556653224410345


Q ss_pred             HHHHH----HHHHHCCC-----CCCCCCCCCCCCCCCCCCC
Q ss_conf             99999----99763210-----0368887512000002432
Q gi|254781016|r  315 EETIK----QFFPEITI-----IDPLDSPDLWSTKDSLSQK  346 (355)
Q Consensus       315 ~~~i~----~~l~~i~~-----~~~~~~~~~~~~~~~~~~~  346 (355)
                      .++|.    +.|.+.++     +......+..+++..-.-+
T Consensus       289 a~~V~~aM~~a~~~~gi~~~~~i~~~~~~G~~vi~~~~~~~  329 (336)
T PTZ00299        289 AESVAEAMIKAAEAVGVAGRVIITQPSDQGVHLVGTTCIRP  329 (336)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEECCCCCCC
T ss_conf             99999999999998698458999346778878965645678


No 9  
>PTZ00298 mevalonate kinase; Provisional
Probab=99.40  E-value=1e-09  Score=88.29  Aligned_cols=212  Identities=15%  Similarity=0.191  Sum_probs=130.2

Q ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH------C--CC-CCHHHHCCCCHHCCCCCCC
Q ss_conf             3999985023321101232247999999999981889998899988652------1--35-3034310562002578987
Q gi|254781016|r  107 YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL------G--SG-SACRSFYRGFCEWICGTDQ  177 (355)
Q Consensus       107 ~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl------G--SG-SA~RSi~GG~v~W~~g~~~  177 (355)
                      .++|...-+.|.++||+||||...|++.|+.++++++++.+++..+|..      |  || -..-|.|||++...++...
T Consensus        94 g~~i~i~S~iP~gaGLGSSAAv~VA~~~Al~~~~~~~ls~~~i~~~A~~~E~~~hG~pSGiD~~~s~~Gg~i~f~~~~~~  173 (328)
T PTZ00298         94 GLKMHLGGPLVPSSGIGASASDVVSLSRALSELYQLNLTEEEVNLSAFVGEGGYHGTPSGADNTAATYGGLISYRRVNGK  173 (328)
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCEEEEEECCCC
T ss_conf             53899705888656735068899999999999847999999999999999998558997276999945987999854886


Q ss_pred             CCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH----HC-HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             654413101566686421589997287667521056798876----18-5689999730550999999998099999999
Q gi|254781016|r  178 NGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRH----HS-PFFTQWTQQISTDLAHIKQAIIDQDFIKLGE  252 (355)
Q Consensus       178 ~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~----tS-p~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~  252 (355)
                      ....  .+.+.     ....+++++++.+  .+|..+-..|.    .. ..|+.=++...+-..+..++++++|+..||+
T Consensus       174 ~~~~--~i~~~-----~~~~lvi~dtg~~--~~T~~~V~~V~~~~~~~p~~~~~i~~~~~~iv~~a~~aL~~~d~~~lG~  244 (328)
T PTZ00298        174 SVFK--RIAFQ-----QPLYLVVCSTGIT--ASTTKVVGDVRKLKENQPTWFNRLLENYNACVSEAKEALQKGNLFRVGE  244 (328)
T ss_pred             CCCE--ECCCC-----CCCEEEEEECCCC--CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             4420--23678-----9706999836986--5369999999999865869999999999999999999986489999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCC-CEEEEEECCCC--EEEEEECH-HHHHHHHHHHHHCCCC
Q ss_conf             99999998999870389956865788999999999974289-61999977798--17999558-9899999997632100
Q gi|254781016|r  253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGP--NLKLLFTH-KIEETIKQFFPEITII  328 (355)
Q Consensus       253 i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g-~~v~fT~DAGP--Nv~il~~~-~~~~~i~~~l~~i~~~  328 (355)
                      ++-.+    |.++.+=  .+.  +|.--++   |+..|+.| +.+=.| .||=  -+..||+. ++++.|.+.+.+-.. 
T Consensus       245 Lm~~n----h~lL~~l--gVS--~p~Ld~l---v~~a~~~GAlGAKLT-GAG~GGcvIaL~~~~~~a~~i~~al~~~~~-  311 (328)
T PTZ00298        245 LMNAN----HDLCQKL--TVS--CRELDSI---VQTCRTYGALGAKMS-GTGRGGLVVALAASEDQRDAIAKAVRARCP-  311 (328)
T ss_pred             HHHHH----HHHHHHC--CCC--CHHHHHH---HHHHHHCCCCEEEEC-CCCCCCEEEEECCCHHHHHHHHHHHHHHCC-
T ss_conf             99999----9989746--889--7899999---999997699655751-468875899983866669999999997466-


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             368887512000002
Q gi|254781016|r  329 DPLDSPDLWSTKDSL  343 (355)
Q Consensus       329 ~~~~~~~~~~~~~~~  343 (355)
                        . ....|.-.++-
T Consensus       312 --~-a~~~w~~~~~~  323 (328)
T PTZ00298        312 --E-AKFVWRYTVQP  323 (328)
T ss_pred             --C-CCCEEEEEECC
T ss_conf             --7-73059999556


No 10 
>PRK04344 consensus
Probab=99.35  E-value=4.3e-09  Score=83.96  Aligned_cols=267  Identities=16%  Similarity=0.138  Sum_probs=159.6

Q ss_pred             CEEEECCCCEEEE-ECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHH
Q ss_conf             3789748842488-116776701175789843468127810799997178885799878725665206899999974216
Q gi|254781016|r   23 KSSAFLPSNIALC-KYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFR  101 (355)
Q Consensus        23 ~~ta~ap~NIALI-KYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r  101 (355)
                      +.+.+||.-|=|- +=.|||+.-  .-.-.|+=.++| ++-+-+++..+..+.++..++...+..++  .-|.+.++.++
T Consensus         2 ~i~~kapAKINL~L~V~~kr~dG--yH~l~s~~~~i~-l~D~i~i~~~~~~~i~i~~~~~~~p~~~~--Nlv~ka~~~l~   76 (284)
T PRK04344          2 KIYEKAPAKINLSLDTLFKRDDG--YHEVEMIMTTID-LADRLTLEELKEDKIVVDSENRFVPSDQR--NLAYQAAKLLK   76 (284)
T ss_pred             CEEEEECEEEECCCCCCCCCCCC--CCEEEEEEEEEC-CCCEEEEEECCCCCEEEEECCCCCCCCCC--HHHHHHHHHHH
T ss_conf             05167121285333227758999--822689999956-88299999988998899978876888762--19999999999


Q ss_pred             HHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCC
Q ss_conf             76194--3999985023321101232247999999999981889998899988652135303431056200257898765
Q gi|254781016|r  102 QFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG  179 (355)
Q Consensus       102 ~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~  179 (355)
                      +..+.  .+.|.-+-|+|.+|||++++|-.||+..+++++++++++.+++..+|+.....-.-+++||.+. ..|.++. 
T Consensus        77 ~~~~~~~~~~I~l~KnIPvgaGLGGGSSdAAa~L~~Ln~l~~l~ls~~~L~~la~~lGaDVPffl~g~~a~-~~G~Ge~-  154 (284)
T PRK04344         77 ERYNIKKGVTISIDKHIPVAAGLAGGSSDAAATLRGLNRLWNLGLSLEELAELGSEIGSDVPFCVYGGTAL-ATGRGEK-  154 (284)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEEECCCEE-EECCCCE-
T ss_conf             97598997699999789886788986157999999999985689999999999986279864898276189-9858965-


Q ss_pred             CCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             44131015666864215899972876675210567988761856899997305509999999980999999999999999
Q gi|254781016|r  180 MDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL  259 (355)
Q Consensus       180 sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal  259 (355)
                        .  .++.. .+++.+  +++....  ..||.-+=.....+       .....++..+..++..+|+..+.....+   
T Consensus       155 --l--~~l~~-~~~~~~--vlv~P~~--~vST~~vy~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~N---  215 (284)
T PRK04344        155 --I--EPLPT-PPSCWV--VLAKPNI--GVSTPDIFKNLNLD-------RIEHPDTDKMVEAIENGDYQQICQSLGN---  215 (284)
T ss_pred             --E--EECCC-CCCCEE--EEECCCC--CCCHHHHHHHCCCC-------CCCCCCHHHHHHHHHCCCHHHHHHHCCC---
T ss_conf             --0--79987-787589--9988999--96739999745800-------0468777899998862799999977348---


Q ss_pred             HHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHH-HHHHHHHHHHHC
Q ss_conf             899987038995686578899999999997428961999977798179995589-899999997632
Q gi|254781016|r  260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK-IEETIKQFFPEI  325 (355)
Q Consensus       260 ~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~-~~~~i~~~l~~i  325 (355)
                      .|-.....-       .|+-.++.+.   +++.|-..+.=-..||.|+-||..+ .++++.+.|+..
T Consensus       216 dle~~~~~~-------~P~i~~i~~~---l~~~Ga~~~~mSGSGstvF~lf~~~~~A~~~~~~lk~~  272 (284)
T PRK04344        216 VLEPVTLAK-------HPEIAKIKNR---MLKFGADAALMSGSGPTVFGLCRKESRAQRIYNGLKGF  272 (284)
T ss_pred             CHHHHHHHH-------CHHHHHHHHH---HHHCCCCEEEEECCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             568999985-------9399999999---99679986899772512489989999999999987875


No 11 
>PRK03188 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=99.35  E-value=1.1e-09  Score=88.16  Aligned_cols=270  Identities=13%  Similarity=0.077  Sum_probs=165.3

Q ss_pred             EEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEE---CCCCCHHHHHHHHHHHHHH
Q ss_conf             8974884248811677670117578984346812781079999717888579987872---5665206899999974216
Q gi|254781016|r   25 SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK---ISSQSSFFKKTTQFCDLFR  101 (355)
Q Consensus        25 ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~---~~~~~~~~~ri~~~l~~~r  101 (355)
                      .|-|-.|+.|= --|||+.-  .-.-.|+=.++| ++-+  +++.+.+.+++.++|..   .+..+.  .-|.+.++.++
T Consensus         4 ~apAKINL~L~-V~~kr~dG--yH~l~s~~~~i~-l~D~--i~i~~~~~~~~~~~~~~~~~~P~d~~--Nlv~kA~~~~~   75 (299)
T PRK03188          4 RAPGKVNLHLG-VGPLREDG--YHELATVFQAVS-LYDE--VTVTPADDLSLTVSGEGADQVPTDES--NLAWRAAELLA   75 (299)
T ss_pred             EEEEEEECCCC-CCCCCCCC--CCCEEEEEEEEC-CCEE--EEEEECCCCEEEEECCCCCCCCCCCC--CHHHHHHHHHH
T ss_conf             75012820403-38879999--851358999936-8719--99999999829995787344889986--49999999999


Q ss_pred             HHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCC
Q ss_conf             76194--3999985023321101232247999999999981889998899988652135303431056200257898765
Q gi|254781016|r  102 QFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG  179 (355)
Q Consensus       102 ~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~  179 (355)
                      +..+.  .+.|.-+.++|.++||++++|..||...+++++++++++.++|..+|+....--.-+++||.+.. .|.++. 
T Consensus        76 ~~~~~~~~~~I~l~K~IP~gaGLGGGSsdAAa~L~~ln~l~~l~ls~~eL~~lA~~lGsDVPffL~gg~a~~-~G~Ge~-  153 (299)
T PRK03188         76 EHVGRAPDVHIHIDKGIPVAGGMAGGSADAAAALVACDALWGLGLSRDELLALAAELGSDVPFALLGGTALG-TGRGEE-  153 (299)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCEEE-EECCCE-
T ss_conf             972999976999995797767777407899999999999717997989999999861788763762786899-974867-


Q ss_pred             CCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             44131015666864215899972876675210567988761856899997305509999999980999999999999999
Q gi|254781016|r  180 MDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL  259 (355)
Q Consensus       180 sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal  259 (355)
                        ...+  . ..+.+.++  ++.... .+ ||...-...... ....-......+...+.+++..+|++.+.+...+|  
T Consensus       154 --l~pl--~-~~~~~~~v--lv~P~~-~v-ST~~ay~~ld~~-~~~~~~~~~~~~~~~l~~al~~gd~~~l~~~l~Nd--  221 (299)
T PRK03188        154 --LAPV--L-ARGTFHWV--LAFADG-GL-STPAVFRELDRL-REAGPDPPRLGDPEPLLAALAAGDPAQLAPLLGND--  221 (299)
T ss_pred             --EEEC--C-CCCCCEEE--EECCCC-CC-CHHHHHHHHHHH-CCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHCCC--
T ss_conf             --6888--7-67863799--986899-94-729999977764-23667765667879999999839999998871686--


Q ss_pred             HHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECH-HHHHHHHHHHHHCCC
Q ss_conf             89998703899568657889999999999742896199997779817999558-989999999763210
Q gi|254781016|r  260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH-KIEETIKQFFPEITI  327 (355)
Q Consensus       260 ~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~-~~~~~i~~~l~~i~~  327 (355)
                       |...-       +-+-|+--++.+   .+++.|-....=-.+||.|+-||.. ++++.+.+.+..-++
T Consensus       222 -Le~~a-------~~l~P~i~~i~~---~l~~~Ga~~a~mSGSGsTvFalf~~~~~A~~~a~~l~~~g~  279 (299)
T PRK03188        222 -LQAAA-------LSLRPELRRTLR---AGEEAGALAGIVSGSGPTCAFLCASADSAVDVAAALSGAGV  279 (299)
T ss_pred             -HHHHH-------HHCCCHHHHHHH---HHHHCCCCEEEEECCCCCEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             -06778-------771909999999---99967998789978440102797899999999999975793


No 12 
>PRK03926 mevalonate kinase; Provisional
Probab=99.32  E-value=9.7e-09  Score=81.48  Aligned_cols=261  Identities=18%  Similarity=0.187  Sum_probs=151.1

Q ss_pred             EEEECCCCEEEE----ECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHH
Q ss_conf             789748842488----1167767011757898434681278107999971788857998787256652068999999742
Q gi|254781016|r   24 SSAFLPSNIALC----KYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDL   99 (355)
Q Consensus        24 ~ta~ap~NIALI----KYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~   99 (355)
                      ..+.||--|=||    =|+|+          +-|.+.++ .+|+.+++..   .|.+++...... ......-+...++.
T Consensus         3 i~asAPGrv~LiGEH~v~~G~----------~aia~AI~-~~~~v~~~~~---~d~i~~~~~~~~-~~~~~~~~~~~l~~   67 (302)
T PRK03926          3 VLCSAPGKIYLFGEHAVVYGK----------PAIACAID-LRTRVRAELN---DDSIYIQSDYGK-TGEVHPYVRAAIEK   67 (302)
T ss_pred             EEEEECEEEEEEECCEEECCC----------EEEEEEEC-CCEEEEEEEC---CCEEEEECCCCC-CCCHHHHHHHHHHH
T ss_conf             999807899999387698696----------08999937-8199999998---990699754776-54200799999999


Q ss_pred             HHHHCCC-EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH------C--CC-CCHHHHCCCCH
Q ss_conf             1676194-3999985023321101232247999999999981889998899988652------1--35-30343105620
Q gi|254781016|r  100 FRQFSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL------G--SG-SACRSFYRGFC  169 (355)
Q Consensus       100 ~r~~~~~-~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl------G--SG-SA~RSi~GG~v  169 (355)
                      +++.... .+.|....++|.++||+||||--.|++.|+.++++++++.+++..+|..      |  || -..-|.|||+.
T Consensus        68 ~~~~~~~~G~~i~I~S~iP~gaGLgSSAAl~va~~~al~~~~g~~ls~~~la~la~~~E~~~~G~~sGiD~~~s~~Gg~~  147 (302)
T PRK03926         68 VREEADKDGVDLSITSQIPVGSGLGSSAAVTVATIGALNKLLGLGLSLEEIAKMGHEVELLVQGAASPTDTYVSTIGGFV  147 (302)
T ss_pred             HHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCEE
T ss_conf             99756899837999656887778763899999999999985489989999999999999874689978899999759989


Q ss_pred             HCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH----HCH-HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02578987654413101566686421589997287667521056798876----185-6899997305509999999980
Q gi|254781016|r  170 EWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRH----HSP-FFTQWTQQISTDLAHIKQAIID  244 (355)
Q Consensus       170 ~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~----tSp-~y~~r~~~~~~~~~~~~~ai~~  244 (355)
                      ....+.        .++    .+++.  +++.+.+.+  .+|......+.    ..| .++.-++...+...++.+++.+
T Consensus       148 ~~~~~~--------~l~----~~~~~--l~l~~tg~~--~~t~~~v~~v~~~~~~~~~~~~~~~~~~~~i~~~a~~~l~~  211 (302)
T PRK03926        148 TIPDRK--------KLP----FMDCG--IVVGYTGSS--GSTKELVANVRKLYEEYPELIEPILESIGKLSEKAEELVLS  211 (302)
T ss_pred             EECCCC--------CCC----CCCCC--EEEEECCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             966789--------777----78978--899983974--65999999999998766999999999999999999987765


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCC-CEEEEEECCC--CEEEEEECHHHHHHHHHH
Q ss_conf             9999999999999998999870389956865788999999999974289-6199997779--817999558989999999
Q gi|254781016|r  245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAG--PNLKLLFTHKIEETIKQF  321 (355)
Q Consensus       245 ~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g-~~v~fT~DAG--PNv~il~~~~~~~~i~~~  321 (355)
                      +|+..||+++..+    |.++ ... .+.  +|+--++   |...|+.| +.+=-| .||  =-+..|++++..+.|.+.
T Consensus       212 ~d~~~lG~Lm~~~----h~ll-~~l-gVS--~peld~l---v~~a~~~GalGAKlt-GaG~GGc~iaL~~~d~~~~v~~a  279 (302)
T PRK03926        212 GDYVSIGELMNIN----QGLL-DAL-GVS--TKELSEL---VYAARTAGAFGAKIT-GAGGGGCMVALTAPDKCREVATA  279 (302)
T ss_pred             CCHHHHHHHHHHH----HHHH-HHC-CCC--CHHHHHH---HHHHHHCCCCEEEEC-CCCCCCEEEEEECCCCHHHHHHH
T ss_conf             6499999999996----8878-731-689--8899999---999996798288805-89876289999461319999999


Q ss_pred             HHHCCC
Q ss_conf             763210
Q gi|254781016|r  322 FPEITI  327 (355)
Q Consensus       322 l~~i~~  327 (355)
                      +.+.+.
T Consensus       280 l~~ag~  285 (302)
T PRK03926        280 IGIAGG  285 (302)
T ss_pred             HHHCCC
T ss_conf             997699


No 13 
>COG1577 ERG12 Mevalonate kinase [Lipid metabolism]
Probab=99.29  E-value=8.2e-09  Score=82.00  Aligned_cols=253  Identities=21%  Similarity=0.150  Sum_probs=144.2

Q ss_pred             CCEEEEECCCCEEEEEEECCCCCCEEEECCEECC---CCCHHHHHHHHHHHHHHHHCC----CEEEEEEECCCCCCCHHH
Q ss_conf             8434681278107999971788857998787256---652068999999742167619----439999850233211012
Q gi|254781016|r   51 NSLSLSLGHLGTITHITVIDSDADCIILNGQKIS---SQSSFFKKTTQFCDLFRQFSK----VYFLIETSNNIPTKAGLA  123 (355)
Q Consensus        51 ~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~---~~~~~~~ri~~~l~~~r~~~~----~~~~I~S~N~fPtaaGLA  123 (355)
                      |.|+.+++.. .++++...+..+..+...+-...   ..+. ..-+...++.+.+...    .++.++-.-..|-.+||+
T Consensus        22 pAI~~aI~~~-~~v~~~~s~~~~~~i~~~~~~~~~~~~~~~-~~~~~~~v~~~~e~~~~~~~~~~~l~I~S~iP~g~GLG   99 (307)
T COG1577          22 PAIAAAIDLR-VTVTISESDSNKIVIESSDLKSSTLERDED-EGYIQAAVRLASELLNQSSLKPFSLEIDSEIPIGAGLG   99 (307)
T ss_pred             CHHHEEEEEE-EEEEEEECCCCCEEEECCCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCC
T ss_conf             3151350100-899999668885798416777655456663-24899999999987332578984799962799887862


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH------CCCC---CHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCC
Q ss_conf             32247999999999981889998899988652------1353---03431056200257898765441310156668642
Q gi|254781016|r  124 SSASGFAALTLALFRIYSIPEKSESLSRVARL------GSGS---ACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL  194 (355)
Q Consensus       124 SSASgfAALa~Al~~~~~~~~~~~~lS~lARl------GSGS---A~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl  194 (355)
                      ||||...|++.|+.++|+.+++.+++..+|..      |.+|   ..-+.|||++...++.+.       ..+.-.+.. 
T Consensus       100 SSAAVsva~i~al~~~~g~~ls~~~l~~la~~~e~~vqG~~Sg~D~a~~~~gg~v~~~~~~~~-------~~l~~~~~~-  171 (307)
T COG1577         100 SSAAVSVAVIKALSAYFGVELSPEELAKLANKVELIVQGKASGIDIATITYGGLVAFKKGFDF-------EKLEIELLG-  171 (307)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCEEEEECCCCC-------CCCCCCCCC-
T ss_conf             799999999999998628988989999999999998758987614038861888998458875-------201356677-


Q ss_pred             EEEEEEECCCCCCCCCCHHHHHHHH-----HCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             1589997287667521056798876-----18568999973055099999999809999999999999998999870389
Q gi|254781016|r  195 RIGLLKIIDREKKIGSREAMEITRH-----HSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS  269 (355)
Q Consensus       195 ~~~i~iv~~~~K~vsSt~gm~~~v~-----tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~  269 (355)
                        .++|.+++..  .||.-|-.-|.     ...++..-++....-..++..++.++|++.|++++..+--.+-++-    
T Consensus       172 --~~~I~~tg~~--~sT~e~V~~V~~l~~~~~~~~~~~~~~ig~~~~~a~~al~~~d~e~lgelm~~nq~LL~~Lg----  243 (307)
T COG1577         172 --TLVIGDTGVP--GSTKELVAGVAKLLEEEPEVIDPILDAIGELVQEAEAALQTGDFEELGELMNINQGLLKALG----  243 (307)
T ss_pred             --EEEEEECCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCC----
T ss_conf             --1899974886--60899999999999864677899999999999999999861649999999999998898658----


Q ss_pred             CCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEE--C-HHHHHHHHHHHHHCCCC
Q ss_conf             95686578899999999997428961999977798179995--5-89899999997632100
Q gi|254781016|r  270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF--T-HKIEETIKQFFPEITII  328 (355)
Q Consensus       270 P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~--~-~~~~~~i~~~l~~i~~~  328 (355)
                          +-+|+-   -+.|+..|+.|..-+=...||=-=++++  . ++..+.+.+.+.+.++.
T Consensus       244 ----Vs~~~L---~~lv~~a~~~Ga~gaKlTGAGgGGc~IaL~~~~~~~~~l~~~~~~~~i~  298 (307)
T COG1577         244 ----VSTPEL---DELVEAARSLGALGAKLTGAGGGGCIIALAKNEEIAETLSNRLEKAGIA  298 (307)
T ss_pred             ----CCCHHH---HHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCC
T ss_conf             ----486899---9999999866951002146888866999835515899999888865863


No 14 
>TIGR00191 thrB homoserine kinase; InterPro: IPR000870 Saccharomyces cerevisiae strains containing the erg8-1 mutation are temperature sensitive for growth due to a defect in phosphomevalonate kinase, an enzyme of isoprene and ergosterol biosynthesis. Subcloning and DNA sequencing have defined the functional ERG8 regulon as an 850bp upstream region and an adjacent 1,272bp open reading frame. The deduced ERG8 protein contains 424 residues and shows no similarity to known proteins, except within a putative ATP-binding domain present in many kinases . Enzymes that share the N-terminal Gly/Ser-rich putative ATP-binding region include galactokinase, homoserine kinase, mevalonate kinase and phosphomevalonate kinase. Homoserine kinase is a homodimeric enzyme involved in threonine biosynthesis. Sequence comparison of the yeast enzyme with the corresponding proteins from bacterial sources reveals the presence of several highly conserved regions, the pattern of occurrence of which suggests that the ancestral sequences might have been composed from separate (functional) domains. A block of similar residues, found towards the C-terminus, is also present in many other proteins involved in threonine (or serine) metabolism; this motif may therefore represent the binding site for the hydroxy-amino acids. Limited similarity was detected between a motif conserved among the homoserine kinases and consensus sequences found in other mono- or dinucleotide-binding proteins .; GO: 0004413 homoserine kinase activity, 0005524 ATP binding, 0006566 threonine metabolic process.
Probab=99.23  E-value=8.5e-10  Score=88.88  Aligned_cols=263  Identities=21%  Similarity=0.217  Sum_probs=162.8

Q ss_pred             CCCCCEEEEECCCCEEEEEEEC-CCC-------CCEEEECCEE---CCCCCH---HHHHHHHHHHHHHHHC-CCEEEEEE
Q ss_conf             7898434681278107999971-788-------8579987872---566520---6899999974216761-94399998
Q gi|254781016|r   48 PLNNSLSLSLGHLGTITHITVI-DSD-------ADCIILNGQK---ISSQSS---FFKKTTQFCDLFRQFS-KVYFLIET  112 (355)
Q Consensus        48 P~n~SiS~TL~~~~T~T~v~~~-~~~-------~d~~~lnG~~---~~~~~~---~~~ri~~~l~~~r~~~-~~~~~I~S  112 (355)
                      |=-++|-+.|+...--+-.... ...       +..+...|+.   ++...+   ..+-..++++.+.... -..+++.-
T Consensus        14 pGFD~LG~aL~~~~~~~~~~~~~~e~~~~~nnCk~~~~~~g~~~~~iP~~p~~N~~yq~~~~~~~~~g~~~~~~p~k~~~   93 (359)
T TIGR00191        14 PGFDVLGLALSLYNGLTVTDVVAVESDDTPNNCKFEIEAEGEDVEKIPTEPDDNLIYQVAKRFLDQLGKRNFIKPVKLTL   93 (359)
T ss_pred             CCCCEEECEECCCCCEEEECCCCHHHCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
T ss_conf             44001201003334405504664111058874126888622451258896121056889999999818777888768998


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH----CCCC-----CHHHHCCCCHHCCCCCCC------
Q ss_conf             5023321101232247999999999981889998899988652----1353-----034310562002578987------
Q gi|254781016|r  113 SNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL----GSGS-----ACRSFYRGFCEWICGTDQ------  177 (355)
Q Consensus       113 ~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl----GSGS-----A~RSi~GG~v~W~~g~~~------  177 (355)
                      +|++|.++||+|||++.+|-+.|++++++++++..++-.+|-.    .|||     .+-+++|||..--...+.      
T Consensus        94 ~~~iP~grGLGSSAaaiVaa~~a~ne~~g~~l~~~~~L~~a~~~E~~~SGs~HpDNvaPa~~GG~~~~~~~~~~Pqever  173 (359)
T TIGR00191        94 EKNIPLGRGLGSSAAAIVAALLAANELAGLPLSKEELLDLALELEGRISGSIHPDNVAPALLGGFQLAVKEDDKPQEVER  173 (359)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCEEEEEEECCCCCCHHH
T ss_conf             53851013666389999999999999838898989999999998643057757134678851662798842798761135


Q ss_pred             ---CCCCEEEEECC--------------------CCCC-CCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             ---65441310156--------------------6686-42158999728766752105679887618568999973055
Q gi|254781016|r  178 ---NGMDSFAVPFN--------------------NQWP-DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIST  233 (355)
Q Consensus       178 ---~~sds~a~~~~--------------------~~~~-dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~  233 (355)
                         --..+..+|..                    -.|. ++..++++.+.+   | ||..-+..--. .|-.+=+-..-.
T Consensus       174 rei~~~~~~~~P~~GedtGlvPPlPPtdiGrhvkyqWn~~~~~v~aIP~~~---~-sT~~AR~vLPk-~Y~~~d~v~n~~  248 (359)
T TIGR00191       174 REIVLLEVLKIPIFGEDTGLVPPLPPTDIGRHVKYQWNSKLKVVLAIPNIE---V-STAEARAVLPK-AYPRQDLVFNLS  248 (359)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCEEEECCCCC---C-CHHHHHHHCCC-CCCHHHHHHHHH
T ss_conf             666566641488987666567977852234420020167651799817842---0-56889620555-467889999887


Q ss_pred             HHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCC-EEEEEECCCCEEEEEEC
Q ss_conf             0999999998099-999999999999989998703899568657889999999999742896-19999777981799955
Q gi|254781016|r  234 DLAHIKQAIIDQD-FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSI-PIYFTLDAGPNLKLLFT  311 (355)
Q Consensus       234 ~~~~~~~ai~~~D-f~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~-~v~fT~DAGPNv~il~~  311 (355)
                      ++.-|+.|+-.+| ...|+.++|+|  +||+=.+.+      +=|+-.+|-.-|+.-+..|. ....+ .|||.+..||.
T Consensus       249 ~l~~l~~A~~~~dP~~~l~~~~~kD--~~hqPyR~~------L~P~l~~i~sCv~~~~~~Ga~~~~iS-GsGPTila~~~  319 (359)
T TIGR00191       249 HLAGLVHALYQKDPKPDLLAIMMKD--RIHQPYRES------LIPNLFKIKSCVQAALEKGALGITIS-GSGPTILALAD  319 (359)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHCC--CCCCCCCCC------CCCHHHHHHHHHHHHHHCCCEEEEEC-CCCHHHHHCCC
T ss_conf             7877775610799628999997338--501163422------36148998999999973586488711-20105551688


Q ss_pred             HHH-HHHHHHHHHH
Q ss_conf             898-9999999763
Q gi|254781016|r  312 HKI-EETIKQFFPE  324 (355)
Q Consensus       312 ~~~-~~~i~~~l~~  324 (355)
                      +.. .+.+.+.+-+
T Consensus       320 e~~G~~~~~~~~~~  333 (359)
T TIGR00191       320 EEFGTEQKAQDLLE  333 (359)
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             88775777699987


No 15 
>PRK03817 galactokinase; Provisional
Probab=99.18  E-value=5.5e-07  Score=69.24  Aligned_cols=288  Identities=15%  Similarity=0.103  Sum_probs=149.3

Q ss_pred             EEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCC---------EEEECCEECCCCCHHHHHHHH
Q ss_conf             89748842488116776701175789843468127810799997178885---------799878725665206899999
Q gi|254781016|r   25 SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDAD---------CIILNGQKISSQSSFFKKTTQ   95 (355)
Q Consensus        25 ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d---------~~~lnG~~~~~~~~~~~ri~~   95 (355)
                      +++||--|=|+==+-=+      .--+.|.+.++. ++.  +++.++++.         .+.+|..+..  .....-+..
T Consensus         2 ~v~APGRV~LiGEH~Dy------~gg~vl~~AI~~-~~~--i~~~~~~~~~~~s~~~~~~~~~~~~~~~--~~w~~yv~g   70 (351)
T PRK03817          2 KVKSPGRVNLIGEHTDY------NDGYVLPFAIDR-YTV--LEIEKSDKFIFYSENFNETFELDKLEKT--NSWADYIKG   70 (351)
T ss_pred             EEECCCCEEEECCCEEE------CCCCEEEEEECC-EEE--EEEEECCCEEEEECCCCCCEEECCCCCC--CCHHHHHHH
T ss_conf             69687137986388778------898679588212-499--9999789189998888872340455667--976889999


Q ss_pred             HHHHHHHHC-C-CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC------CCC----CHHH
Q ss_conf             974216761-9-439999850233211012322479999999999818899988999886521------353----0343
Q gi|254781016|r   96 FCDLFRQFS-K-VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLG------SGS----ACRS  163 (355)
Q Consensus        96 ~l~~~r~~~-~-~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlG------SGS----A~RS  163 (355)
                      .+..+++.. . ..+.|.-.-++|.++||.||||--.|++.|+.++++++++..++..+++..      .-+    -+-|
T Consensus        71 vi~~l~~~g~~~~G~~i~i~s~iP~gsGLsSSAAl~va~~~al~~~~~~~l~~~~la~~~~~aE~~~~G~~~G~mDq~as  150 (351)
T PRK03817         71 VIWVLEKEGYEVGPVKGKVSSNLPLGAGLSSSAALEVAVAYALNEYYNLNLSKLELALIARKAENEFVGVPCGIMDQFAV  150 (351)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             99999970999887499997788898887648999999999999984899999999999999999861588508889999


Q ss_pred             HCCC--CHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHH-----------------------
Q ss_conf             1056--200257898765441310156668642158999728766752105679887-----------------------
Q gi|254781016|r  164 FYRG--FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITR-----------------------  218 (355)
Q Consensus       164 i~GG--~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v-----------------------  218 (355)
                      ++|+  .+.|....   ....-.++++.  .++  .+++++...|.-..+......+                       
T Consensus       151 ~~g~~~~~~~~d~~---~~~~~~~~~~~--~~~--~~vv~~s~~~~~l~~~~yn~r~~~~~~a~~~l~~~~~~~~~~~~l  223 (351)
T PRK03817        151 AFGKKDHAIFLDTM---TLEYEYIPFPL--KDY--EILVFDSGVKHELASSEYNERRKECEEALKILGKKSFREVTEEDL  223 (351)
T ss_pred             HHCCCCEEEEECCC---CCCEEEECCCC--CCE--EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHCCHHHH
T ss_conf             85457738982168---88447633688--775--899997797543451067899999999999966000443169999


Q ss_pred             -HHCHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHH-CC
Q ss_conf             -6185689999730---550999999998099999999999999989998703899568657889999999999742-89
Q gi|254781016|r  219 -HHSPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-QS  293 (355)
Q Consensus       219 -~tSp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~-~g  293 (355)
                       +-.+.+..|+..+   ..++.+..+|++++|++.||+++-.+-..|-..+--|       +|+.-.   .|...+. .|
T Consensus       224 ~~l~~~~~~r~~hv~~E~~rv~~~~~al~~~d~~~lG~Lm~~sh~sLr~~~~vS-------~~eld~---lv~~a~~~~G  293 (351)
T PRK03817        224 EKLPPLLRKRAGHVLRENERVLKVRDALKEGDVETLGKLLYESHESLADLYEVS-------CEELDF---IVEFLLGKLG  293 (351)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCC-------CHHHHH---HHHHHHHCCC
T ss_conf             857688999999999888999999999873899999999999889998866489-------778999---9999986089


Q ss_pred             CEEEEEECC--CCEEEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             619999777--98179995589899999997632100368887512000
Q gi|254781016|r  294 IPIYFTLDA--GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK  340 (355)
Q Consensus       294 ~~v~fT~DA--GPNv~il~~~~~~~~i~~~l~~i~~~~~~~~~~~~~~~  340 (355)
                      .--+=-+.|  |=-+..|++++.++.+.+.+.+-..-.-...|+.++.+
T Consensus       294 a~GakltGaG~GGc~vaLv~~~~~e~~~~~v~~~Y~~~~~~~~~~~~~~  342 (351)
T PRK03817        294 IYGARLVGGGFGGSVIVLVKKGAFESIGEELLEEYTKKFGITPEYFKVE  342 (351)
T ss_pred             CEECEEECCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             8675331488755899997546799999999999999639998199998


No 16 
>PRK02534 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=99.18  E-value=1.4e-07  Score=73.41  Aligned_cols=283  Identities=16%  Similarity=0.099  Sum_probs=154.1

Q ss_pred             EEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             78974884248811677670117578984346812781079999717888579987872566520689999997421676
Q gi|254781016|r   24 SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQF  103 (355)
Q Consensus        24 ~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~  103 (355)
                      ..|.|-.|+.|= =.|||+.-+.  .-.|+-..+| ++-+-+++..+..+-.+.-++...+..+.  .-|.+.++.+++.
T Consensus         6 l~apAKINL~L~-V~~kr~dGyH--~l~s~~~~i~-l~D~i~i~~~~~~~i~~~~~~~~~~~~~~--Nlv~ka~~~l~~~   79 (308)
T PRK02534          6 LIAPAKINLHLE-ILGDRPDGFH--ELAMVMQSID-LADRLEFRNNGDGTIKLRCDHPDLSTDDD--NLIYRAAQLLRKR   79 (308)
T ss_pred             EEECEEEECCEE-CCCCCCCCCC--EEEEEEEEEC-CCCEEEEEECCCCCEEEEECCCCCCCCCC--CHHHHHHHHHHHH
T ss_conf             980436810430-1887999985--0478999816-88399999989998899868876888986--4999999999996


Q ss_pred             CCC---EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCC
Q ss_conf             194---39999850233211012322479999999999818899988999886521353034310562002578987654
Q gi|254781016|r  104 SKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM  180 (355)
Q Consensus       104 ~~~---~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~s  180 (355)
                      .+.   .+.|.-+-|+|.+|||+++||-.||+.++++++++++++.+++..+|.....--.-.++||.+. ..|.++.  
T Consensus        80 ~~~~~~gv~I~l~KnIPv~aGLGGGSsdAAa~L~~Ln~l~~~~ls~~~L~~ia~~lGsDVPffl~g~~a~-~~G~Ge~--  156 (308)
T PRK02534         80 FPFAELGVDITLEKNIPIGAGLAGGSSDAAAVLVGLNLLWGLGLTQPELESLAAELGSDVPFCIAGGTQL-CFGRGEI--  156 (308)
T ss_pred             CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCEECCCEEE-EECCCCE--
T ss_conf             3999886589998368866788840689999999999984799998999998751168855022085189-8358867--


Q ss_pred             CEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH--
Q ss_conf             413101566686421589997287667521056798876185689999730550999999998099999999999999--
Q gi|254781016|r  181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA--  258 (355)
Q Consensus       181 ds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~da--  258 (355)
                       ...++   ..+++.+ +++...+..  .||.-+=.....  .+....-..+..+......+...+|....  ...+.  
T Consensus       157 -l~pl~---~~~~~~~-llv~~P~~~--vST~~~y~~~~~--~~~~~~~~~~~~~~~~~~~l~~~~~~~~~--~~~~~~~  225 (308)
T PRK02534        157 -LEPLP---DLDSLGV-VLAKYPSLS--VSTPWAYKTYRQ--QFGDTYLSDEEDFEQRRQALRSGSLLQAI--SAKDPPP  225 (308)
T ss_pred             -EEECC---CCCCCEE-EEEECCCCC--CCCHHHHHHHHH--HCCCCCCCCCHHHHHHHHHCCCCHHHHHH--HHCCHHH
T ss_conf             -67888---7765649-999589998--274999999987--50343357603455555421310688988--7347898


Q ss_pred             --HHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHC-CC-EEEEEECCCCEEEEEEC-HHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             --9899987038995686578899999999997428-96-19999777981799955-8989999999763210036888
Q gi|254781016|r  259 --LKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SI-PIYFTLDAGPNLKLLFT-HKIEETIKQFFPEITIIDPLDS  333 (355)
Q Consensus       259 --l~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~-g~-~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~i~~~~~~~~  333 (355)
                        |.|-...+.-.       |+-.+++   ..++.. |- .+-.| ..||.|+-+|. +++++++.+.|.+   -.+.+|
T Consensus       226 l~NdLe~~a~~~~-------P~i~~~~---~~L~~~~Ga~~~~mS-GSGstvFglf~~~~~A~~a~~~l~~---~~p~~~  291 (308)
T PRK02534        226 LRNDLQKVVLPEY-------PQVAKLL---ELLSSLPGCLGTMMS-GSGPTCFALFEDQEQAEQALEQVRE---AFADPG  291 (308)
T ss_pred             HHHHHHHHHHHCC-------HHHHHHH---HHHHHCCCCCEEEEE-CHHHHHEEEECCHHHHHHHHHHHHH---HCCCCC
T ss_conf             8643699988739-------4999999---999744798888997-2410003797899999999999998---678999


Q ss_pred             CCCCCCC
Q ss_conf             7512000
Q gi|254781016|r  334 PDLWSTK  340 (355)
Q Consensus       334 ~~~~~~~  340 (355)
                      -+.|+.+
T Consensus       292 ~~~~v~~  298 (308)
T PRK02534        292 LDAWVCQ  298 (308)
T ss_pred             CCEEEEC
T ss_conf             8689751


No 17 
>TIGR00549 mevalon_kin mevalonate kinase; InterPro: IPR006205   Mevalonate kinase (2.7.1.36 from EC) is well-characterised among the Eukaryotes, where it plays a role in the synthesis of isopentanyl pyrophosphate, a common intermediate for a number of pathways including cholesterol biosynthesis. It is also involved in mevalonate catabolism. Close homologs are found in the Archaea. A bacterial example is found in the Lyme disease spirochete Borrelia burgdorferi, but is not necessarily the same biosynthetic enzyme.; GO: 0004496 mevalonate kinase activity, 0005524 ATP binding, 0008299 isoprenoid biosynthetic process, 0005737 cytoplasm.
Probab=99.09  E-value=1.9e-08  Score=79.45  Aligned_cols=191  Identities=23%  Similarity=0.168  Sum_probs=135.2

Q ss_pred             HHHHH-HHHHHHHHCCC---EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHC---------CCCCHHHHHHHHHHC-
Q ss_conf             99999-97421676194---39999850233211012322479999999999818---------899988999886521-
Q gi|254781016|r   91 KKTTQ-FCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS---------IPEKSESLSRVARLG-  156 (355)
Q Consensus        91 ~ri~~-~l~~~r~~~~~---~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~---------~~~~~~~lS~lARlG-  156 (355)
                      .-|.. ++.++......   .+.|+-.-..|.++||+||||...|++.|+.+++|         .+++.+++..+|..+ 
T Consensus       112 ~y~~~~~~~~~~~~~~~~~~p~~~~i~S~iP~g~GLGSSAAv~vA~~~al~~~~g~~~n~~s~L~~~~~~~~~~~a~~~E  191 (345)
T TIGR00549       112 SYIAAAALSKLSELNEPPKTPLEIEIESEIPPGRGLGSSAAVAVALIRALADYFGIRSNDLSKLSELSKEELAKLANEAE  191 (345)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999997502675548727998505366555634799999999999987044668621024689889999998877


Q ss_pred             -------CC-CCHHHHCCCCHHCCCCCC-CCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH----HCHH
Q ss_conf             -------35-303431056200257898-7654413101566686421589997287667521056798876----1856
Q gi|254781016|r  157 -------SG-SACRSFYRGFCEWICGTD-QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRH----HSPF  223 (355)
Q Consensus       157 -------SG-SA~RSi~GG~v~W~~g~~-~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~----tSp~  223 (355)
                             || -+.=+.|||++...++.. +..     ....   ++ ...++|.+++.+  .+|.-|-..|.    ..|-
T Consensus       192 ~~~HG~pSG~D~~~~~~g~~~~f~k~~~~~~~-----~~~~---~~-~~~~~i~dtg~~--~~T~~~V~~V~~l~~~~p~  260 (345)
T TIGR00549       192 KIVHGKPSGIDTATSTYGGPVLFEKGEGVEET-----KLIS---LD-ALYLVIADTGVS--GSTKEAVAKVRQLLERFPE  260 (345)
T ss_pred             HHHCCCCCCCCCEEEECCCEEEEECCCCCCEE-----EECC---CC-CCEEEEEECCCC--CCHHHHHHHHHHHHHHCHH
T ss_conf             65179985312212344866898768887314-----4027---89-960899834877--7489999999998751716


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHCC-------HHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCE
Q ss_conf             8999-9730550999999998099-------9999999999999899987038995686578899999999997428961
Q gi|254781016|r  224 FTQW-TQQISTDLAHIKQAIIDQD-------FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP  295 (355)
Q Consensus       224 y~~r-~~~~~~~~~~~~~ai~~~D-------f~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~  295 (355)
                      +-.. ++....-..+..++|.++|       ++.||+++..+=-.|+++=.+.           -++=+.|+..|+.|-.
T Consensus       261 ~~~~~~~~~g~l~~~a~~a~~~~d~~~~~ek~~~lg~lm~~nq~lL~~lGVS~-----------~~ld~l~~~~~~~GAl  329 (345)
T TIGR00549       261 LIDAIMDAIGELTKEAKAALEDGDEVEDSEKVESLGELMNINQGLLKALGVST-----------PKLDQLVELARKAGAL  329 (345)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCH-----------HHHHHHHHHHHHCCCC
T ss_conf             89999999999999999999718831035589999999999998888707985-----------7999999999867974


Q ss_pred             EE-EEECCCC
Q ss_conf             99-9977798
Q gi|254781016|r  296 IY-FTLDAGP  304 (355)
Q Consensus       296 v~-fT~DAGP  304 (355)
                      -+ -| .||-
T Consensus       330 GaKlT-GaG~  338 (345)
T TIGR00549       330 GAKLT-GAGG  338 (345)
T ss_pred             EEEEC-CCCC
T ss_conf             63101-5777


No 18 
>COG1685 Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=98.95  E-value=4.3e-07  Score=69.95  Aligned_cols=223  Identities=16%  Similarity=0.231  Sum_probs=128.6

Q ss_pred             CCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCE--EEEEEECCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             7810799997178885799878725665206899999974216761943--99998502332110123224799999999
Q gi|254781016|r   59 HLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLAL  136 (355)
Q Consensus        59 ~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~--~~I~S~N~fPtaaGLASSASgfAALa~Al  136 (355)
                      ++.++.+|+..+    ....-|.+...    .+.+.+.++.+++..+..  ++++.+..+|.+.||.||++...||+.|+
T Consensus        28 dL~v~a~v~~~~----~~~~~~~~~~d----~~li~~~~~~v~e~~g~~~~~~v~v~SeiP~~~GLkSSSA~~nAlv~A~   99 (278)
T COG1685          28 DLKVEAEVRLSD----EGKVRGEPEGD----TRLIERCVERVREKYGIPLGVEVEVESEIPVGSGLKSSSAASNALVKAV   99 (278)
T ss_pred             CCEEEEEEEECC----CCCCCCCCCCC----HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             445899999857----65313677787----4799999999998729886559998257876667424589999999999


Q ss_pred             HHHHCCCCCHHHHHHHH---HHCCC--------CCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCC
Q ss_conf             99818899988999886---52135--------30343105620025789876544131015666864215899972876
Q gi|254781016|r  137 FRIYSIPEKSESLSRVA---RLGSG--------SACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE  205 (355)
Q Consensus       137 ~~~~~~~~~~~~lS~lA---RlGSG--------SA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~  205 (355)
                      .++.+.+.++-++-+++   -+..|        -||-|.|||+++=..       +-+.+.....-+++.++|++.  +.
T Consensus       100 ~~~~g~~~~~~~i~~l~a~~S~~aGvSvTGA~DDa~AS~~GG~~iTDN-------~~m~Ilrr~~~~~~~vlI~~p--~~  170 (278)
T COG1685         100 LKALGEEIDDFEILRLGARASKEAGVSVTGAFDDACASYLGGIVITDN-------RKMRILRRLDLPELTVLILAP--GE  170 (278)
T ss_pred             HHHCCCCCCHHHHHHHHHHHHHHCCCEEECCCHHHHHHHHCCEEEECC-------HHHEEHHCCCCCCCEEEEEEC--CC
T ss_conf             997189888148888777988745944741406889997588688616-------111000003467740899816--87


Q ss_pred             CCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHH
Q ss_conf             67521056798876185689999730550999999998099999999999999989998703899568657889999999
Q gi|254781016|r  206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER  285 (355)
Q Consensus       206 K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~  285 (355)
                      |.-+...--.++...+|+++.-++.+           ..+||-        .+|.+..+.-.+-  +=|    -.+   .
T Consensus       171 k~~~~~vdv~~~r~~a~~~e~A~~lA-----------~~G~~~--------~Am~lNG~~y~~a--LG~----~~e---~  222 (278)
T COG1685         171 KRLSANVDVNRLRLIAPVVEEAFRLA-----------LKGEYF--------KAMVLNGILYCSA--LGY----DLE---P  222 (278)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHH-----------HCCCHH--------HHHHHHHHHHHHH--HCC----CHH---H
T ss_conf             65255478789877438999999998-----------535288--------8888767998987--089----828---9


Q ss_pred             HHHHHHCC-CEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCCCC
Q ss_conf             99974289-619999777981799955898999999976321003
Q gi|254781016|r  286 VWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIID  329 (355)
Q Consensus       286 v~~~R~~g-~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~~~  329 (355)
                      +.+.-+.| .-+..+ ..||.++-|+.+.  +.+.+...+++.+.
T Consensus       223 ~~~ale~GA~~aglS-GtGPa~~Al~~~~--~~v~ea~~~~G~V~  264 (278)
T COG1685         223 ALKALEAGAAAAGLS-GTGPAYFALTEDP--EEVAEAWSKIGDVI  264 (278)
T ss_pred             HHHHHHCCCCEECCC-CCCCCEEEEECCC--HHHHHHHHHCCEEE
T ss_conf             999986354064357-8897169995493--78999998678699


No 19 
>TIGR01920 Shik_kin_archae shikimate kinase; InterPro: IPR010189   Shikimate kinase (2.7.1.71 from EC) catalyses the fifth step in the shikimate pathway of aromatic amino acids biosynthesis. It converts shikimate to shikimate 3-phosphate (3-phosphoshikimate). This part of the pathway leads to the biosynthesis of chorismate, the precursor of aromatic amino acids, folates, ubiquinones, and other aromatic compounds. The shikimate pathway links metabolism of carbohydrates to biosynthesis of the aromatic amino acids phenylalanine, tyrosine, tryptophan and their derivatives in microorganisms and plants . In a sequence of seven enzymatic reactions, D-erythrose 4-phosphate (E4P), an intermediate of the pentose phosphate pathway and phosphoenol pyruvate (PEP), a glycolytic intermediate, are converted to chorismate. The shikimate pathway is present in bacteria, archaea, fungi and plants. The absence of the shikimate pathway in animals makes it an attractive target for non-toxic herbicides, antimicrobial and antifungal agents.   Shikimate kinase enzymes present an example of convergent evolution via enzyme recruitment from an unrelated group. This group represents shikimate kinases of the archaeal type. Members have no sequence similarity with the typical form of shikimate kinase (PIRSF000702 from PIRSF, IPR000623 from INTERPRO) found in bacteria and eukaryotes, but are instead distantly related to homoserine kinases, which belong to the GHMP kinase domain superfamily (GHMP = galactose, homoserine, mevalonate, and phosphomevalonate) . All known non-archaeal shikimate kinases (the typical form) belong to the non-homologous, structurally unrelated nucleoside monophosphate (NMP) kinase domain superfamily .   Nomenclature note: the name AroK is used for non-homologous shikimate kinases of both the archaeal and bacterial types. ; GO: 0004765 shikimate kinase activity, 0009073 aromatic amino acid family biosynthetic process, 0005737 cytoplasm.
Probab=98.94  E-value=9.8e-07  Score=67.46  Aligned_cols=227  Identities=16%  Similarity=0.195  Sum_probs=143.0

Q ss_pred             CCCEEEEEEECCC--CCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             7810799997178--88579987872566520689999997421676194--3999985023321101232247999999
Q gi|254781016|r   59 HLGTITHITVIDS--DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL  134 (355)
Q Consensus        59 ~~~T~T~v~~~~~--~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~  134 (355)
                      ++.|+.+|...++  .+=....++.+... .   .-|.+.++.+++..+.  .+.++.+-.+|.++||-|||+...||+.
T Consensus        23 dL~v~a~V~~~~d~~~~v~~~~~~~~~~~-~---~~~~~~~~~~~~~~g~~~~~~v~~~seiP~g~GLKSSSA~~nAlv~   98 (273)
T TIGR01920        23 DLKVEAKVRLSDDGEAKVSLKVRGNPELD-P---RLIERILTALIEKFGIVEGLEVEVESEIPLGSGLKSSSALVNALVL   98 (273)
T ss_pred             CCEEEEEEEEECCCCCCEEEEECCCCCCC-H---HHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             86079999970688543147766765479-7---8999999998985388862489996176788664378999999999


Q ss_pred             HHHHHHC--CCCCHHHHHHHHHH---CCC--------CCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCC-CEEEEEE
Q ss_conf             9999818--89998899988652---135--------30343105620025789876544131015666864-2158999
Q gi|254781016|r  135 ALFRIYS--IPEKSESLSRVARL---GSG--------SACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGLLK  200 (355)
Q Consensus       135 Al~~~~~--~~~~~~~lS~lARl---GSG--------SA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~d-l~~~i~i  200 (355)
                      |..++.+  .+.+.-++-++.=.   .-|        -||-|.+||+++=     |+  .-+.+...+..++ +..+|+|
T Consensus        99 A~~~~~gva~~~~~~~~~~l~a~~S~~AG~s~TGAfDDa~AS~~GG~~~T-----DN--~~~~ilk~~~~~~~l~~~vl~  171 (273)
T TIGR01920        99 AVLKAKGVAEEIDDIDILRLGAELSKEAGVSVTGAFDDAAASYLGGIVIT-----DN--RKMKILKRDKLEGNLTAVVLV  171 (273)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHCCCCEEE-----EC--CEEEEEEECCCCCCCEEEEEE
T ss_conf             99986123421773368999999888668515305889999860820052-----14--302465521678986589997


Q ss_pred             ECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHH
Q ss_conf             72876675210567988761856899997305509999999980999999999999999899987038995686578899
Q gi|254781016|r  201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETI  280 (355)
Q Consensus       201 v~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~  280 (355)
                      ....+  ....+. .++.+.+++++.=++.           =.++||-        .||.|-.+....-  +-| -+   
T Consensus       172 P~~~~--~~~~~~-~~~~~~~~~~e~a~~~-----------A~~G~y~--------~Am~lNG~~y~~~--Lgy-p~---  223 (273)
T TIGR01920       172 PKEER--RENVDL-NRLRKISPVVEEAFKL-----------ALKGEYL--------KAMVLNGVAYATA--LGY-PL---  223 (273)
T ss_pred             CCCCC--CCCCCH-HHHHHHHHHHHHHHHH-----------HHCCCCH--------HHHHHHHHHHHHH--HCC-CH---
T ss_conf             68766--767688-8888666899999999-----------6468807--------8999999999988--189-86---


Q ss_pred             HHHHHHHHHHHCC-CEEEEEECCCCEEEEEECHHHHHHHHHHHHHC--CCC
Q ss_conf             9999999974289-61999977798179995589899999997632--100
Q gi|254781016|r  281 QGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI--TII  328 (355)
Q Consensus       281 ~ii~~v~~~R~~g-~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i--~~~  328 (355)
                         +.+.+.-+.| .-+..| ..||.++-++.+.+.+.+.+.+.+.  +.|
T Consensus       224 ---e~~~~al~~GA~~aG~S-G~GPsy~A~~~~pe~~~~~~~~~~~G~G~V  270 (273)
T TIGR01920       224 ---EPASKALEKGAAVAGLS-GKGPSYFALTEEPEEEEVAEALEEFGFGRV  270 (273)
T ss_pred             ---HHHHHHHHCCCEEEEEC-CCCCEEEEEECCCCHHHHHHHHHHCCCEEE
T ss_conf             ---48999973894388630-575568997306864899999974697079


No 20 
>PRK00555 galactokinase; Provisional
Probab=98.88  E-value=1.6e-05  Score=59.02  Aligned_cols=275  Identities=15%  Similarity=0.105  Sum_probs=144.0

Q ss_pred             CCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCE-------------EEECCEECCCCCH
Q ss_conf             637897488424881167767011757898434681278107999971788857-------------9987872566520
Q gi|254781016|r   22 EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC-------------IILNGQKISSQSS   88 (355)
Q Consensus        22 ~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~-------------~~lnG~~~~~~~~   88 (355)
                      ++.|+.||=-|=||==+=-++.-..||.      .++ .+|  .+.+.+.+.+.             +.++..+.+ ...
T Consensus         1 ~~~~~sAPGRVnliGEH~DY~gG~VLp~------AI~-~~~--~v~~~~~~~~~i~~~s~~~~~~~~~~~~~~~~~-~~~   70 (363)
T PRK00555          1 MTVSYAAPGRINLIGEHTDYNLGFALPI------ALP-QRT--VVTFTPEHTGAITARSDRADGSVRIPLDTTPGQ-VTG   70 (363)
T ss_pred             CCEEEECCCCEEEEECCEEECCCEEEEE------EHH-HCE--EEEEEECCCCEEEEEECCCCCCEEEECCCCCCC-CCC
T ss_conf             9269976665897628757899746947------820-128--999998899869999768898679867768776-622


Q ss_pred             HHHHHHHHHHHHHHH----CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC----C--
Q ss_conf             689999997421676----194399998502332110123224799999999998188999889998865213----5--
Q gi|254781016|r   89 FFKKTTQFCDLFRQF----SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS----G--  158 (355)
Q Consensus        89 ~~~ri~~~l~~~r~~----~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS----G--  158 (355)
                      ...-+.-.+..+++.    .++.+.|.|  ++|.++||.||||--.|++.|+..+++.+++..++..+|...-    |  
T Consensus        71 W~~y~~gv~~~l~~~g~~~~g~~~~I~s--~IP~gaGLSSSAAl~va~~~al~~~~~~~~~~~ela~la~~aE~~~~G~~  148 (363)
T PRK00555         71 WAAYAAGVIWALRGAGHPVPGGAMSITS--DVEIGSGLSSSAALECAVLGAVGAATGTRIDRLEQARLAQRAENDYVGAP  148 (363)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCEEEEEC--CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             7899999999999718998885289977--88876674418999999999999970899999999999999997517888


Q ss_pred             ----CCHHHHCCC---CHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHH-------HHH--------
Q ss_conf             ----303431056---2002578987654413101566686421589997287667521056-------798--------
Q gi|254781016|r  159 ----SACRSFYRG---FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREA-------MEI--------  216 (355)
Q Consensus       159 ----SA~RSi~GG---~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~g-------m~~--------  216 (355)
                          --.=|++|.   +..-..    .......++++...  ..+.+++++...++-.....       ++.        
T Consensus       149 ~GiMDQ~as~~g~~g~al~id~----~~l~~~~v~~~~~~--~~~~~vi~dS~~~~~~~~~~y~~R~~ec~~aa~~l~~~  222 (363)
T PRK00555        149 TGLLDQLAALFGAPKTALLIDF----RDLTVRPVAFDPDA--CGVVLLLMDSRARHRHAGGEYAARRASCERAAADLGVS  222 (363)
T ss_pred             CCCHHHHHHHCCCCCEEEEECC----CCCCEECCCCCCCC--CCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCH
T ss_conf             7505478886278883987326----78853214447776--77699997667644345323589999999999985912


Q ss_pred             -------------HHHHCHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHH
Q ss_conf             -------------876185689999730---5509999999980999999999999999899987038995686578899
Q gi|254781016|r  217 -------------TRHHSPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETI  280 (355)
Q Consensus       217 -------------~v~tSp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~  280 (355)
                                   .....+....|...+   .+|+.+...|++++|++.||+++-..-..|--.+--|.       |+--
T Consensus       223 ~lr~~~~~~l~~l~~~~~~~~~~Ra~hv~~E~~RV~~~~~al~~~d~~~~G~Lm~~SH~Slrd~yevS~-------~elD  295 (363)
T PRK00555        223 SLRAVQDRGLAALGAIADPIDARRARHVLTENQRVLDFVAALADSDFTAAGQILTASHASMRDDFAITT-------ERID  295 (363)
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC-------HHHH
T ss_conf             354420768999875058888888888888888999999998739999999999999999998651796-------8799


Q ss_pred             HHHHHHHHHHHCC-CEEEEEECC--CCEEEEEECHHHHHHHHHHHHHC
Q ss_conf             9999999974289-619999777--98179995589899999997632
Q gi|254781016|r  281 QGMERVWDARQQS-IPIYFTLDA--GPNLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       281 ~ii~~v~~~R~~g-~~v~fT~DA--GPNv~il~~~~~~~~i~~~l~~i  325 (355)
                         ..|+..++.| +-+=.| .|  |=-+..|++++.++.+.+.+.+-
T Consensus       296 ---~lv~~a~~~Ga~GARlt-GaGfGGc~vaLv~~~~~~~~~~~v~~~  339 (363)
T PRK00555        296 ---LIADSAVRAGALGARMT-GGGFGGCVIALVPADRARDVADTVRRA  339 (363)
T ss_pred             ---HHHHHHHHCCCCEEEEE-CCCCCEEEEEEECHHHHHHHHHHHHHH
T ss_conf             ---99999997699278897-378874899996687899999999999


No 21 
>PRK05322 galactokinase; Provisional
Probab=98.73  E-value=4.7e-05  Score=55.72  Aligned_cols=302  Identities=14%  Similarity=0.103  Sum_probs=154.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCC-CEEEEEEE-CCC--CCC--EEE
Q ss_conf             488988887403467877637897488424881167767011757898434681278-10799997-178--885--799
Q gi|254781016|r    4 SLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL-GTITHITV-IDS--DAD--CII   77 (355)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~-~T~T~v~~-~~~--~~d--~~~   77 (355)
                      .++++..+|...-+..+.  .-++||--|=||==+=-++.-..||.-=....+.... ..+..+.+ +.+  +.+  +|-
T Consensus         2 ~~~~l~~~F~~~fg~~p~--~~~~APGRVnLiGeHtDY~gg~Vlp~AI~~~~~ia~~~~~d~~i~i~s~~~~~~~~~~~~   79 (387)
T PRK05322          2 NKEELKKKFAEVFGEEED--RVFFSPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKKVRLYSANFEDLGIIEFD   79 (387)
T ss_pred             CHHHHHHHHHHHHCCCCC--EEEECCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEECCCCCCCEEEEE
T ss_conf             889999999998689989--899764763656144305998179588003749999988998799998988877549987


Q ss_pred             ECCEECCCCCHHHHHHHHHHHHHHHH-CC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             87872566520689999997421676-19--4399998502332110123224799999999998188999889998865
Q gi|254781016|r   78 LNGQKISSQSSFFKKTTQFCDLFRQF-SK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVAR  154 (355)
Q Consensus        78 lnG~~~~~~~~~~~ri~~~l~~~r~~-~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lAR  154 (355)
                      ++....+....-..-+.-.+..+++. ..  ..+.+...-++|.++||.||||--.|.+.++..+++++++..++..+|+
T Consensus        80 ~~~~~~~~~~~W~~Yv~Gvi~~l~~~g~~~~~G~d~~I~s~IP~gaGLSSSAAl~va~~~al~~~~~~~l~~~ela~la~  159 (387)
T PRK05322         80 LDDLSYDKEDDWANYPKGVLKYLQEAGYKIDHGFDLYIYGNIPNGAGLSSSASIELLTGVILKDLFNLDLDRLDLVKLGQ  159 (387)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             33258788766677999999999973998778738999578888777530889999999999997389999999999999


Q ss_pred             HCC----CCCH------HHHCCCC--HHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCH----------
Q ss_conf             213----5303------4310562--00257898765441310156668642158999728766752105----------
Q gi|254781016|r  155 LGS----GSAC------RSFYRGF--CEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSRE----------  212 (355)
Q Consensus       155 lGS----GSA~------RSi~GG~--v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~----------  212 (355)
                      ..-    |-.|      -|++|.-  +++.- .  .....-.+|++  +.++  .+++++...|+.-.+.          
T Consensus       160 ~aE~~~~G~~~GiMDQ~as~~g~~~~al~iD-~--~~l~~~~~p~~--~~~~--~~vi~~s~~~~~l~~s~Yn~R~~ec~  232 (387)
T PRK05322        160 KVENEFIGVNSGIMDQFAIGMGKKDHAILLD-T--NTLEYEYVPLD--LGDY--VIVIMNTNKRRELADSKYNERRAECE  232 (387)
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCEEEEEC-C--CCCCEEEECCC--CCCC--EEEEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             9988871698742346777742577488622-7--88843661257--8882--79998579764346321256899999


Q ss_pred             -HHHHHHH---------H-------------CHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -6798876---------1-------------85689999730---55099999999809999999999999998999870
Q gi|254781016|r  213 -AMEITRH---------H-------------SPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI  266 (355)
Q Consensus       213 -gm~~~v~---------t-------------Sp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~  266 (355)
                       +.+...+         -             .+....|+..+   ..+..+..+|++++|++.||+++-.+-..|--.+.
T Consensus       233 ~a~~~l~~~~~i~~l~~~~~~~~~~~~~~l~~~~~~~Ra~Hvv~En~Rv~~a~~aL~~~d~~~~G~Lm~~sH~sLrd~ye  312 (387)
T PRK05322        233 KALKELQKKLDIKSLGELTEEEFDEYSYLIKDETLLKRARHAVTENQRTLKAVKALKAGDLEKFGRLMNASHVSLRDDYE  312 (387)
T ss_pred             HHHHHHHHHCCCHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             99999876249423552999999988754256888999999998779999999998669999999999998999998662


Q ss_pred             CCCCCEEEECHHHHHHHHHHHHHH-HCCC-EEEEEECCC--CEEEEEECHHHHHHHHHHHHHC
Q ss_conf             389956865788999999999974-2896-199997779--8179995589899999997632
Q gi|254781016|r  267 AASPPLLYWQKETIQGMERVWDAR-QQSI-PIYFTLDAG--PNLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       267 ~s~P~~~Y~~~~t~~ii~~v~~~R-~~g~-~v~fT~DAG--PNv~il~~~~~~~~i~~~l~~i  325 (355)
                      -|.       |+-   =.+|...+ ..|. -+=.| .||  =-+..|++++.++.+.+.+.+-
T Consensus       313 vS~-------~el---D~Lv~~a~~~~Ga~GARmt-G~GfGGc~vaLv~~~~~~~~~~~v~~~  364 (387)
T PRK05322        313 VTG-------LEL---DTLVEAAWKQPGVLGARMT-GAGFGGCAIAIVKKDEVEAFKENVGKA  364 (387)
T ss_pred             CCC-------HHH---HHHHHHHHHCCCCEECEEE-CCCCCEEEEEEECHHHHHHHHHHHHHH
T ss_conf             798-------889---9999998763897377362-488822699996277899999999999


No 22 
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional
Probab=98.70  E-value=1.8e-05  Score=58.63  Aligned_cols=228  Identities=14%  Similarity=0.098  Sum_probs=136.2

Q ss_pred             CCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH-----HHHCCCCCHH----HHCCCCHHCCCC
Q ss_conf             1943999985023321101232247999999999981889998899988-----6521353034----310562002578
Q gi|254781016|r  104 SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRV-----ARLGSGSACR----SFYRGFCEWICG  174 (355)
Q Consensus       104 ~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~l-----ARlGSGSA~R----Si~GG~v~W~~g  174 (355)
                      .+-.+.|.+..+.|+++||++|+--.+|+..|+.++.|...+.+++...     -.++.|-+=-    -+|||+=.-...
T Consensus       723 fg~GlEi~t~s~lP~GSGLGTSSILA~avl~Al~~~~g~~~d~~~l~~~vL~lEQlLtTGGGWQDQ~GG~~~GiK~~~s~  802 (974)
T PRK13412        723 FGSGIEITLLAAIPAGSGLGTSSILASTVLGAISDFCGLAWDKNEICNRTLVLEQLLTTGGGWQDQYGGVLPGVKLLQTE  802 (974)
T ss_pred             CCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCEEEEECC
T ss_conf             08965888623788878863889999999999999838998889999999999988615882554016742660466337


Q ss_pred             CCCCCCCEEEEECCCC---CCCCEEEEEEECCCCCCCCCCHHHHHHHHH----CHHHHHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             9876544131015666---864215899972876675210567988761----856899997305509999999980999
Q gi|254781016|r  175 TDQNGMDSFAVPFNNQ---WPDLRIGLLKIIDREKKIGSREAMEITRHH----SPFFTQWTQQISTDLAHIKQAIIDQDF  247 (355)
Q Consensus       175 ~~~~~sds~a~~~~~~---~~dl~~~i~iv~~~~K~vsSt~gm~~~v~t----Sp~y~~r~~~~~~~~~~~~~ai~~~Df  247 (355)
                      ++..-.. .-.++++.   -++|....+++.+++-.. ++.-.+..|..    +|---.=++...+.-.+|.+|+.++||
T Consensus       803 pg~~~~~-~V~~L~~~~~~~~el~~~llLvyTG~tRl-Ak~iL~~VVr~~~~r~~~~l~~l~~l~~~A~~m~~Al~~g~~  880 (974)
T PRK13412        803 AGFQQSP-LVRWLPDSLFTQPEYEDCHLLYYTGITRT-AKGILAEIVSSMFLNSTAHLQLLHEMKAHALDMAEAIQRGEF  880 (974)
T ss_pred             CCCCCCC-EEEEECCCHHHHHHHHHCEEEEECCCCHH-HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             9986662-46760561766898861479999183065-768999999999845788999999999999999999982899


Q ss_pred             HHHHHHHHHHHHHHHHHHH-CCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCC--EEEEEE-CHHHHHHHHHHHH
Q ss_conf             9999999999998999870-38995686578899999999997428961999977798--179995-5898999999976
Q gi|254781016|r  248 IKLGEVAEKNALKMHATMI-AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP--NLKLLF-THKIEETIKQFFP  323 (355)
Q Consensus       248 ~~l~~i~e~dal~mHa~~~-~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGP--Nv~il~-~~~~~~~i~~~l~  323 (355)
                      +.+|++.++- .+.|..|- .+.      ++.--++|+.++.+--+...    ..||-  -+.++. .+..+++|++.|.
T Consensus       881 ~~~g~~l~~~-W~q~k~Ldpg~~------~~~V~~l~~~i~p~~~G~kL----~GAGGGGfl~~~aKdp~~a~~ir~~L~  949 (974)
T PRK13412        881 EEFGRLVGKT-WEQNKALDSGTN------PAAVEAIIETIKDYTLGYKL----PGAGGGGYLYMVAKDPGAAERIRKILT  949 (974)
T ss_pred             HHHHHHHHHH-HHHHHCCCCCCC------CHHHHHHHHHHHHHHHCCCC----CCCCCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             9999999999-998750088999------58999999975223310414----556777679999748778999999997


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             32100368887512000002432023
Q gi|254781016|r  324 EITIIDPLDSPDLWSTKDSLSQKNSI  349 (355)
Q Consensus       324 ~i~~~~~~~~~~~~~~~~~~~~~~~~  349 (355)
                      +.     .+.|+..++...++++-+.
T Consensus       950 ~~-----~p~~~arfve~s~s~~g~~  970 (974)
T PRK13412        950 EQ-----APNPRARFVEMSLSDKGLQ  970 (974)
T ss_pred             HC-----CCCCCCEEEEEEECCCCCE
T ss_conf             37-----9899828999886376753


No 23 
>PRK05905 hypothetical protein; Provisional
Probab=98.69  E-value=1.9e-05  Score=58.46  Aligned_cols=251  Identities=13%  Similarity=0.073  Sum_probs=126.9

Q ss_pred             CEEEECCCCEEEEECCCCCCH-HHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHH
Q ss_conf             378974884248811677670-1175789843468127810799997178885799878725665206899999974216
Q gi|254781016|r   23 KSSAFLPSNIALCKYWGKRDS-KLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFR  101 (355)
Q Consensus        23 ~~ta~ap~NIALIKYWGK~d~-~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r  101 (355)
                      +-.+.|=.|+.| +=.|||.. -  .=.-.|+=....+++-+-+++..+...+.+.+-+.........-.-+.+.+..++
T Consensus         2 k~ks~AKINL~L-~I~~kr~d~G--yH~l~S~f~~i~~l~D~i~i~~~~~~~~~i~~~~~~~~~~~~~~ni~~ka~~~l~   78 (258)
T PRK05905          2 KYKSYAKINLGL-SIYKKCKKVT--KHKLESIFILVENVYDDIEIEKIEKNIDDIHYFDETNEILVYSRLILVKTLEWLR   78 (258)
T ss_pred             CCCCCCCCCCCE-EECCCCCCCC--CEEEEEEEEEECCCCEEEEEEECCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             365355071452-2487788999--6689999999378872999998779987599708876677824699999999998


Q ss_pred             HHCC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH-CCCCCHHHHCCCCHHCCCCCCCC
Q ss_conf             7619--43999985023321101232247999999999981889998899988652-13530343105620025789876
Q gi|254781016|r  102 QFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL-GSGSACRSFYRGFCEWICGTDQN  178 (355)
Q Consensus       102 ~~~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl-GSGSA~RSi~GG~v~W~~g~~~~  178 (355)
                      +..+  ..+.|.-+-++|.+|||+..+|-+||+-.++.+.+++  +..++..+|+. || -..-.++|.=..|..|.++.
T Consensus        79 ~~~~~~~~~~I~l~K~IP~gAGLGGGSSnAAa~L~~L~~~~~l--~~~~l~~ia~~lGs-DVPffl~~~~~a~~~G~GE~  155 (258)
T PRK05905         79 DKYNIKNHFKIKIKKRIPIGSGLGSGSSNAAVLMKWILEFEGI--NEINYKDVVNKLGS-DIPFFLSGYKTAYISDYGSQ  155 (258)
T ss_pred             HHHCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCC--CHHHHHHHHHHHCC-CCCEEECCCCCEEEECCCCE
T ss_conf             8609998669999945876567787527799999999986599--98999999986189-98879816873899878877


Q ss_pred             CCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             54413101566686421589997287667521056798876185689999730550999999998099999999999999
Q gi|254781016|r  179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA  258 (355)
Q Consensus       179 ~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~da  258 (355)
                      -     .++... +.+.++++..  .. . .||.-.=...+.+..      .....+..........    ...   .-.
T Consensus       156 l-----~~l~~~-~~~~~llv~P--~~-~-~ST~~vy~~~~~~~~------~~~~~~~~~~~~~~~~----~~~---~~~  212 (258)
T PRK05905        156 V-----EDLIGQ-FKLTYKVIFM--NV-N-VSTKKVFEKFDDNQH------VIKNNFKTIIKNLKEN----IVV---NIH  212 (258)
T ss_pred             E-----EECCCC-CCCEEEEEEC--CC-C-CCHHHHHHHHCCCCC------CCCCHHHHHHHHHHHH----HHH---CCC
T ss_conf             8-----888778-7752999927--99-9-575999972262444------5631078888766777----763---370


Q ss_pred             HHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHH
Q ss_conf             9899987038995686578899999999997428961999977798179995589
Q gi|254781016|r  259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK  313 (355)
Q Consensus       259 l~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~  313 (355)
                      |.|-.....-.       |+-.+   ...++++.|..+..| .-|+.|+.+|..+
T Consensus       213 Ndle~~~~~~~-------P~i~~---~~~~l~~~~~~~~MS-GSGSt~F~i~~~~  256 (258)
T PRK05905        213 NDLQEPCFELY-------PNLLY---KYNELLNDGFYTILS-GAGSSFIVIKKIN  256 (258)
T ss_pred             CCHHHHHHHHC-------HHHHH---HHHHHHCCCCCEEEE-CCCCCEEEEEECC
T ss_conf             17399999879-------79999---999986799838997-6371489999636


No 24 
>COG1907 Predicted archaeal sugar kinases [General function prediction only]
Probab=98.67  E-value=3.9e-05  Score=56.28  Aligned_cols=248  Identities=17%  Similarity=0.189  Sum_probs=152.8

Q ss_pred             CCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHH
Q ss_conf             98434681278107999971788857998787256652068999999742167619439999850233211012322479
Q gi|254781016|r   50 NNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGF  129 (355)
Q Consensus        50 n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~~~I~S~N~fPtaaGLASSASgf  129 (355)
                      -.++-++|+.-+-+-+++.  +  |.+-.+|...      .+|+.+.++..-+.. ..++|+-...||.-.||+|---..
T Consensus        25 ~GgvG~aLe~P~l~i~~~~--s--~~~~~~ge~~------~~~~~~~a~~~le~~-~gv~I~I~~~~P~HvGLGS~TQla   93 (312)
T COG1907          25 DGGVGLALEEPRLEIEAKP--S--DDIEVDGEDR------RERVEKAARLVLEVG-EGVKIEIRSDIPAHVGLGSTTQLA   93 (312)
T ss_pred             ECCEEEEEECCCEEEEEEC--C--CCCCCCCHHH------HHHHHHHHHHHHCCC-CCEEEEEEECCCHHCCCCHHHHHH
T ss_conf             0440488507815999720--5--5411255066------899999999751416-752999975273220777377999


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHH---HHCCCCHHCCCCCCCC---CCCEEEEECCCCCC-CCEEEEEEEC
Q ss_conf             999999999818899988999886521353034---3105620025789876---54413101566686-4215899972
Q gi|254781016|r  130 AALTLALFRIYSIPEKSESLSRVARLGSGSACR---SFYRGFCEWICGTDQN---GMDSFAVPFNNQWP-DLRIGLLKII  202 (355)
Q Consensus       130 AALa~Al~~~~~~~~~~~~lS~lARlGSGSA~R---Si~GG~v~W~~g~~~~---~sds~a~~~~~~~~-dl~~~i~iv~  202 (355)
                      -|++.++.++++++++.+++....++|--||-=   =-+|||+.=+ |....   +.-+ ++-+..++| |-+.+++|. 
T Consensus        94 La~a~ai~~i~gl~~~~~elA~~vgRG~tSgiGv~afe~GGFIVDG-Gh~~~f~ps~~s-P~I~R~dfPedW~~VlaIP-  170 (312)
T COG1907          94 LAVASAILEIYGLELSIRELAFAVGRGGTSGIGVYAFEYGGFIVDG-GHSFGFLPSSAS-PLIFRLDFPEDWRFVLAIP-  170 (312)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCEEEEEEEECCEEEEC-CCCCCCCCCCCC-CEEEEECCCCCEEEEEEEC-
T ss_conf             9999999998658999899999973677564137998878899878-744676668999-6055322888659999944-


Q ss_pred             CCCCCCCCCHHHHHHHHHCHHHHHHHHHH-HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH--HCCCCCEEEECHHH
Q ss_conf             87667521056798876185689999730-5509999999980999999999999999899987--03899568657889
Q gi|254781016|r  203 DREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM--IAASPPLLYWQKET  279 (355)
Q Consensus       203 ~~~K~vsSt~gm~~~v~tSp~y~~r~~~~-~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~--~~s~P~~~Y~~~~t  279 (355)
                      ..++-+.-+..-....+..|.-...+... ..-+-.|.-|+-++|++.|++-.-    +++.+.  .-...--.|+.+.-
T Consensus       171 ~~~rg~~~~~E~~if~~~~p~p~~~~~~ls~~vLm~mmPavvE~Die~fg~~l~----~iQ~l~g~~f~~~e~~~~~~~V  246 (312)
T COG1907         171 EVERGVSGRREVDIFKKYCPVPLEEVGELSHRVLMKMMPAVVERDIESFGEALN----EIQELGGKWFKKVEGGLQREDV  246 (312)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHH----HHHHHHHHHHHHHHCEECCHHH
T ss_conf             788432102788899756899979998999999998758988637999999999----9998876646564131022899


Q ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHHHHHHHH
Q ss_conf             9999999997428961999977798179995589899999
Q gi|254781016|r  280 IQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK  319 (355)
Q Consensus       280 ~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~~~~~i~  319 (355)
                      .++|   ..+++....++-+ -=||.|+=|+.+.....+.
T Consensus       247 ~~iv---~~m~~~a~~agqS-SwGPtvY~i~d~~~~~~~~  282 (312)
T COG1907         247 KEIV---DEMVEAAYGAGQS-SWGPTVYGIVDSREAGSVV  282 (312)
T ss_pred             HHHH---HHHHHHCCCCCCC-CCCCEEEEECCCCCCCHHH
T ss_conf             9999---9998723044325-6688789861653212479


No 25 
>PRK03009 consensus
Probab=98.64  E-value=1.1e-05  Score=60.16  Aligned_cols=254  Identities=16%  Similarity=0.150  Sum_probs=130.3

Q ss_pred             CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCC--E
Q ss_conf             84248811677670117578984346812781079999717888579987872566520689999997421676194--3
Q gi|254781016|r   30 SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--Y  107 (355)
Q Consensus        30 ~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~--~  107 (355)
                      .|..| +=-|||+.-  .-.-.|+=..+ +++-+-+++..++....+.-+....+.+.   .-|.+..+.+++..+.  .
T Consensus        11 INL~L-~V~~kr~DG--yH~l~Sl~~~i-~l~D~i~i~~~~~~~~~~~~~~~~i~~~~---Nlv~kA~~~l~~~~~~~~~   83 (287)
T PRK03009         11 LNLFL-HVTGRRPDG--YHLLQTVFQLL-DWGDTLHFTLRDDGKVARVTDVPGVPEES---DLVVRAARLLQAHTGTRLG   83 (287)
T ss_pred             EECCC-CCCCCCCCC--CCEEEEEEEEC-CCCCEEEEEECCCCCEEECCCCCCCCCCC---CHHHHHHHHHHHHHCCCCC
T ss_conf             70250-248868999--87067899980-67869999988899479625777898866---5999999999985399885


Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEEEEC
Q ss_conf             99998502332110123224799999999998188999889998865213530343105620025789876544131015
Q gi|254781016|r  108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF  187 (355)
Q Consensus       108 ~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a~~~  187 (355)
                      +.|.-+-|+|.+|||+..+|-.||.-.+++++++++++.+++..+|+..----.-.++||- .|..|.++.-.   .+..
T Consensus        84 ~~I~l~KnIPv~AGLGGGSSdAAa~L~~Ln~l~~l~ls~~~l~~ia~~lGADVPffl~~~~-a~~~G~Ge~l~---~l~~  159 (287)
T PRK03009         84 VDIEIDKRLPMGGGLGGGSSDAATTLLALNRLWGLDLPRAELQSLALKLGADVPFFVFGKN-AFAEGIGEALT---AVEL  159 (287)
T ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCEECCCC-EEEECCCCCCE---ECCC
T ss_conf             4999980687656778775379999999999707999999999998763998230322776-79985884640---7478


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             66686421589997287667521056798876185689999730550999999998099999999999999989998703
Q gi|254781016|r  188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA  267 (355)
Q Consensus       188 ~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~  267 (355)
                          ++..  +++|..  +...||.-+=....     ..+ ......+.+.. +....|........   .|.|-.....
T Consensus       160 ----~~~~--~llv~P--~~~iST~~vy~~~~-----~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~---~NdLe~~a~~  221 (287)
T PRK03009        160 ----PPRW--FLVVTP--RVHVPTAEIFSDES-----LTR-DTKPITIADFL-AQQTSDAGWPDSFG---RNDLQPVVTS  221 (287)
T ss_pred             ----CCCE--EEEECC--CCCCCHHHHHHCCH-----HCC-CCCCCCHHHHH-HHHCCCHHHHHHHC---CCCCHHHHHH
T ss_conf             ----9747--999859--99846799974502-----025-67766687887-52332455678754---7875899987


Q ss_pred             CCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHH
Q ss_conf             89956865788999999999974289619999777981799955-8989999999763
Q gi|254781016|r  268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPE  324 (355)
Q Consensus       268 s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~  324 (355)
                      -       .|+-.++++.   ++..+ .+-.| .-||.|+-||. +++++++.+.|+.
T Consensus       222 ~-------~PeI~~i~~~---l~~~~-~a~MS-GSGSt~Fglf~~~~~A~~a~~~l~~  267 (287)
T PRK03009        222 K-------YAEVARAVEW---LYNLT-PARMT-GSGACVFAAFKSKAEAEAAQAKLPA  267 (287)
T ss_pred             H-------CHHHHHHHHH---HHCCC-CEEEE-CCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             4-------8899999999---86789-71877-7150288998999999999986887


No 26 
>COG2605 Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only]
Probab=98.61  E-value=6.6e-05  Score=54.70  Aligned_cols=220  Identities=15%  Similarity=0.108  Sum_probs=144.3

Q ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHC--------CC--CCHHHHCCCCHHCCCCCC
Q ss_conf             39999850233211012322479999999999818899988999886521--------35--303431056200257898
Q gi|254781016|r  107 YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLG--------SG--SACRSFYRGFCEWICGTD  176 (355)
Q Consensus       107 ~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlG--------SG--SA~RSi~GG~v~W~~g~~  176 (355)
                      .+.|.+.-..|..+||+||++...||..|+...-+..++..+|.++|-..        -|  ----..||||-...-+. 
T Consensus        89 ~~el~~~~D~P~GSGLGSSSa~vvaLl~a~~~~kg~~~~~~~LA~eAy~IER~~l~~~gG~QDqYaaA~GGFnfMEf~~-  167 (333)
T COG2605          89 PIELHTQSDAPPGSGLGSSSAFVVALLNALHAWKGESLGPYELAREAYEIEREDLKIVGGKQDQYAAAFGGFNFMEFRG-  167 (333)
T ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCEEEEECC-
T ss_conf             4699984378999987734799999999999985787898999999999889985454666237899847921799748-


Q ss_pred             CCCC-CEEEEECCCC-CCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHH----HHHHHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             7654-4131015666-8642158999728766752105679887618568----99997305509999999980999999
Q gi|254781016|r  177 QNGM-DSFAVPFNNQ-WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF----TQWTQQISTDLAHIKQAIIDQDFIKL  250 (355)
Q Consensus       177 ~~~s-ds~a~~~~~~-~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y----~~r~~~~~~~~~~~~~ai~~~Df~~l  250 (355)
                       ++. ..-++.+..+ -.+|+.-++++-++.+..||-.-+++..+ .---    .+-..+..+...+|.+++-..|+..|
T Consensus       168 -~~~V~v~pL~i~~e~~~Ele~~~lL~yTGi~R~Ss~V~~dQ~~~-~~~~~~~~~e~~~~mk~~A~~~~~al~~nd~~~f  245 (333)
T COG2605         168 -NGEVVVNPLRINRERTAELEARLLLYYTGITRQSSEVIEDQVRN-VVDGDEETLEALHEMKALAYEMKDALVRNDIPEF  245 (333)
T ss_pred             -CCCEEEEECCCCHHHHHHHHHCEEEEEECCCCCHHHHHHHHHHH-HHCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             -98389800334466899987406998816402255889999987-6315188999999999999999999986335779


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHH-HHCCCEEEEEECCCCE--EEEEECHHHHHHHHHHHHHCCC
Q ss_conf             999999999899987038995686578899999999997-4289619999777981--7999558989999999763210
Q gi|254781016|r  251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-RQQSIPIYFTLDAGPN--LKLLFTHKIEETIKQFFPEITI  327 (355)
Q Consensus       251 ~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~-R~~g~~v~fT~DAGPN--v~il~~~~~~~~i~~~l~~i~~  327 (355)
                      +++.-.... +--. +++        --|-..|+.++++ ++.|--..=++.||..  +.++|++.....+.+.|...+.
T Consensus       246 ~~~l~~gW~-~KK~-ls~--------~ISN~~IDriy~~A~~~GA~~gKl~GaG~gGFllf~~~p~k~~~l~r~l~~~~~  315 (333)
T COG2605         246 GQILDRGWE-AKKK-LSS--------RISNDAIDRIYELALKNGAYGGKLSGAGGGGFLLFFCDPSKRNELARALEKEQG  315 (333)
T ss_pred             HHHHHHHHH-HHHH-HCC--------CCCCHHHHHHHHHHHHCCCHHCEEECCCCCCEEEEEECCCCHHHHHHHHHHHCC
T ss_conf             999976777-6455-335--------767477899999998667322223026886279999685424899999998449


Q ss_pred             C-----CCCCCCCCCCC
Q ss_conf             0-----36888751200
Q gi|254781016|r  328 I-----DPLDSPDLWST  339 (355)
Q Consensus       328 ~-----~~~~~~~~~~~  339 (355)
                      .     +...|..+|..
T Consensus       316 ~~~~~~Fd~~Gsr~i~i  332 (333)
T COG2605         316 FVVDTSFDKEGSRIIFI  332 (333)
T ss_pred             CEEEEEECCCCEEEEEC
T ss_conf             73787764787079822


No 27 
>COG0153 GalK Galactokinase [Carbohydrate transport and metabolism]
Probab=98.61  E-value=0.00011  Score=53.27  Aligned_cols=281  Identities=19%  Similarity=0.222  Sum_probs=154.2

Q ss_pred             CCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEE-ECCEECCC-----CCHHHHHH
Q ss_conf             7763789748842488116776701175789843468127810799997178885799-87872566-----52068999
Q gi|254781016|r   20 INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII-LNGQKISS-----QSSFFKKT   93 (355)
Q Consensus        20 ~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~-lnG~~~~~-----~~~~~~ri   93 (355)
                      .....+++||--+-||-=+=-++.-..+|..      + +..|...++..++...+++ .|......     ..-...++
T Consensus        20 ~~~~~~~~aPGRvNLIGEHtDYn~G~VlP~A------i-n~~t~v~v~~r~d~~v~l~s~n~~~~~~~~~~~~d~~~~~~   92 (390)
T COG0153          20 VEPTVTAFAPGRVNLIGEHTDYNGGFVLPCA------I-NYGTYVAVAKRDDGKVRLYSANFGNAGDIFFLLLDIAKEKI   92 (390)
T ss_pred             CCCCEEECCCCEEEEECCCEECCCCEEEEEE------E-ECCEEEEEEECCCCEEEEEECCCCCCCCEEECCHHHCCCCC
T ss_conf             3764576178558860122212686678889------6-05428999973685599996787633424304433144531


Q ss_pred             HHHHHHHHH------HCCC---EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC----CCC
Q ss_conf             999742167------6194---399998502332110123224799999999998188999889998865213----530
Q gi|254781016|r   94 TQFCDLFRQ------FSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS----GSA  160 (355)
Q Consensus        94 ~~~l~~~r~------~~~~---~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS----GSA  160 (355)
                      ..+.++++.      ..+.   .+.|.-.-|+|++|||+||||=-.|+++++.++++++++..++..++..--    |=-
T Consensus        93 ~~W~nYvkgvi~~l~~~g~~~~G~~i~i~gnIP~GaGLSSSAAleva~~~al~~l~~~~~~k~~la~i~q~AEn~fvGvn  172 (390)
T COG0153          93 DDWANYVKGVIKALQKRGYAFTGLDIVISGNIPIGAGLSSSAALEVAVALALQRLFNLPLDKAELAKIAQVAENQFVGVN  172 (390)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             10332478999999865877677059996678888886726899999999999973899988899999999875134776


Q ss_pred             ------HHHHCC---CCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHH----H------HHH-
Q ss_conf             ------343105---62002578987654413101566686421589997287667521056798----8------761-
Q gi|254781016|r  161 ------CRSFYR---GFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEI----T------RHH-  220 (355)
Q Consensus       161 ------~RSi~G---G~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~----~------v~t-  220 (355)
                            +-|.+|   -...-..    ......++|    +|-..+.++|++...|.-....-...    +      ... 
T Consensus       173 ~G~mDQ~~s~~G~~~~al~ld~----~~l~~~~~~----~p~~~~~ivI~ns~vkr~la~seYn~Rr~ece~A~~~l~~~  244 (390)
T COG0153         173 CGIMDQLASAFGKKDHALLLDC----RTLEYEPVP----FPVGGVSIVIVNSNVKRELADSEYNERRAECEEAAEFLGVS  244 (390)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEC----CCCCEEEEC----CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7508899998687784899973----666268730----47664599996379766542347899999999999999875


Q ss_pred             ---------------------CHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             ---------------------85689999730---550999999998099999999999999989998703899568657
Q gi|254781016|r  221 ---------------------SPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ  276 (355)
Q Consensus       221 ---------------------Sp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~  276 (355)
                                           .|-...|+..+   ..|..+..+|++++||.+||+++..+-.+|--.+--|.|      
T Consensus       245 ~~~L~d~~~~~~~~~~~~i~~~~~~~rRa~hvv~En~Rvl~a~~Al~~~dl~~fG~Lm~~SH~slrddyevt~p------  318 (390)
T COG0153         245 IKSLRDVTDEEFAALQAEIEVDPKIARRARHVVTENQRVLEAAKALRSGDLTEFGELMNESHESLRDDYEVTCP------  318 (390)
T ss_pred             HHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCH------
T ss_conf             50354337999996452414466888999999867778999999987188999999999989988743566566------


Q ss_pred             HHHHHHHHHHHHHHHCCC-EEEEEECCCC--EEEEEECHHHHHHHHHHHHHC
Q ss_conf             889999999999742896-1999977798--179995589899999997632
Q gi|254781016|r  277 KETIQGMERVWDARQQSI-PIYFTLDAGP--NLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       277 ~~t~~ii~~v~~~R~~g~-~v~fT~DAGP--Nv~il~~~~~~~~i~~~l~~i  325 (355)
                       +.=.+.+..+..  .|. .+=-| .||=  -+.-|.++++.+.+++.+.+-
T Consensus       319 -ElD~lve~a~~~--~G~~GaRmT-GaGfGGc~IaLv~~~~v~~~~e~v~~~  366 (390)
T COG0153         319 -ELDTLVEIALAA--GGAYGARMT-GAGFGGCVIALVPNDDVEAVAEAVAEE  366 (390)
T ss_pred             -HHHHHHHHHHHC--CCCCCCEEC-CCCCCCEEEEEECHHHHHHHHHHHHHH
T ss_conf             -289999999872--786501203-788785599993220279999999876


No 28 
>PRK04943 consensus
Probab=98.59  E-value=2.3e-05  Score=57.84  Aligned_cols=253  Identities=13%  Similarity=0.052  Sum_probs=138.2

Q ss_pred             CCEEEECCCCEEEE-ECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCE--ECCCCCHHHHHHHHHHH
Q ss_conf             63789748842488-1167767011757898434681278107999971788857998787--25665206899999974
Q gi|254781016|r   22 EKSSAFLPSNIALC-KYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ--KISSQSSFFKKTTQFCD   98 (355)
Q Consensus        22 ~~~ta~ap~NIALI-KYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~--~~~~~~~~~~ri~~~l~   98 (355)
                      ......||.-|=|- +=-|||+.-  .=--.|+=..+ +++-+-+++  +.+.+.+.+.+.  ..+.+.   .-|.+.++
T Consensus         4 ~~~~~~aPAKINL~L~V~~kr~DG--YH~i~S~~~~i-dl~D~l~i~--~~~~~~i~~~~~~~~i~~~~---Nli~kA~~   75 (288)
T PRK04943          4 GTTRWPSPAKLNLFLYINGRTENG--YHELQTLFQFL-DHGDELTIT--ANNSGNITLSPAIEGVPLED---NLIWKAAT   75 (288)
T ss_pred             CCEEEECCEEEECCCCCCCCCCCC--CCEEEEEEEEE-CCCEEEEEE--ECCCCCEEEECCCCCCCCCC---CHHHHHHH
T ss_conf             874871311682340238879999--87157899981-675099999--98999889817867898767---49999999


Q ss_pred             HHHHHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCC
Q ss_conf             21676194--3999985023321101232247999999999981889998899988652135303431056200257898
Q gi|254781016|r   99 LFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD  176 (355)
Q Consensus        99 ~~r~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~  176 (355)
                      .+++..+.  .+.|.-+-|+|.+|||+.-+|-.||+..+++++++++++.+++..+|+...---.-.++|+-+ |..|.+
T Consensus        76 ~l~~~~~~~~~~~I~l~KnIPv~AGLGGGSSnAAa~L~~Ln~l~~l~ls~~~l~~ia~~lGADVPffl~~~~a-~~~G~G  154 (288)
T PRK04943         76 ALQNAAQCSLGAHIELHKILPMGGGIGGGSSNAATTLVALNYLWQTGLSDDELAEIGLALGADVPVFVRGFAA-FAEGVG  154 (288)
T ss_pred             HHHHHHCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEECCCCE-EEECCC
T ss_conf             9999769998808999971787578887620699999999998479999899999887439985768617768-998688


Q ss_pred             CCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             76544131015666864215899972876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  177 QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       177 ~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      +.-.   .+..    ++..  +++|..  +...||..+=..      ++..-.....++..+......+||+...     
T Consensus       155 E~l~---~~~~----~~~~--~lLv~P--~~~iST~~vf~~------~~~~~~~~~~~~~~~~~~~~~NDLE~~~-----  212 (288)
T PRK04943        155 EKLS---PATP----EEKW--YLVVRP--NVSIATVDIFTH------PDLTRNTPKRDLETLLNTPYVNDCEKIV-----  212 (288)
T ss_pred             CEEE---ECCC----CCCE--EEEECC--CCCCCCHHHHCC------CHHCCCCCCCCHHHHHHCHHCCCCHHHH-----
T ss_conf             5742---6677----7767--999879--999727788059------3001376521799987360047857999-----


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHHCC
Q ss_conf             9998999870389956865788999999999974289619999777981799955-898999999976321
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPEIT  326 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~i~  326 (355)
                               ..-       .|+-.++++.   +.+.+ .+-.| .-||.|+-+|. +++++++.+.|++--
T Consensus       213 ---------~~~-------~PeI~~~~~~---l~~~~-~~~MS-GSGstvFglf~s~~~A~~~~~~l~~~~  262 (288)
T PRK04943        213 ---------RML-------YPEVDKQLSW---LLQYA-PSRLT-GTGSCVFAEFSSRSEAEAILAQLSDNV  262 (288)
T ss_pred             ---------HHH-------CHHHHHHHHH---HHCCC-CCEEE-CHHHEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             ---------986-------8899999999---85659-87132-640558899899999999998689767


No 29 
>PRK00343 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=98.49  E-value=1.3e-05  Score=59.65  Aligned_cols=248  Identities=18%  Similarity=0.163  Sum_probs=134.1

Q ss_pred             EEECCC--CEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEEC--CCCCHHHHHHHHHHHHH
Q ss_conf             897488--42488116776701175789843468127810799997178885799878725--66520689999997421
Q gi|254781016|r   25 SAFLPS--NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI--SSQSSFFKKTTQFCDLF  100 (355)
Q Consensus        25 ta~ap~--NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~--~~~~~~~~ri~~~l~~~  100 (355)
                      |+.||.  |+.| +--|||+.-  .-.-.|+=... +++-+-+++.  .++..+.+.|...  +.++   .-|.+.++.+
T Consensus         4 ~~~aPAKINL~L-~V~~kr~DG--yH~i~Sl~~~i-dl~D~i~i~~--~~~~~i~~~~~~~~i~~~~---Nlv~ka~~~l   74 (279)
T PRK00343          4 DWPAPAKLNLFL-HITGRRADG--YHELQTLFQFL-DYGDTLHFEP--RDDGQIRLLTEIPGVPEED---NLIVRAARLL   74 (279)
T ss_pred             CCCCCEEEEECC-CCCCCCCCC--CCEEEEEEEEC-CCCCEEEEEE--CCCCCEEEECCCCCCCCCC---CHHHHHHHHH
T ss_conf             636500273032-238708999--86257899982-7883999999--8899689946877798647---5999999999


Q ss_pred             HHHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCC
Q ss_conf             676194--399998502332110123224799999999998188999889998865213530343105620025789876
Q gi|254781016|r  101 RQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN  178 (355)
Q Consensus       101 r~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~  178 (355)
                      ++..+.  .+.|.-+-|.|++|||+..+|-.||+-.+++++++++++.+++..+|+.. ||=.+-+..|-..|..|.++.
T Consensus        75 ~~~~~~~~~~~I~l~KnIPv~AGLGGGSSnAAa~L~~Ln~l~~l~ls~~~l~~ia~~l-GaDVPffl~~~~a~~~G~Ge~  153 (279)
T PRK00343         75 QKATGTPLGADISLDKRLPMGGGLGGGSSDAATTLVALNRLWQLGLSRDELAALGLKL-GADVPVFVRGHAAFAEGVGEK  153 (279)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHC-CCCEEEEECCCCEEEEECCCE
T ss_conf             9986999974999996587635678887128999999999746678999999998751-897777860876899806868


Q ss_pred             CCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             54413101566686421589997287667521056798876185689999730550999999998099999999999999
Q gi|254781016|r  179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA  258 (355)
Q Consensus       179 ~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~da  258 (355)
                      -   ..+..    ++..  +++|...  -..||.-+=.    .+.. .| ......+..+......+||           
T Consensus       154 l---~~~~~----~~~~--~llv~P~--~~vST~~vf~----~~~l-~~-~~~~~~~~~~~~~~~~NDL-----------  205 (279)
T PRK00343        154 L---TPVEL----PEKW--YLVVKPG--VHVSTAEIFS----DPEL-TR-DTPKRTIADFLAGPGRNDC-----------  205 (279)
T ss_pred             E---EECCC----CCCE--EEEECCC--CCCCHHHHHH----CCCC-CC-CCCCCCHHHHHHCHHCCCH-----------
T ss_conf             7---77567----8747--9998799--9956199983----8245-54-7730069999843121858-----------


Q ss_pred             HHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHHC
Q ss_conf             98999870389956865788999999999974289619999777981799955-89899999997632
Q gi|254781016|r  259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPEI  325 (355)
Q Consensus       259 l~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~i  325 (355)
                         ......-.       |+=-+++   ..+.+.| .+.-| .-||.|+-+|. +++++.+.+.|++-
T Consensus       206 ---e~~a~~~~-------PeI~~~~---~~L~~~~-~~~MS-GSGSt~Fglf~~~~~A~~a~~~l~~~  258 (279)
T PRK00343        206 ---EPVVRKRY-------PEVAQAL---SWLLEYA-PARMT-GTGACVFAEFDTEAEAEAVLAQLPEG  258 (279)
T ss_pred             ---HHHHHHHC-------HHHHHHH---HHHHHCC-CCEEE-CCCCEEEEEECCHHHHHHHHHHCCCC
T ss_conf             ---99998869-------8999999---9986028-87465-42225889979999999999864744


No 30 
>PRK00650 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=98.46  E-value=3.5e-05  Score=56.60  Aligned_cols=235  Identities=15%  Similarity=0.148  Sum_probs=127.6

Q ss_pred             CCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECC-EECCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             48842488116776701175789843468127810799997178885799878-72566520689999997421676194
Q gi|254781016|r   28 LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG-QKISSQSSFFKKTTQFCDLFRQFSKV  106 (355)
Q Consensus        28 ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG-~~~~~~~~~~~ri~~~l~~~r~~~~~  106 (355)
                      |-.|+.| +=-|||+.-  .-.-.|+=..+| ++-+-+++  ...++.+.+.+ ...+..+   .-|.+.++.+++..+.
T Consensus         7 AKINL~L-~V~~kr~DG--YH~l~Sl~~~id-l~D~i~i~--~~~~~~~~~~~~~~~~~~~---Nli~kA~~~l~~~~~~   77 (288)
T PRK00650          7 AKLNLFL-QLLGKREDG--FHEIVTRYQAID-FGDQLSLS--ISSRDSLQVINLCELETPQ---NSIWKSVALFRDYTGI   77 (288)
T ss_pred             EEEECCC-CCCCCCCCC--CCEEEEEEEEEC-CCCEEEEE--ECCCCCEEEECCCCCCCCH---HHHHHHHHHHHHHHCC
T ss_conf             1073250-458879999--881579999967-89899999--8899968983898789945---6999999999997499


Q ss_pred             --EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEE
Q ss_conf             --399998502332110123224799999999998188999889998865213530343105620025789876544131
Q gi|254781016|r  107 --YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA  184 (355)
Q Consensus       107 --~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a  184 (355)
                        .+.|+-+-|+|.+|||+..+|-.||...+++++++++++.+++..+|+...--..-.++||.+. ..|.++.   -  
T Consensus        78 ~~~~~I~l~KnIPvgAGLGGGSSnAAavL~~Ln~l~~l~l~~~~L~~ia~~lGADVPffl~~~~a~-~~G~GE~---i--  151 (288)
T PRK00650         78 TTPVSWRVVKQIPIGAGLAGGSSNAATALFALNQHFQTGLSDEELRSLAEKIGMDTPFFFSSGSAL-GVGRGEK---I--  151 (288)
T ss_pred             CCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCEEECCCCEE-EEECCCE---E--
T ss_conf             987379999579765567610378999999999985589899999999987299814075387589-9937967---7--


Q ss_pred             EECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             01566686421589997287667521056798876185689999730550999999998099999999999999989998
Q gi|254781016|r  185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT  264 (355)
Q Consensus       185 ~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~  264 (355)
                      .++... +++..+++.  .. ..++..+. =..++-+.+ .     ..++   +..  .++||              -..
T Consensus       152 ~~l~~~-~~~~~vLv~--p~-~~vsT~~v-f~~~~~~~~-~-----~~~~---l~~--~~NDL--------------E~~  201 (288)
T PRK00650        152 LALEES-VSDRYVLYF--SD-QGVLTSDA-FAYVQPSDC-S-----SRKN---LEY--TQNDL--------------EKP  201 (288)
T ss_pred             EECCCC-CCCEEEEEC--CC-CCCCCHHH-HHHCCCCCC-C-----HHHH---HHH--CCCCC--------------HHH
T ss_conf             788767-765199991--99-89776698-750491006-6-----3666---654--58978--------------899


Q ss_pred             HHCCCCCEEEECHHHHHHHHHHHHHHHCCC-EEEEEECCCCEEEEEECHHHH
Q ss_conf             703899568657889999999999742896-199997779817999558989
Q gi|254781016|r  265 MIAASPPLLYWQKETIQGMERVWDARQQSI-PIYFTLDAGPNLKLLFTHKIE  315 (355)
Q Consensus       265 ~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~-~v~fT~DAGPNv~il~~~~~~  315 (355)
                      .+.-       .|+--++.+++.++.+.+. .+--| ..|+.|+.+|+++..
T Consensus       202 a~~~-------~P~i~~ik~~L~~l~a~~~~~~rMS-GSGstvFa~F~~~~e  245 (288)
T PRK00650        202 VFRL-------RLDLKEKKHWLESLWSPFPVHVGLT-GSGATLFVRYPRILE  245 (288)
T ss_pred             HHHH-------CHHHHHHHHHHHHCCCCCCCEEEEE-CCCCEEEEEECCCCC
T ss_conf             9985-------9799999999996469877658887-313049999088110


No 31 
>PRK04648 consensus
Probab=98.44  E-value=1.1e-05  Score=60.25  Aligned_cols=242  Identities=14%  Similarity=0.162  Sum_probs=129.7

Q ss_pred             ECC--CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECC---CCCHHHHHHHHHHHHHH
Q ss_conf             748--8424881167767011757898434681278107999971788857998787256---65206899999974216
Q gi|254781016|r   27 FLP--SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS---SQSSFFKKTTQFCDLFR  101 (355)
Q Consensus        27 ~ap--~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~---~~~~~~~ri~~~l~~~r  101 (355)
                      -||  .|+.| +--|||+.-  .-.-.|+=..+| ++-+-+++.  ....++...|...+   .++   .-|.+.++.++
T Consensus        18 ~APAKINL~L-~V~gkr~DG--YH~l~Sl~~~id-l~D~l~i~~--~~~~~~~~~~~~~~~i~~~~---Nlv~ka~~~l~   88 (295)
T PRK04648         18 PAPAKLNLFL-QITGRRADG--YHLLQTVFRLLD-WGDTIHLRV--RSDGQIHRIGESLPGVAEDD---DLVVRAARLLQ   88 (295)
T ss_pred             CCCCEEECCC-CCCCCCCCC--CCEEEEEEEECC-CCEEEEEEE--CCCCCEEEECCCCCCCCCCC---HHHHHHHHHHH
T ss_conf             5621370251-328879999--872568999837-880999998--89994799368888899977---49999999999


Q ss_pred             HHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCC
Q ss_conf             76194--3999985023321101232247999999999981889998899988652135303431056200257898765
Q gi|254781016|r  102 QFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG  179 (355)
Q Consensus       102 ~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~  179 (355)
                      +..+.  .+.|.-+-|+|.+|||+.-+|-.||+-.++++.++++++.+++..+|+...--..-.++|+- .|..|.++.-
T Consensus        89 ~~~~~~~~~~I~l~K~IPvgAGLGGGSSnAAa~L~~Ln~~~~l~ls~~~L~~ia~~lGaDVPffl~~~~-a~~~G~GE~l  167 (295)
T PRK04648         89 SAAGTALGAEIRVDKRIPAGGGFGGGSSDAATVLVALNALWGLGLDVDTLAELGLRLGADVPVFVRGHN-AWAEGVGEQL  167 (295)
T ss_pred             HHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEEEECCC-EEEEECCCEE
T ss_conf             965999874999980686675677654689999999999858999989999999964899315874776-8999678363


Q ss_pred             CCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHH---HHHHHHHHHHHH-HHHCCHHHHHHHHH
Q ss_conf             44131015666864215899972876675210567988761856899997---305509999999-98099999999999
Q gi|254781016|r  180 MDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ---QISTDLAHIKQA-IIDQDFIKLGEVAE  255 (355)
Q Consensus       180 sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~---~~~~~~~~~~~a-i~~~Df~~l~~i~e  255 (355)
                           .++  ..|+..+  ++|..+.  -.||.-+=         +.+-.   ..+..+.+.... +..+          
T Consensus       168 -----~~~--~~~~~~~--lLv~P~~--~vST~~vy---------~~~~~~~~~~~~~~~~~~~~~~~~N----------  217 (295)
T PRK04648        168 -----TPI--SLPEAAY--LLVDPGV--HVPTPVLF---------RSQELTRDAAPAKIADFASGSLLDN----------  217 (295)
T ss_pred             -----EEC--CCCCCEE--EEECCCC--CCCHHHHH---------HCCCCCCCCCCCCHHHHHHCCHHHC----------
T ss_conf             -----586--7788579--9988999--96659997---------3834456666455677762843118----------


Q ss_pred             HHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHH-HHHHHHHHHHH
Q ss_conf             9999899987038995686578899999999997428961999977798179995589-89999999763
Q gi|254781016|r  256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK-IEETIKQFFPE  324 (355)
Q Consensus       256 ~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~-~~~~i~~~l~~  324 (355)
                          .+-.+.+...       |+-.+++   ..+++-|. +--| ..||.|+-+|..+ +++++.+.|+.
T Consensus       218 ----dlE~~~~~~~-------P~I~~i~---~~L~~~g~-a~MS-GSGSt~FglF~~~~~A~~a~~~l~~  271 (295)
T PRK04648        218 ----AFEPVLRRRE-------PAVEAVF---QALSRVGT-PRLT-GSGSGCFVEFATRAAAEQALAQLPG  271 (295)
T ss_pred             ----HHHHHHHHCC-------HHHHHHH---HHHHCCCC-CCEE-EECCCEEEEECCHHHHHHHHHHCCC
T ss_conf             ----1689998628-------8999999---99860598-6579-5352138998999999999996345


No 32 
>COG1947 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase [Lipid metabolism]
Probab=98.44  E-value=4.2e-05  Score=56.04  Aligned_cols=261  Identities=18%  Similarity=0.198  Sum_probs=142.5

Q ss_pred             CEEEECC--CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECC-EECCCCCHHHHHHHHHHHH
Q ss_conf             3789748--842488116776701175789843468127810799997178885799878-7256652068999999742
Q gi|254781016|r   23 KSSAFLP--SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG-QKISSQSSFFKKTTQFCDL   99 (355)
Q Consensus        23 ~~ta~ap--~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG-~~~~~~~~~~~ri~~~l~~   99 (355)
                      +.++.||  .|+.| +--|||+.-+  -.--||=-++| ++-+-+++..+...+.+.-+. ..++..+   .-+.+..+.
T Consensus         3 ~~~~~apAKiNL~L-~V~gkr~DGY--Hel~sl~~~id-~~D~l~i~~~~~~~~~~~~~~~~~lp~~~---NLv~rAa~l   75 (289)
T COG1947           3 STKFPAPAKINLFL-HVTGKRADGY--HELETLFQFID-LGDELTIRPRDDDGFIVLGTFADGLPTDE---NLVYRAAEL   75 (289)
T ss_pred             CEEEECCCEEEEEE-EECCCCCCCC--EEEEEEEEEEC-CCCEEEEEECCCCCCEEECCCCCCCCCCC---HHHHHHHHH
T ss_conf             36872154488888-8535589984--34589999941-48789999877887269667777887743---199999999


Q ss_pred             HHHHCCC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCC
Q ss_conf             1676194--39999850233211012322479999999999818899988999886521353034310562002578987
Q gi|254781016|r  100 FRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ  177 (355)
Q Consensus       100 ~r~~~~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~  177 (355)
                      +++..+.  .+.|.-+-+.|.++|||--+|-.||.-+++++++++.++.++|..|+-+-..-..-.++||-+. -.|.++
T Consensus        76 l~~~~~~~~~v~I~l~K~IPv~aGLGGGSSdAAa~L~~Ln~lw~~~ls~~eL~~Lg~~LGaDVPffl~g~tA~-a~G~GE  154 (289)
T COG1947          76 LRKRTGIAGGVSIHLDKNIPVGAGLGGGSSDAAAVLVALNELWGLGLSLEELAELGLRLGADVPFFLSGGTAF-AEGRGE  154 (289)
T ss_pred             HHHHHCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEECCCEE-EEECCC
T ss_conf             9998689998279998368655767664578999999999986799999999999998689867143188569-887363


Q ss_pred             CCCCEEEEECCCCCCCCEEEEEEECCCCCCCC-CCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             65441310156668642158999728766752-10567988761856899997305509999999980999999999999
Q gi|254781016|r  178 NGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG-SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       178 ~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vs-St~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      .   .  .++.+ .+...++++  ..   .++ ||..+=+    .+...    .....-..+..++..+++..+.+   .
T Consensus       155 ~---l--~~~~~-~~~~~~vl~--~P---~v~vsT~~vy~----~~~~~----~~~~~~~~~~~~~~~~~~~~~~~---~  212 (289)
T COG1947         155 K---L--EPLED-PPEKWYVLA--KP---GVGVSTKEVYK----DPELT----RNTPKSEPLIAALSLENLKQIAP---F  212 (289)
T ss_pred             E---E--EECCC-CCCCEEEEE--EC---CCCCCHHHHHC----CCCCC----CCCCCCHHHHHHHHHHHHHHHHH---H
T ss_conf             5---1--47777-887529999--58---98998799970----86756----46677224558786552776410---2


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCC-CEEEEEECCCCEEEEEECHH-HHHHHHHHHHH
Q ss_conf             9998999870389956865788999999999974289-61999977798179995589-89999999763
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHK-IEETIKQFFPE  324 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g-~~v~fT~DAGPNv~il~~~~-~~~~i~~~l~~  324 (355)
                      .-|.|.+....-.|       +-   -+....+++.| ..+..| ..||.|+-+|+.+ .++.+.+.+++
T Consensus       213 ~~NdLe~~~~~~~p-------~v---~~~~~~l~~~ga~~~~mS-GSGstvF~l~~~~~~a~~~~~~l~~  271 (289)
T COG1947         213 LINDLEKVALRLYP-------EV---KEALSELLEYGALPARMS-GSGSTVFALFDTEKEAQRVAEQLPK  271 (289)
T ss_pred             CCCCHHHHHHHHCH-------HH---HHHHHHHHHCCCCCCEEE-CCCCCEEEEECCHHHHHHHHHHHHC
T ss_conf             03645788988586-------89---999999764135443682-4787289993876889999987430


No 33 
>PRK05101 galactokinase; Provisional
Probab=98.44  E-value=0.00028  Score=50.31  Aligned_cols=310  Identities=14%  Similarity=0.144  Sum_probs=154.3

Q ss_pred             HHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCC-EEEEEEE-C-C--CCCCEEEECCEECC
Q ss_conf             8874034678776378974884248811677670117578984346812781-0799997-1-7--88857998787256
Q gi|254781016|r   10 HRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLG-TITHITV-I-D--SDADCIILNGQKIS   84 (355)
Q Consensus        10 ~~~~~~~~~~~~~~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~-T~T~v~~-~-~--~~~d~~~lnG~~~~   84 (355)
                      .-|...-+..+  ...++||--|-||==+=-++.-..||.-=....++.... .+.++.+ + +  ...+.|-++.....
T Consensus         9 ~~F~~~fG~~P--~~~~~APGRVnliGEHtDY~gG~Vlp~AI~~~~~ia~~~~~d~~~~v~s~~~~~~~~~~~l~~~~~~   86 (382)
T PRK05101          9 SLFAEQFGYPP--THTIQAPGRVNLIGEHTDYNDGFVLPCAINYQTVISCAKRDDRIVRVIAADYDNQQDEFSLDAPIVP   86 (382)
T ss_pred             HHHHHHHCCCC--CEEEECCCCCCCCCHHHHCCCCCEEEEECCCCEEEEEEECCCCEEEEEECCCCCCEEEEECCCCCCC
T ss_conf             99999868998--5899776740332032342898578688112579999988998599998888985258856876677


Q ss_pred             C-CCHHHHHHHHHHHHHHHHC-C-CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC----
Q ss_conf             6-5206899999974216761-9-4399998502332110123224799999999998188999889998865213----
Q gi|254781016|r   85 S-QSSFFKKTTQFCDLFRQFS-K-VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS----  157 (355)
Q Consensus        85 ~-~~~~~~ri~~~l~~~r~~~-~-~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS----  157 (355)
                      . ...-..-+.-.+..+++.. . ..+.+.-..++|.++||.||||--.|++.++..+++++++..++..+++..-    
T Consensus        87 ~~~~~W~~Yv~Gv~~~l~~~g~~~~G~d~~I~s~IP~GaGLSSSAAl~va~~~al~~l~~~~~~~~ela~l~~~aE~~~~  166 (382)
T PRK05101         87 HENYQWANYVRGVVKHLQERNPDFGGADLVISGNVPQGAGLSSSASLEVAVGQTFQQLYHLPLSGAEIALNGQEAENQFV  166 (382)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             87766799999999999973899887389996788887775417899999999999973899899999999999998401


Q ss_pred             CCCH------HHHCCC---CHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCH-------HHHHHHHH-
Q ss_conf             5303------431056---200257898765441310156668642158999728766752105-------67988761-
Q gi|254781016|r  158 GSAC------RSFYRG---FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSRE-------AMEITRHH-  220 (355)
Q Consensus       158 GSA~------RSi~GG---~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~-------gm~~~v~t-  220 (355)
                      |..|      -|++|.   ...-...    ..+...++++   .++  .+++++...|+-..+.       .++...+. 
T Consensus       167 G~~~GiMDQ~as~~g~~~~al~id~~----~l~~~~v~lp---~~~--~~vi~dS~v~~~l~~~~Yn~R~~ec~~aa~~l  237 (382)
T PRK05101        167 GCNCGIMDQLISALGKKDHALLIDCR----SLETKAVSMP---EGV--AVVIINSNVKRGLVDSEYNTRREQCETAARFF  237 (382)
T ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCC----CCCEEEEECC---CCC--EEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             78887167889985267828850367----8843665469---996--79995388654345450578999999999996


Q ss_pred             --------------------CHHHHHHHHHH---HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECH
Q ss_conf             --------------------85689999730---5509999999980999999999999999899987038995686578
Q gi|254781016|r  221 --------------------SPFFTQWTQQI---STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK  277 (355)
Q Consensus       221 --------------------Sp~y~~r~~~~---~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~  277 (355)
                                          .+....|...+   ..|..+..+|++++|++.||+++-.+-..|--.+--|.       |
T Consensus       238 ~~~~Lrd~~~~~l~~~~~~l~~~~~~Ra~Hvi~E~~Rv~~a~~aL~~~d~~~lG~Lm~~SH~Slr~~yevS~-------~  310 (382)
T PRK05101        238 GVKALRDVTLEQFNAVAAELDPVVAKRARHVITENARTLEAASALAQGDLKRMGELMAESHASMRDDFEITV-------P  310 (382)
T ss_pred             CHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC-------H
T ss_conf             924133289999998771089999999999999999999999998628999999999862798998770798-------8


Q ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCC--CEEEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             89999999999742896199997779--81799955898999999976321003688875120
Q gi|254781016|r  278 ETIQGMERVWDARQQSIPIYFTLDAG--PNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS  338 (355)
Q Consensus       278 ~t~~ii~~v~~~R~~g~~v~fT~DAG--PNv~il~~~~~~~~i~~~l~~i~~~~~~~~~~~~~  338 (355)
                      +.-.+++..++.......+=.| .||  =-+..|++++.++.+.+.+.+...-.....|..+.
T Consensus       311 elD~lv~~a~~~~g~~gGARmt-G~GfGGc~vaLv~~~~~~~~~~~v~~~Y~~~~g~~~~~~~  372 (382)
T PRK05101        311 QIDTLVEIVKAVIGDQGGVRMT-GGGFGGCIVALVPEELVEAVRQAVAEQYEAKTGLKETFYV  372 (382)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEE-CCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             9999999999761877546896-3676002899974778999999999999996499987899


No 34 
>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR005917   Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific .   Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins.   The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases .    Phosphomevalonate kinase (2.7.4.2 from EC)catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This pathway starts with three molecules of acetyl-CoA, which, in a series of six different enzyme reactions, are converted to isopentanyl pyrophosphate (IPP), the basic C5 isoprene unit and a common intermediate for a number of pathways including isoprenoid and cholesterol biosynthesis. There are two unrelated types of PMK. The first type belongs to the GHMP kinase and includes a eukaryotic group which is typified by Saccharomyces cerevisiae ERG8  and a bacterial group typified by by  Streptococcus pneumoniae  PMK (MvaK2) . The second type includes animal PMKs, typified by human PMK . PMKs of the first type are present in eubacteria, fungi, and plants, while the second type is found only in animals, indicative of a nonorthologous gene displacement early in animal evolution . PMKs of the GHMP kinase type are closely related to mevalonate kinases. The two types of PMK have different consensus ATP-binding motifs: a protein kinase motif in the ERG8 orthologs versus a P-loop or Walker A motif in the animal orthologs. The fact that ERG8 orthologs are found in pathogenic eubacteria and fungi but not in humans makes them attractive targets for the development of antibacterial and/or antifungal drugs . This group of enzymes belongs to the GHMP kinase domain superfamily. GHMP kinases are a unique class of ATP-dependent enzymes (the abbreviation of which refers to the original members: galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase) . Enzymes belonging to this superfamily contain three well-conserved motifs, the second of which has the typical sequence Pro-X-X-X-Gly-Leu-X-Ser-Ser-Ala and is involved in ATP binding . The phosphate binding loop in GHMP kinases is distinct from the classical P-loops found in many ATP/GTP binding proteins. The bound ADP molecule adopts a rare syn conformation and is in the opposite orientation from those bound to the P-loop-containing proteins . GHMP kinases display a distinctly bilobal appearance with their N-terminal subdomains dominated by a mixed beta-sheet flanked on one side by alpha-helices and their C-terminal subdomains containing a four stranded anti-parallel beta-sheet , , , ..
Probab=98.42  E-value=5e-05  Score=55.53  Aligned_cols=274  Identities=15%  Similarity=0.153  Sum_probs=167.2

Q ss_pred             CCCCCCCEEEEECCCCEEEEEEECC---CC-------------------CCEEEECCEECCC-CCHHHHHHHHHHHHHHH
Q ss_conf             7578984346812781079999717---88-------------------8579987872566-52068999999742167
Q gi|254781016|r   46 NLPLNNSLSLSLGHLGTITHITVID---SD-------------------ADCIILNGQKISS-QSSFFKKTTQFCDLFRQ  102 (355)
Q Consensus        46 ~lP~n~SiS~TL~~~~T~T~v~~~~---~~-------------------~d~~~lnG~~~~~-~~~~~~ri~~~l~~~r~  102 (355)
                      .=|=||||=+-.|.+-|-| |+-.+   ..                   +|++.++...... -+..++-|...++.+.+
T Consensus        18 vePG~pailvAVDrfvtvt-ve~~~adt~~~~~i~S~~l~~~pv~w~r~~g~lv~~d~~dGqqA~s~l~yVv~AIe~~e~   96 (367)
T TIGR01220        18 VEPGYPAILVAVDRFVTVT-VEDADADTDAADVIQSSDLSSEPVRWRRRDGKLVVDDADDGQQAESALKYVVAAIEVVEK   96 (367)
T ss_pred             ECCCCCEEEEEECCEEEEE-EECCCCCCCCCCCEEECCCCCCCCEEEEECCEEEEECCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             3777955999975658999-863567543445145211477760346426857872377435566457876678999999


Q ss_pred             HC--------CCEEEEEEECCC--CCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH--------CCC-CCHHH
Q ss_conf             61--------943999985023--321101232247999999999981889998899988652--------135-30343
Q gi|254781016|r  103 FS--------KVYFLIETSNNI--PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL--------GSG-SACRS  163 (355)
Q Consensus       103 ~~--------~~~~~I~S~N~f--PtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARl--------GSG-SA~RS  163 (355)
                      ++        -+++.|.|+=+=  ---=||+||++...+.+.|++.+|++.|+..++-+||-+        ||| --+-|
T Consensus        97 ya~e~n~kl~~~hL~v~S~Ld~~~GrKyGLGSSgAVtV~tVkAln~Fydl~Lsn~eifkLa~la~~~lq~~gScGDiAaS  176 (367)
T TIGR01220        97 YARERNKKLKAYHLEVSSELDEADGRKYGLGSSGAVTVATVKALNAFYDLELSNEEIFKLAVLATLELQSKGSCGDIAAS  176 (367)
T ss_pred             HHHHCCCCCCEEEEEEEEEEECCCCCEECCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHH
T ss_conf             97650971102676687641057884504662078999999999986287757567889989864220689975411110


Q ss_pred             HCCCCHHCCCCCCCCCC-CEE-----EEECCCCCCCCEEEEEEECCC---------CCCCCC---CHHHHHHHHHCHHHH
Q ss_conf             10562002578987654-413-----101566686421589997287---------667521---056798876185689
Q gi|254781016|r  164 FYRGFCEWICGTDQNGM-DSF-----AVPFNNQWPDLRIGLLKIIDR---------EKKIGS---REAMEITRHHSPFFT  225 (355)
Q Consensus       164 i~GG~v~W~~g~~~~~s-ds~-----a~~~~~~~~dl~~~i~iv~~~---------~K~vsS---t~gm~~~v~tSp~y~  225 (355)
                      .||||..... .|.|-- +-.     -.-+...||++.+-=+-+..+         ...-++   ++-|++..+.+-+|+
T Consensus       177 ~ygGWiAyst-fDhdwV~q~~~~~~v~~~L~~~WPgl~i~pL~aPk~l~lliGWTGsPASt~~LVs~vhr~k~~~~a~y~  255 (367)
T TIGR01220       177 VYGGWIAYST-FDHDWVKQKVEEVSVDEVLKKDWPGLSIEPLKAPKNLELLIGWTGSPASTADLVSEVHRRKEEKSAAYE  255 (367)
T ss_pred             HHHHHHHHCC-CCHHHHHHHHHHHCHHHHHHCCCCCCEEECCCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCHHHH
T ss_conf             1110333057-666888755413035888614778850220679986779886317887776788888740467623688


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCE
Q ss_conf             99973055099999999809999999999999998999870389956865788999999999974289619999777981
Q gi|254781016|r  226 QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN  305 (355)
Q Consensus       226 ~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPN  305 (355)
                      .-+++...=++.|+.|++.+|...+-.-+.++=+.|.  -|+..-++.-.||+-..+=+.-    +....++=|-.||==
T Consensus       256 rFl~~s~~CVe~~i~af~tg~i~~~~k~Ir~nR~~la--~ld~e~gv~IeTe~Lk~LCD~a----E~yggAAK~SGAGGG  329 (367)
T TIGR01220       256 RFLEKSRDCVESLITAFETGDIKSVQKEIRKNRQLLA--RLDDEVGVDIETEKLKALCDLA----EAYGGAAKSSGAGGG  329 (367)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH--HHCCCCCCEEECHHHHHHHHHH----HHCCCCCCCCCCCCC
T ss_conf             8887678999999864315773257888899999998--5101142023444366554264----311122377888874


Q ss_pred             ---EEEEECHH--HHHHHHHHHHHCCC
Q ss_conf             ---79995589--89999999763210
Q gi|254781016|r  306 ---LKLLFTHK--IEETIKQFFPEITI  327 (355)
Q Consensus       306 ---v~il~~~~--~~~~i~~~l~~i~~  327 (355)
                         +.||=.+.  +...|.+.=..-++
T Consensus       330 DCGIai~d~~~srdi~~~~~~We~~Gi  356 (367)
T TIGR01220       330 DCGIAILDAKASRDILRVRQEWEKDGI  356 (367)
T ss_pred             CHHHHEEHHHHHCCCHHHHHHHHHCCC
T ss_conf             411212200231360578888886688


No 35 
>PRK01726 consensus
Probab=98.40  E-value=0.00021  Score=51.15  Aligned_cols=251  Identities=14%  Similarity=0.090  Sum_probs=137.0

Q ss_pred             EEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             89748842488116776701175789843468127810799997178885799878725665206899999974216761
Q gi|254781016|r   25 SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFS  104 (355)
Q Consensus        25 ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~  104 (355)
                      .|-|-.|+.| +--|||+.-  .=.-.|+=..+ +++-+-+++.  .+.+.+.+.+........ -.-|.+.++.+++..
T Consensus        25 ~aPAKINL~L-~V~gkR~DG--YH~L~Sl~~~i-dl~D~i~i~~--~~~~~i~~~~~~~~i~~~-~Nli~kA~~~l~~~~   97 (312)
T PRK01726         25 PSPAKLNLFL-YINGKRPDG--YHELQTLFQFL-DFGDWLDISI--REDNQIVLTPEIPNLKTE-DNLIYRAAKLLQQKT   97 (312)
T ss_pred             ECCEEECCCC-CCCCCCCCC--CCEEEEEEEEE-CCCCEEEEEE--CCCCCEEEECCCCCCCCC-CCHHHHHHHHHHHHH
T ss_conf             4630480450-207828999--85268999994-6896999999--689978993678999886-759999999999976


Q ss_pred             CC--EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCE
Q ss_conf             94--3999985023321101232247999999999981889998899988652135303431056200257898765441
Q gi|254781016|r  105 KV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS  182 (355)
Q Consensus       105 ~~--~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds  182 (355)
                      +.  .+.|.-+-|.|.+|||+.-+|-.||+..+++++++++++.+++..+|+....-..-.++|+-+. ..|.++.-.  
T Consensus        98 ~~~~~~~I~l~KnIPvgAGLGGGSSdAAavL~~Ln~l~~l~ls~~~L~~ia~~iGADVPffl~~~~a~-~~GiGE~l~--  174 (312)
T PRK01726         98 NCQLGANIHLDKILPMGGGVGGGSSNAATALVALNYLWQTNLSIDELAKLGLTLGADVPIFVHGHAAF-AEGVGEKIT--  174 (312)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEEEECCCEE-EECCCCEEE--
T ss_conf             99876389997378665677754346999999999984469998999999986189816686177789-988986820--


Q ss_pred             EEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             31015666864215899972876675210567988761856899997305509999999980999999999999999899
Q gi|254781016|r  183 FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH  262 (355)
Q Consensus       183 ~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mH  262 (355)
                       .+..    ++..  +++|..  .--.||..+=....- +     -......+.++..---.+||              -
T Consensus       175 -~i~~----~~~~--~lLv~P--~i~vST~~vf~~~~l-~-----~~~~~~~~~~~l~~~~~NDL--------------E  225 (312)
T PRK01726        175 -YCEP----PEKW--FVVLKP--DDSISTAVIFQDPNL-P-----RNTPKKSLEQLLSEPYKNDC--------------E  225 (312)
T ss_pred             -ECCC----CCCE--EEEECC--CCCCCCHHHHHCCCC-C-----CCCCHHHHHHHHHHHHCCCH--------------H
T ss_conf             -6677----7666--999899--998687799709675-5-----47631149999860611644--------------8


Q ss_pred             HHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEC-HHHHHHHHHHHHHCC
Q ss_conf             9870389956865788999999999974289619999777981799955-898999999976321
Q gi|254781016|r  263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFPEIT  326 (355)
Q Consensus       263 a~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~-~~~~~~i~~~l~~i~  326 (355)
                      .....-       .|+--++.+.+.++   |- +--| ..||.|+-+|. ++.+++|.+.+|+--
T Consensus       226 ~~a~~~-------~PeI~~i~~~L~~~---~~-arMS-GSGST~FglF~sk~eA~ki~~~~p~~~  278 (312)
T PRK01726        226 KVVINH-------YSEVEEALNWLLQY---AP-ARLT-GTGACVFAEFDHEASAQAVFRQKPEAF  278 (312)
T ss_pred             HHHHHH-------CHHHHHHHHHHHHC---CC-CEEE-CCCCEEEEEECCHHHHHHHHHHCCCCC
T ss_conf             999986-------89999999998613---89-8367-538049999799999999998689764


No 36 
>PRK04181 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=98.21  E-value=0.00024  Score=50.80  Aligned_cols=143  Identities=20%  Similarity=0.148  Sum_probs=87.0

Q ss_pred             EECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCEECC-CCCHHHHHHHHHHHHHHHHC
Q ss_conf             97488424881167767011757898434681278107999971788857998787256-65206899999974216761
Q gi|254781016|r   26 AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS-SQSSFFKKTTQFCDLFRQFS  104 (355)
Q Consensus        26 a~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~~~~-~~~~~~~ri~~~l~~~r~~~  104 (355)
                      +.|-.|..|-= -||||. . -.+ -|+=.++.+++-+-++  .+...+.+.+.|.... .+..   -+.+.++.++...
T Consensus         3 s~AKINL~L~V-~~kRd~-y-H~l-~s~~~~i~dl~D~i~i--~~~~~~~~~~~~~~~~~~~~N---lv~ka~~~l~~~~   73 (254)
T PRK04181          3 SYAKVNIFLKI-TGKRGN-Y-HEL-ISRFVLVKDLFDEIEF--VDDSAKSFEIIGNFDCPLEEN---IIFKAYQELKSKG   73 (254)
T ss_pred             CCCEECCCEEE-CCCCCC-C-CEE-EEEEEEHHHCCEEEEE--EECCCCCEEEECCCCCCCCCC---HHHHHHHHHHHHC
T ss_conf             76537674357-753499-8-732-5477782008579999--988999589978888885415---9999999998753


Q ss_pred             ------C--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCC
Q ss_conf             ------9--43999985023321101232247999999999981889998899988652135303431056200257898
Q gi|254781016|r  105 ------K--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD  176 (355)
Q Consensus       105 ------~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~  176 (355)
                            .  ..+.|.-+-|+|.+|||+.-+|-.||.-.++++.++++++.+++..+|+...---.-.++|+=..|..|.+
T Consensus        74 ~~~~~~~~~~~~~I~l~KnIP~gAGLGGGSSdAAa~L~~l~~~~~l~ls~~~L~~ia~~lGaDVPffl~g~~~a~~~G~G  153 (254)
T PRK04181         74 FSNELIEFFSKLAIEVTKNIPTGAGLGGGSSNAATFLLMANEILNLKLSLEELINIGSKIGADVAFFISGYKSANVSGIG  153 (254)
T ss_pred             CCCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCEEECCCCEEEEECCC
T ss_conf             32343113664179995257665678874668999999999982899999999998753189824497578637887577


Q ss_pred             C
Q ss_conf             7
Q gi|254781016|r  177 Q  177 (355)
Q Consensus       177 ~  177 (355)
                      +
T Consensus       154 e  154 (254)
T PRK04181        154 E  154 (254)
T ss_pred             C
T ss_conf             3


No 37 
>PRK03288 consensus
Probab=98.19  E-value=0.00044  Score=48.93  Aligned_cols=245  Identities=13%  Similarity=0.068  Sum_probs=128.7

Q ss_pred             ECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECC--EECCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             748842488116776701175789843468127810799997178885799878--725665206899999974216761
Q gi|254781016|r   27 FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG--QKISSQSSFFKKTTQFCDLFRQFS  104 (355)
Q Consensus        27 ~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG--~~~~~~~~~~~ri~~~l~~~r~~~  104 (355)
                      -|-.|+.| +=-|||+.-  .=.-.|+-..+| ++-+-+++.  .+++++.+.+  ...+.++   .-|.+..+.+++..
T Consensus         8 PAKINL~L-~V~gkR~DG--YH~i~S~~~~id-l~D~i~i~~--~~~~~i~~~~~~~~~~~~~---Nlv~ka~~~l~~~~   78 (283)
T PRK03288          8 PAKLNLFL-YITGQRADG--YHTLQTLFQFLD-YGDTLTIEP--RDDGEIRLLTPVEGVENED---NLIVRAARLLMKTA   78 (283)
T ss_pred             CEEEECCC-CCCCCCCCC--CCEEEEEEEECC-CCCEEEEEE--CCCCCEEEECCCCCCCCCC---CHHHHHHHHHHHHH
T ss_conf             01581140-338869999--872578999817-882999999--8999789955876787754---18999999999976


Q ss_pred             --------CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCC
Q ss_conf             --------943999985023321101232247999999999981889998899988652135303431056200257898
Q gi|254781016|r  105 --------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD  176 (355)
Q Consensus       105 --------~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~  176 (355)
                              ...+.|.-+-|.|.+|||+..+|-.||+-.+++++++++++.+++..+|+..-.--.-.++|+ ..|..|.+
T Consensus        79 ~~~~~~~~~~g~~I~l~KnIPv~AGLGGGSSdAAa~L~~L~~l~~l~ls~~~l~~ia~~iGaDVPffl~~~-~a~~~G~G  157 (283)
T PRK03288         79 ADSGRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSDDELAELGLTLGADVPVFVRGH-AAFAEGVG  157 (283)
T ss_pred             HHHCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCEECCC-CEEEECCC
T ss_conf             44024566666079994367644567877615999999999985899999999999998589831054277-58998288


Q ss_pred             CCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             76544131015666864215899972876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  177 QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       177 ~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      +.-.   .+..    ++..  +++|..  ..-.||.-+=...   .+..   ......+..+...-..+||+...   .+
T Consensus       158 e~l~---~~~~----~~~~--~llv~P--~~~vST~~vy~~~---~~~~---~~~~~~~~~~l~~~~~Ndle~~a---~~  217 (283)
T PRK03288        158 EILT---PVDP----PEKW--YLVAHP--GVSIPTPVIFKDP---ELPR---NTPKRSIETLLKCEFSNDCEVIA---RK  217 (283)
T ss_pred             CEEE---ECCC----CCCE--EEEECC--CCCCCHHHHHCCC---CCCC---CCCCCCHHHHHHCHHCCCHHHHH---HH
T ss_conf             6814---7677----8756--999899--9997828984494---4467---87534899997371106469999---87


Q ss_pred             HHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECH-HHHHHHHHHHHH
Q ss_conf             99989998703899568657889999999999742896199997779817999558-989999999763
Q gi|254781016|r  257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH-KIEETIKQFFPE  324 (355)
Q Consensus       257 dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~-~~~~~i~~~l~~  324 (355)
                      .                  .|+-.++++   .+++.+- +--| .-|+.|+-+|.. +++++|.+.+++
T Consensus       218 ~------------------~peI~~~~~---~l~~~~~-~~MS-GSGSt~Fglf~~~~~A~ki~~~~p~  263 (283)
T PRK03288        218 R------------------FREVDAALS---WLLEYAP-SRLT-GTGACVFAEFDTESEARQVLEQAPE  263 (283)
T ss_pred             H------------------HHHHHHHHH---HHHCCCC-CCEE-CHHHEEEEEECCHHHHHHHHHHCCC
T ss_conf             5------------------599999999---9855398-7122-6404179998999999999996886


No 38 
>KOG1511 consensus
Probab=98.13  E-value=0.0013  Score=45.64  Aligned_cols=100  Identities=25%  Similarity=0.284  Sum_probs=68.5

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC-----------HHHHHHHHHHC--------CC-CCHHHHCCC
Q ss_conf             99998502332110123224799999999998188999-----------88999886521--------35-303431056
Q gi|254781016|r  108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK-----------SESLSRVARLG--------SG-SACRSFYRG  167 (355)
Q Consensus       108 ~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~-----------~~~lS~lARlG--------SG-SA~RSi~GG  167 (355)
                      +.+.-.-..|.+|||+||||=-.||+.++..++|.-..           ..=+..+|-.|        || -.+-|.|||
T Consensus       132 ~~v~v~SelP~GaGLGSSAa~sv~lAtall~~~g~i~~p~~~~~~~e~~l~Li~~WAf~gE~~iHGtpSGiDnaV~t~Gg  211 (397)
T KOG1511         132 LTVVVDSELPLGAGLGSSAAISVALATALLRLAGLIPPPGSNLSLAENDLALINKWAFEGEKCIHGTPSGIDNAVCTYGG  211 (397)
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCCHHHHHHHHHHCCCEEECCCCCCCCHHHHCCCC
T ss_conf             69998446787677650689999999999997356899853000132269999988750560114887654212211476


Q ss_pred             CHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHH
Q ss_conf             2002578987654413101566686421589997287667521056798876
Q gi|254781016|r  168 FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRH  219 (355)
Q Consensus       168 ~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~  219 (355)
                      .....+|..        +..-++.|.++|+  +++++.  --||..|-..|.
T Consensus       212 ~i~f~kg~~--------~~~Lk~~~~L~il--ltnTrv--~RnTk~lVa~Vr  251 (397)
T KOG1511         212 LISFKKGVE--------IESLKHLPPLRIL--LTNTRV--PRNTKALVAGVR  251 (397)
T ss_pred             EEEEECCCC--------CEECCCCCCCEEE--EECCCC--CCCHHHHHHHHH
T ss_conf             478614765--------0203668873389--871656--751999999999


No 39 
>pfam00288 GHMP_kinases_N GHMP kinases N terminal domain. This family includes homoserine kinases, galactokinases and mevalonate kinases.
Probab=97.84  E-value=2.8e-05  Score=57.33  Aligned_cols=48  Identities=44%  Similarity=0.544  Sum_probs=42.6

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC
Q ss_conf             998502332110123224799999999998188999889998865213
Q gi|254781016|r  110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS  157 (355)
Q Consensus       110 I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGS  157 (355)
                      |....++|.++||+|||+..+|++.|+.++++++++.+++-.+|....
T Consensus         2 i~i~s~iP~g~GLgSSaa~~~a~~~al~~~~~~~l~~~~l~~~a~~~E   49 (67)
T pfam00288         2 IEIESNIPLGAGLGSSAALAVALLLALNELFGLPLSKEELARLALEAE   49 (67)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             257568998678655699999999999999589989999999999999


No 40 
>COG1829 Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only]
Probab=97.82  E-value=0.0044  Score=41.91  Aligned_cols=180  Identities=17%  Similarity=0.169  Sum_probs=104.4

Q ss_pred             CCCCEEEEEC-CCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHH
Q ss_conf             8984346812-781079999717888579987872566520689999997421676194399998502332110123224
Q gi|254781016|r   49 LNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSAS  127 (355)
Q Consensus        49 ~n~SiS~TL~-~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~~~I~S~N~fPtaaGLASSAS  127 (355)
                      ...||-..+. .-++++.|.+.++  -.+++||++.+.     +-....++++....   +.|..+-.||..+|++-|++
T Consensus        25 ~SGSiGaGv~l~~gv~v~v~~~~~--~~v~~Ng~~~d~-----~~~~~v~e~L~~~~---~~v~~~~~~P~G~G~G~Sga   94 (283)
T COG1829          25 KSGSIGAGVALERGVTVEVRFGEG--TGVRLNGKKIDL-----PITRKVIEKLGPDG---VGVRIESPVPLGCGYGVSGA   94 (283)
T ss_pred             CCCCCCEEEEECCCEEEEEEECCC--CEEEECCEECCC-----HHHHHHHHHHCCCC---CCEEEEECCCCCCCCCHHHH
T ss_conf             678864237963862699996587--358889963130-----26999999847668---62699851798865414479


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHH-------HCCCCCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEE
Q ss_conf             799999999998188999889998865-------2135303431056200257898765441310156668642158999
Q gi|254781016|r  128 GFAALTLALFRIYSIPEKSESLSRVAR-------LGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK  200 (355)
Q Consensus       128 gfAALa~Al~~~~~~~~~~~~lS~lAR-------lGSGSA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~i  200 (355)
                      +.-+.++|++..++++  .+.+.+.|-       -|=|--.-=.+||+|+=.+ ++..+   ++.-..-.++.++++...
T Consensus        95 ~AL~~Ala~a~~~~~~--~~~a~~~AH~aEV~~gtGLGDVvAq~~GGlViR~~-pG~Pg---~~~vd~Ip~~~~~V~~~~  168 (283)
T COG1829          95 GALGTALALAEELGLG--EESAARIAHVAEVENGTGLGDVVAQYTGGLVIRVK-PGGPG---EGEVDRIPVPGLRVITIS  168 (283)
T ss_pred             HHHHHHHHHHHHCCCC--HHHHHHHHHHHHHHCCCCCHHHHHHHCCCEEEEEC-CCCCC---EEEEEEEECCCCEEEEEE
T ss_conf             9999999988664998--78999988899987178704788875085799831-89998---578988604882699997


Q ss_pred             ECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             72876675210567988761856899997305509999999980999999999999
Q gi|254781016|r  201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       201 v~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                        -++...++       +-++.- ..++  ...-...+.+.+++-+++.|.+.+.+
T Consensus       169 --~g~l~T~~-------vi~~~~-~~~i--~~~g~~~l~ellk~Ptle~f~~~a~~  212 (283)
T COG1829         169 --LGELSTKS-------VITDEV-VRKI--NEAGKRALAELLKNPTLENFMEEARE  212 (283)
T ss_pred             --CCCCCHHH-------HHHHHH-HHHH--HHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             --36666777-------630678-9999--99999999998839999999999999


No 41 
>TIGR00154 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; InterPro: IPR004424 4-diphosphocytidyl-2C-methyl-D-erythritol kinase is a member of the family of GHMP kinases that were previously designated as conserved hypothetical protein YchB or as isopentenyl monophosphate kinase. In Lycopersicon esculentum (tomato) and Escherichia coli the protein has been indentified as 4-diphosphocytidyl-2C-methyl-D-erythritol kinase, an enzyme of the deoxyxylulose phosphate pathway of terpenoid biosynthesis.; GO: 0050515 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity, 0016114 terpenoid biosynthetic process.
Probab=97.69  E-value=0.0028  Score=43.29  Aligned_cols=239  Identities=16%  Similarity=0.145  Sum_probs=132.0

Q ss_pred             EEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCC------------CEEEEEEECCCCCCCHHHHHHHHH
Q ss_conf             07999971788857998787256652068999999742167619------------439999850233211012322479
Q gi|254781016|r   62 TITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK------------VYFLIETSNNIPTKAGLASSASGF  129 (355)
Q Consensus        62 T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~------------~~~~I~S~N~fPtaaGLASSASgf  129 (355)
                      -+-+|+....+.|.+.+.|...-..+. ..-+.+.++.+.+.+.            ..+.|.-+=+.|++||||--+|-+
T Consensus        40 D~i~i~~~~q~~~i~l~~~~~~~~~e~-~NL~yrAa~Ll~~~~~~~nfsH~~~~~~~G~~I~~~K~iP~~aGLgGGSsdA  118 (322)
T TIGR00154        40 DKIEISVRSQDDDIRLSKGDSDVPDEE-RNLIYRAAKLLKNKANSKNFSHSVIKVKKGVNIEITKVIPMAAGLGGGSSDA  118 (322)
T ss_pred             CEEEEEEECCCCCEEECCCCCCCCCCH-HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHHH
T ss_conf             737999853578478737789888620-1069999999998510023334301256761489864146657765404579


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCC-CCHHC-CCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCC
Q ss_conf             9999999998188999889998865213530343105-62002-578987654413101566686421589997287667
Q gi|254781016|r  130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYR-GFCEW-ICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK  207 (355)
Q Consensus       130 AALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~G-G~v~W-~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~  207 (355)
                      ||+-.+|+.+++++|+.++|..|+-..-.--.-.|+| +-+.= +.|+-.+       +++++-++..++|.    +++.
T Consensus       119 A~~L~~LN~LW~~~LS~~EL~~lG~~lGaDvpffv~GY~~A~AtG~GE~i~-------~~~e~P~e~W~~~~----kP~~  187 (322)
T TIGR00154       119 AAVLVGLNQLWNLNLSLEELAELGATLGADVPFFVSGYGTAFATGRGEIIT-------PLEEEPPEKWVVIA----KPRS  187 (322)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCEEEECCCCEEEECCCCCCCC-------CCCCCCCCCEEEEE----CCCC
T ss_conf             999998767762168878999998874698307863633121123442505-------78889874038897----2798


Q ss_pred             C-CCCHHHHHHHHHCHHHHHHHHH-HHHHHH-------HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHH
Q ss_conf             5-2105679887618568999973-055099-------999999809999999999999998999870389956865788
Q gi|254781016|r  208 I-GSREAMEITRHHSPFFTQWTQQ-ISTDLA-------HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKE  278 (355)
Q Consensus       208 v-sSt~gm~~~v~tSp~y~~r~~~-~~~~~~-------~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~  278 (355)
                      | -||...=+.-+ -.|=+..+.. .+.+.+       -+++++..+-+..+..-..+|   +-.+.+...       ++
T Consensus       188 ~~~ST~~vyq~~~-qkfGknyLp~~~~~~~~~ktihaG~~l~~i~~~~~~~~~~~~~ND---lEkv~l~~~-------~~  256 (322)
T TIGR00154       188 VSVSTAVVYQAYK-QKFGKNYLPRNTPKRAKEKTIHAGGLLKKIEEKLLQLLDSNLKND---LEKVALDAH-------TE  256 (322)
T ss_pred             CCCCCHHHHHHHH-HHCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCC---CCHHHHCCC-------CC
T ss_conf             5327389871245-531522478777656776320025102456676577665404772---020000157-------61


Q ss_pred             HHHHHHHHHHHH-HCCCEEE-EEECCCCEEEEEECH-HHHHHHHHHHHHCCC
Q ss_conf             999999999974-2896199-997779817999558-989999999763210
Q gi|254781016|r  279 TIQGMERVWDAR-QQSIPIY-FTLDAGPNLKLLFTH-KIEETIKQFFPEITI  327 (355)
Q Consensus       279 t~~ii~~v~~~R-~~g~~v~-fT~DAGPNv~il~~~-~~~~~i~~~l~~i~~  327 (355)
                      =-++.   ..+. .++-+.. +| ..||.|+-||+. ..++.|.+--+|--.
T Consensus       257 V~~~l---~~l~~~g~~~~~f~s-GsG~~vF~l~~~e~ea~~v~~~a~E~L~  304 (322)
T TIGR00154       257 VAQAL---NWLLEYGLAPERFLS-GSGPCVFALFDEEAEAEQVLEQAPEKLN  304 (322)
T ss_pred             HHHHH---HHHHHHCCCCEEEEE-CCCHHHHHCCHHHHHHHHHHHHCCHHHC
T ss_conf             89999---999860588425764-4854664215114678999873440005


No 42 
>COG4542 PduX Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=97.12  E-value=0.032  Score=35.91  Aligned_cols=184  Identities=15%  Similarity=0.137  Sum_probs=111.0

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHCCCCHHCCCCCCCCCCCEEEEEC
Q ss_conf             99998502332110123224799999999998188999889998865213530343105620025789876544131015
Q gi|254781016|r  108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF  187 (355)
Q Consensus       108 ~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA~RSi~GG~v~W~~g~~~~~sds~a~~~  187 (355)
                      ..+.-..++|.+.|+|||.+-.+|.++|....++..++..++.+++-...-|-+ -+|-+.+....-   +++.   +.+
T Consensus        84 i~l~lqSsIPvgKG~ASSTADl~At~~A~A~~l~~~l~es~iakLcv~iEPtDs-iiF~~~tlFd~r---~g~~---~~~  156 (293)
T COG4542          84 IDLLLQSSIPVGKGMASSTADLVATARATARFLGRELRESEIAKLCVSIEPTDS-IIFDKATLFDQR---EGRV---IEF  156 (293)
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCC-EECCCCEEEHHC---CCHH---HHH
T ss_conf             369986366555565634788999999999996787788899999862587654-000561000220---4308---886


Q ss_pred             CCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             66686421589997287667521056798876185689999730550999999998099999999999999989998703
Q gi|254781016|r  188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA  267 (355)
Q Consensus       188 ~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~  267 (355)
                      ...-|.|.++++    +.+-+--|.--++--. ....-+-.++...-++...+|++-+|-..+|+.+-.++..=. . +.
T Consensus       157 ~g~~PpL~ilv~----e~~~~v~T~~y~q~~r-~e~~~~~~~e~~~l~~~v~~A~~~~~~~~lG~AAT~SAv~~Q-~-~L  229 (293)
T COG4542         157 LGEMPPLHILVF----EGKGTVETVDYNQPPR-GEKLLAPLAELGNLINLVEKALKVGDPKLLGEAATLSAVKNQ-D-RL  229 (293)
T ss_pred             CCCCCCEEEEEE----CCCCCEEEEECCCCCH-HHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHC-C-CC
T ss_conf             378996279997----4898233331467854-656554499999999999998723898898788889988632-0-16


Q ss_pred             CCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEEEECHHHH
Q ss_conf             899568657889999999999742896199997779817999558989
Q gi|254781016|r  268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE  315 (355)
Q Consensus       268 s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~il~~~~~~  315 (355)
                      .       +|.--++.+.+.+...-|+.|.-+   |.-+-+++.....
T Consensus       230 P-------K~~~~~lL~l~e~~~~~Gv~VAHS---GtmlGli~D~~~~  267 (293)
T COG4542         230 P-------KPGLNELLRLVEETCAIGVIVAHS---GTMLGLIYDRKYA  267 (293)
T ss_pred             C-------CHHHHHHHHHHHHHCCCCEEEECC---CCEEEEEECCCCC
T ss_conf             8-------323899999998736544588416---7467765403355


No 43 
>pfam08544 GHMP_kinases_C GHMP kinases C terminal. This family includes homoserine kinases, galactokinases and mevalonate kinases.
Probab=96.44  E-value=0.021  Score=37.19  Aligned_cols=75  Identities=23%  Similarity=0.177  Sum_probs=53.9

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECC--CCEEEEEE-CHHHH
Q ss_conf             9999809999999999999998999870389956865788999999999974289619999777--98179995-58989
Q gi|254781016|r  239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA--GPNLKLLF-THKIE  315 (355)
Q Consensus       239 ~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DA--GPNv~il~-~~~~~  315 (355)
                      ..++.++|++.++++++.+...         +....+.|.-.+++   ..+++.|.....-..+  ||.|++|+ .+++.
T Consensus         2 ~~~l~~~d~~~~~~~~~~~~~~---------~~~~~~~~~i~~~~---~~~~~~G~~~a~~sGsg~G~~v~~l~~~~~~a   69 (82)
T pfam08544         2 LEALREGDLELLGELLNENALL---------LYLGILSPELDELL---EELRELGALGAKLSGSGGGPTVFALFKDEEDA   69 (82)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHC---------CHHHCCCHHHHHHH---HHHHHCCCCEEECCCCCCCCEEEEEECCHHHH
T ss_conf             3788818999999999999864---------05505778899999---99998599855412589888588885898999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999997632
Q gi|254781016|r  316 ETIKQFFPEI  325 (355)
Q Consensus       316 ~~i~~~l~~i  325 (355)
                      +.|.+.+.+.
T Consensus        70 ~~i~~~l~~~   79 (82)
T pfam08544        70 EEVAEALREA   79 (82)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999987


No 44 
>PTZ00290 galactokinase; Provisional
Probab=96.28  E-value=0.12  Score=31.84  Aligned_cols=152  Identities=14%  Similarity=0.085  Sum_probs=76.8

Q ss_pred             HHHHHHHHHHHCCCCCCCCCE-EEECCCCEEEEECCCCCCHHHCCCCCC--CEEEEEC--CCCEEEEEEECCCCCCEEEE
Q ss_conf             488988887403467877637-897488424881167767011757898--4346812--78107999971788857998
Q gi|254781016|r    4 SLRHILHRYIGECNPKINEKS-SAFLPSNIALCKYWGKRDSKLNLPLNN--SLSLSLG--HLGTITHITVIDSDADCIIL   78 (355)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~-ta~ap~NIALIKYWGK~d~~l~lP~n~--SiS~TL~--~~~T~T~v~~~~~~~d~~~l   78 (355)
                      +++-.|.+.-++...+..... .|+||=-+=||==+=-++.-..||.-=  .+=+...  .-.+...+.+.......+.+
T Consensus        17 ~~~~~f~~~~~~~~~~~~~~~~farAPGRVNLIGEHtDYngg~VLP~AI~~~t~i~va~~~~~~~~~~~~~~~~~~~~~~   96 (468)
T PTZ00290         17 TLKPIFLETFKVENDADVEWLLFTFAPGRVNFIGEHVDYMGGYVCPAAVLEGCHILVGRVKHFCDHKLRFATETDEHFVL   96 (468)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEEEECCCEEEEECCCCCCCCCEEECEEECCCEEEEEEECCCCCCCEEEEECCCCCCCCC
T ss_conf             99999999857998654212479977872654023102289854674701680999984257877469985067765215


Q ss_pred             CCEECCCCC----HHHHHHHH-HHHHHHHHC---C-CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCC------
Q ss_conf             787256652----06899999-974216761---9-43999985023321101232247999999999981889------
Q gi|254781016|r   79 NGQKISSQS----SFFKKTTQ-FCDLFRQFS---K-VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP------  143 (355)
Q Consensus        79 nG~~~~~~~----~~~~ri~~-~l~~~r~~~---~-~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~------  143 (355)
                      +.-......    .++.-+.. .++......   . ..+.|.-.-++|.++||.||||--.|++.|++.++.+.      
T Consensus        97 ~~~~~~~~~~~W~nY~~Gv~~~~l~~~g~~~~~~~~~G~~~~v~g~VP~GsGLSSSAAleva~~~al~~~~~~~~~~~~~  176 (468)
T PTZ00290         97 DHLGGAKHNKAWTTFVRGAATLRLNRLGVAIDAPSLQGVCMVVHGTLPMGAGMSASASFGVALLNAINTVVTRRYKGCPT  176 (468)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             76677888987631789999999997198767788860599998988774157899999999999999987422344333


Q ss_pred             -----------CCHHHHHHHHHH
Q ss_conf             -----------998899988652
Q gi|254781016|r  144 -----------EKSESLSRVARL  155 (355)
Q Consensus       144 -----------~~~~~lS~lARl  155 (355)
                                 .+..++..||++
T Consensus       177 ~~~~~~~i~~~~sk~e~~~la~~  199 (468)
T PTZ00290        177 SPGRRYSILPPMSKEELIELAKQ  199 (468)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             43211123455567789999999


No 45 
>KOG1537 consensus
Probab=95.98  E-value=0.095  Score=32.61  Aligned_cols=200  Identities=20%  Similarity=0.204  Sum_probs=115.5

Q ss_pred             EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHH---HH-HHHHHCCCCCHHH-------------------
Q ss_conf             399998502332110123224799999999998188999889---99-8865213530343-------------------
Q gi|254781016|r  107 YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES---LS-RVARLGSGSACRS-------------------  163 (355)
Q Consensus       107 ~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~---lS-~lARlGSGSA~RS-------------------  163 (355)
                      .-++.+.|-.|-.+|++||+++-.|-+.-.+...++.++...   -+ .++|. -..+.-+                   
T Consensus        94 ~Tk~hvtNPiplgrGigssgta~~aGv~l~ne~a~LGlsk~~mldy~lmierh-pdn~~a~mmGgf~GSflr~l~e~E~~  172 (355)
T KOG1537          94 TTKKHVTNPIPLGRGIGSSGTAKMAGVRLVNESADLGLSKGSMLDYSLMIERH-PDNAVAEMMGGFLGSFLRALLESEAK  172 (355)
T ss_pred             CEEEEECCCCCCCCCCCCHHHHHHHHHEECCHHHHCCCCCCCCHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             00254137765655523034566544213044765287610230178887647-17789999866789999875876664


Q ss_pred             ------------HCCCCHHCCCCCCCCCCCEEEEECCCCC-CCCEEEEEEECCCCCCCCCCHHHHHHHHHC-HHHH-HHH
Q ss_conf             ------------1056200257898765441310156668-642158999728766752105679887618-5689-999
Q gi|254781016|r  164 ------------FYRGFCEWICGTDQNGMDSFAVPFNNQW-PDLRIGLLKIIDREKKIGSREAMEITRHHS-PFFT-QWT  228 (355)
Q Consensus       164 ------------i~GG~v~W~~g~~~~~sds~a~~~~~~~-~dl~~~i~iv~~~~K~vsSt~gm~~~v~tS-p~y~-~r~  228 (355)
                                  +.||||+-...+-.|    ...+..-.| +|+..++++.+.+-    +|.-|.-...|+ |.-+ .| 
T Consensus       173 ~~~~~ad~ilp~~~gg~~li~~lpP~d----lg~~~r~pw~~~lk~i~viP~Fel----~T~k~R~vLPt~yp~~d~V~-  243 (355)
T KOG1537         173 VSGYHADNILPAIMGGFVLIRNLPPLD----LGKPLRFPWDKDLKFILVIPDFEL----PTKKMRAVLPTEYPMVDHVW-  243 (355)
T ss_pred             HCCCCHHHHCCCCCCCEEEECCCCCCC----CCCCCCCCCCCCCEEEEEECCCCC----CCHHHHHHCCCCCCCEEEEE-
T ss_conf             237887772501258705505889522----366333777766138999444446----60455420675566300220-


Q ss_pred             HHHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCC-EEEEEECCCCEE
Q ss_conf             73055099999999809-9999999999999989998703899568657889999999999742896-199997779817
Q gi|254781016|r  229 QQISTDLAHIKQAIIDQ-DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSI-PIYFTLDAGPNL  306 (355)
Q Consensus       229 ~~~~~~~~~~~~ai~~~-Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~-~v~fT~DAGPNv  306 (355)
                        .-.++..+..|+.++ |---++.-.|+|  +.|+-++.+      +-|...+|...+..--.-|. .++.+ .|||.+
T Consensus       244 --NlqrlA~LttAl~~~p~n~~L~y~~m~D--kvhqPyRa~------LIPGl~~il~~~~p~t~pGl~GiclS-GAGPT~  312 (355)
T KOG1537         244 --NLQRLAALTTALLEGPDNVMLGYALMSD--KVHQPYRAP------LIPGLEAILKAALPATYPGLFGICLS-GAGPTA  312 (355)
T ss_pred             --CHHHHHHHHHHHHCCCCCHHHHHHHHHC--CCCCCCCCC------CCCCHHHHHHHHCCCCCCCEEEEEEC-CCCCEE
T ss_conf             --0888999999981499713555566532--124753145------57418999986185567862458843-889736


Q ss_pred             EEEECHHHH---HHHHHHHHHCCC
Q ss_conf             999558989---999999763210
Q gi|254781016|r  307 KLLFTHKIE---ETIKQFFPEITI  327 (355)
Q Consensus       307 ~il~~~~~~---~~i~~~l~~i~~  327 (355)
                      .-|-.++-.   +++.+.|...++
T Consensus       313 lAlatenf~eI~~~mv~~F~K~G~  336 (355)
T KOG1537         313 LALATENFQEIGEKMVEAFWKVGH  336 (355)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             887437478999999999986184


No 46 
>TIGR00131 gal_kin galactokinase; InterPro: IPR000705 Galactokinase catalyses the first reaction in the galactose metabolism pathway, the ATP-dependent phosphorylation of galactose, yielding galactose-1-phosphate , . Deficiency in this enzyme results in the disease galactosemia, which is responsible for the formation of cataracts in newborn babies, and is possibly responsible for presenile cataracts in adults . In yeast, the GAL3 gene product is required for the GAL4-mediated induction of other enzymes involved in galactose metabolism. The induction of GAL1 production then reinforces this process, increasing the expression of other galactose-inducible genes. GAL3 has been shown to be similar to the GAL1 protein .; GO: 0004335 galactokinase activity, 0005524 ATP binding, 0006012 galactose metabolic process, 0046835 carbohydrate phosphorylation.
Probab=95.00  E-value=0.21  Score=30.17  Aligned_cols=139  Identities=19%  Similarity=0.246  Sum_probs=73.3

Q ss_pred             HHHHHHHCCCCCCCCCEEEE-CCCCEEEEECCCCCCHHHCCCCCC----CEEEEE--CCCCEEEEEEECCCCCCEEEEC-
Q ss_conf             88887403467877637897-488424881167767011757898----434681--2781079999717888579987-
Q gi|254781016|r    8 ILHRYIGECNPKINEKSSAF-LPSNIALCKYWGKRDSKLNLPLNN----SLSLSL--GHLGTITHITVIDSDADCIILN-   79 (355)
Q Consensus         8 ~~~~~~~~~~~~~~~~~ta~-ap~NIALIKYWGK~d~~l~lP~n~----SiS~TL--~~~~T~T~v~~~~~~~d~~~ln-   79 (355)
                      +...|.++-+.+  ...+++ ||==.=||==+==++.--.||+==    -+|.+-  |....-+...+.+.+-|++-|| 
T Consensus         4 ~~~~F~~~~~~~--~~~~~~faPGRVNLIGEHtDYnDg~VlPcAid~~t~~av~~rdd~~~~~~~~n~~na~~~e~slD~   81 (500)
T TIGR00131         4 LQKIFASAFGEK--PDFTARFAPGRVNLIGEHTDYNDGFVLPCAIDFGTLVAVAERDDKNVRVYAANADNAKFDEFSLDL   81 (500)
T ss_pred             HHHHHHHHHCCC--CCEEEEECCCCEEEEEEEEEECCCEECCCHHCCCCEEEEEEECCCCEEEEEECCCCCCCCCEECCC
T ss_conf             889999860889--766999778846221312422685755501054716875430488606886258864431000376


Q ss_pred             ---CEECCCCCH------HHHHHHHHHH-HHHHHC-------CC-EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHH--H
Q ss_conf             ---872566520------6899999974-216761-------94-39999850233211012322479999999999--8
Q gi|254781016|r   80 ---GQKISSQSS------FFKKTTQFCD-LFRQFS-------KV-YFLIETSNNIPTKAGLASSASGFAALTLALFR--I  139 (355)
Q Consensus        80 ---G~~~~~~~~------~~~ri~~~l~-~~r~~~-------~~-~~~I~S~N~fPtaaGLASSASgfAALa~Al~~--~  139 (355)
                         +++....+.      +++-+..++. ++++++       .. .+.|.-.-|+|++|||.||||=-.|.+++..+  +
T Consensus        82 ~~~~~e~~iDPSv~~WaNY~kgv~~~~qS~LKK~AP~R~~~~p~~G~~~v~~GnvP~G~GLSSSAa~~~avgL~v~qA~~  161 (500)
T TIGR00131        82 PLDGSEVAIDPSVSDWANYVKGVVKVAQSYLKKLAPERFNSFPLVGADIVISGNVPTGAGLSSSAALEVAVGLAVLQAQL  161 (500)
T ss_pred             CCCCCCEEECCCHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             32355302277700013544304788888888734444544575534789965778874133899999999999988615


Q ss_pred             HCCCCCHHH
Q ss_conf             188999889
Q gi|254781016|r  140 YSIPEKSES  148 (355)
Q Consensus       140 ~~~~~~~~~  148 (355)
                      +.+.++..+
T Consensus       162 g~~~~~~~~  170 (500)
T TIGR00131       162 GHLPLDSKQ  170 (500)
T ss_pred             CCCHHHHHH
T ss_conf             874024789


No 47 
>COG3890 ERG8 Phosphomevalonate kinase [Lipid metabolism]
Probab=94.48  E-value=0.48  Score=27.71  Aligned_cols=279  Identities=17%  Similarity=0.182  Sum_probs=122.8

Q ss_pred             EEEECCCCEEEEECCCCCCHHHCCCCC-CCEEEEECCCCEEEEEEECCCCCCEEEECCE-ECCCCCHHHHHHHH-HHHHH
Q ss_conf             789748842488116776701175789-8434681278107999971788857998787-25665206899999-97421
Q gi|254781016|r   24 SSAFLPSNIALCKYWGKRDSKLNLPLN-NSLSLSLGHLGTITHITVIDSDADCIILNGQ-KISSQSSFFKKTTQ-FCDLF  100 (355)
Q Consensus        24 ~ta~ap~NIALIKYWGK~d~~l~lP~n-~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~-~~~~~~~~~~ri~~-~l~~~  100 (355)
                      .++.||-|+-|+-   -+ ..+-.-.. --|..+++.+...  |++.  ++|.+.++-. ..-.+.++.+.+.. ++++|
T Consensus         4 ~~fSaPGk~LlaG---dY-s~lv~glsahaia~nkr~~cs~--vrvK--skdswlfhisi~g~~knsfiEl~~~~Vf~yF   75 (337)
T COG3890           4 ISFSAPGKLLLAG---DY-SILVEGLSAHAIAINKRAFCSF--VRVK--SKDSWLFHISIKGIDKNSFIELRSDFVFKYF   75 (337)
T ss_pred             EEECCCCCEEEEC---CC-EEEEECCEEEEEEECCCCCCCE--EEEC--CCCEEEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             4405887369840---31-1355233124787305552013--6742--6745898733013688718999999999998


Q ss_pred             HHHCCC---E-------EEEEEECCCCC---CCHHHHHHHHHHHHH--HHHHHHHCCCCCH-HHHHHHHH---------H
Q ss_conf             676194---3-------99998502332---110123224799999--9999981889998-89998865---------2
Q gi|254781016|r  101 RQFSKV---Y-------FLIETSNNIPT---KAGLASSASGFAALT--LALFRIYSIPEKS-ESLSRVAR---------L  155 (355)
Q Consensus       101 r~~~~~---~-------~~I~S~N~fPt---aaGLASSASgfAALa--~Al~~~~~~~~~~-~~lS~lAR---------l  155 (355)
                      +.....   .       +++...|.||-   -.||+|||+..--|+  +++.-+.+-+.+. .++-+||.         .
T Consensus        76 ~~~~~~c~qnlev~~ddayy~q~~f~~d~g~KtGlGSSAa~~tsLt~~lfls~~~~~nvd~k~eIhklaqiAhc~aQggI  155 (337)
T COG3890          76 AYLSQNCFQNLEVFADDAYYDQSNFFFDDGTKTGLGSSAAVATSLTCGLFLSHANATNVDEKGEIHKLAQIAHCYAQGGI  155 (337)
T ss_pred             HHHHHHCCCCCEEECCHHHCCCCCCEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             75414223332232323210563222147765777624688999999999988605650167899999999889971797


Q ss_pred             CCC-CCHHHHCCCCHH--CCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHH-
Q ss_conf             135-303431056200--2578987654413101566686421589997287667521056798876185689999730-
Q gi|254781016|r  156 GSG-SACRSFYRGFCE--WICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-  231 (355)
Q Consensus       156 GSG-SA~RSi~GG~v~--W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~-  231 (355)
                      ||| --+-++||+.+.  ...+..++-.+--++    .+-+|.+..    ..++.-++|.||-+-+      +.|-+.. 
T Consensus       156 GSGfDiaaA~fGsiiyrRF~p~li~~l~qig~~----nfg~y~Lmm----Gd~a~gSeTvglV~kv------~~w~ns~~  221 (337)
T COG3890         156 GSGFDIAAAIFGSIIYRRFEPGLIPKLRQIGAV----NFGDYYLMM----GDQAIGSETVGLVCKV------NKWRNSIL  221 (337)
T ss_pred             CCCCHHHHHHHCCEEEEECCCCHHHHHHHHCCC----CCCCEEEEE----CCCCCCCCCHHHHHHH------HHHHHCCC
T ss_conf             764035676623157863483100345763750----306765662----2323685534899999------87763378


Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHH-------HHCCCEEEEEECCCC
Q ss_conf             5509999999980999999999999999899987038995686578899999999997-------428961999977798
Q gi|254781016|r  232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-------RQQSIPIYFTLDAGP  304 (355)
Q Consensus       232 ~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~-------R~~g~~v~fT~DAGP  304 (355)
                      ++.++...+ ...+=++ |.++.-.|+++--+..+.   ++.|.+.+...+++-+.+-       -..|..+.-.=.||-
T Consensus       222 peelkc~de-~nsrvl~-l~~~sLdE~~s~~~~irr---slrritee~~adiep~kqt~~Ld~i~~l~gvl~~lipgaGg  296 (337)
T COG3890         222 PEELKCNDE-MNSRVLN-LIKLSLDESNSKSKAIRR---SLRRITEEGLADIEPIKQTAALDSIFDLLGVLCDLIPGAGG  296 (337)
T ss_pred             HHHHHHHHH-HHHHHHH-HHHHHHHHHHHHHHHHHH---HHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             588776788-8899998-886208889999999999---99999997523333411355400677602754750246788


Q ss_pred             --EEEEEECHHHHHHHHH--HHHHCCCCCCC
Q ss_conf             --1799955898999999--97632100368
Q gi|254781016|r  305 --NLKLLFTHKIEETIKQ--FFPEITIIDPL  331 (355)
Q Consensus       305 --Nv~il~~~~~~~~i~~--~l~~i~~~~~~  331 (355)
                        ..++|+.+.  -++++  ...-+.++...
T Consensus       297 gdaif~l~~~~--~e~re~w~~~gi~i~dv~  325 (337)
T COG3890         297 GDAIFLLYRPN--IEAREAWLSKGISIVDVN  325 (337)
T ss_pred             CCEEEEEECCC--HHHHHHHHHCCEEEEECC
T ss_conf             75379984562--898887875780799714


No 48 
>TIGR00144 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phosphate synthase family; InterPro: IPR004422   This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis . In some species, two members of this family are found. It is unclear whether both act as beta-RFAP synthase. This family is related to the GHMP kinases (Galactokinase, Homoserine kinase, Mevalonate kinase, Phosphomevalonate kinase). Members are found so far only in the Archaea and in Methylobacterium extorquens.They have an amino-terminal domain probably related to ATP binding..
Probab=91.56  E-value=1.3  Score=24.76  Aligned_cols=280  Identities=15%  Similarity=0.118  Sum_probs=157.6

Q ss_pred             CCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCC--CCCEEEECCEECC-CCCHHHHHHHHHHHHHHHHCC-
Q ss_conf             842488116776701175789843468127810799997178--8857998787256-652068999999742167619-
Q gi|254781016|r   30 SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKIS-SQSSFFKKTTQFCDLFRQFSK-  105 (355)
Q Consensus        30 ~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~--~~d~~~lnG~~~~-~~~~~~~ri~~~l~~~r~~~~-  105 (355)
                      ..+.||-.-|...     -....+.++|+.-.........++  -+..-.+-++..+ .......|+.....+..+..+ 
T Consensus         9 ~~~~l~dl~g~~g-----~~dgg~g~~l~~p~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~   83 (337)
T TIGR00144         9 LHLTLIDLNGSIG-----RVDGGVGLALEEPELEIGGKESDDLGVEFDKKLVGKLGEPYNKSVRDRVYEAAAKTLDYIGG   83 (337)
T ss_pred             EEEEEEECCCCCC-----CCCCCCCEEECCCCEEEECCCCCCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             0345552166422-----22455210112653144023333333101135565411045677888889989999987267


Q ss_pred             -CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCC---HHHHCCCCHHCCCCCC---CC
Q ss_conf             -4399998502332110123224799999999998188999889998865213530---3431056200257898---76
Q gi|254781016|r  106 -VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSA---CRSFYRGFCEWICGTD---QN  178 (355)
Q Consensus       106 -~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~lS~lARlGSGSA---~RSi~GG~v~W~~g~~---~~  178 (355)
                       ..+.+.....||...||+|...--.|....+.+++++++...++..+.-+|.-|+   +---+|||+.=.....   .+
T Consensus        84 d~~~~~~~~~~~~~~~glg~g~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~gg~~g~g~~~~~~gg~~~d~g~~~g~g~~  163 (337)
T TIGR00144        84 DEGFDLEVLSLFPAHSGLGSGTQLSLAVGRLVSELYGLELTARELAEIVGRGGTSGIGVAAFEDGGFLVDGGHSTGKGKE  163 (337)
T ss_pred             CCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCEEEECCCCEEEECCCCCCCCCC
T ss_conf             65511687530320014566512467788888887324310455666532777543301222157526645654466643


Q ss_pred             CCCE------E-EEEC----CCCCC-CCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHH-HHHHHHHHHHHHHHC
Q ss_conf             5441------3-1015----66686-42158999728766752105679887618568999973-055099999999809
Q gi|254781016|r  179 GMDS------F-AVPF----NNQWP-DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQ  245 (355)
Q Consensus       179 ~sds------~-a~~~----~~~~~-dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~-~~~~~~~~~~ai~~~  245 (355)
                      ..+.      - +.|.    ...+| +..+ ++.+.+..+.+..+.......+..|.--.-++. ..--+..+..++.++
T Consensus       164 ~~~~~p~~~~~g~~p~p~~~~~d~p~~w~~-~~~~p~~~~~~~g~~~~~~~~~~cp~pl~~~~~~~~~~l~~~~p~~~~~  242 (337)
T TIGR00144       164 KEDFLPSSASKGAKPAPVIARLDFPEDWNV-ILAIPELDRGVFGKREVNLFQKYCPVPLEDVEKLCHLILMKMLPAVVEG  242 (337)
T ss_pred             CHHCCCCCCCCCCCCCCEEEECCCCCCCCE-EEEEECCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             000255321256776531221257745415-8873132111244113344554258766788999999998765566630


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHH-HHHHCCCEEEEEECCCCEEEEEECHH---HHHHHHHH
Q ss_conf             999999999999998999870389956865788999999999-97428961999977798179995589---89999999
Q gi|254781016|r  246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW-DARQQSIPIYFTLDAGPNLKLLFTHK---IEETIKQF  321 (355)
Q Consensus       246 Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~-~~R~~g~~v~fT~DAGPNv~il~~~~---~~~~i~~~  321 (355)
                      |++.|++...+    +..+-...   .-  ....-.+++.+- .+.+.|.++.-....||.++.+..++   -...+.+.
T Consensus       243 ~~~~~g~~~~~----~~~~g~~~---~~--~~~~~~~~~~~~~~~~~~g~~~~g~~~~gp~~~~~~d~~~~~~~~~~~~~  313 (337)
T TIGR00144       243 DLDDFGEALNK----LQGLGFKK---VE--LELQGPLIKGLIDLLDKDGAPGAGLSSFGPTVYAVTDEKPGGIAGALNDI  313 (337)
T ss_pred             HHHHHHHHHHH----HHHCCCHH---HH--HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             15677788877----76313023---44--55533578888876541475313422247524652254401467778875


Q ss_pred             HHH
Q ss_conf             763
Q gi|254781016|r  322 FPE  324 (355)
Q Consensus       322 l~~  324 (355)
                      +.+
T Consensus       314 ~~~  316 (337)
T TIGR00144       314 FGP  316 (337)
T ss_pred             HHC
T ss_conf             200


No 49 
>TIGR02734 crtI_fam phytoene desaturase; InterPro: IPR014105   Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family are CrtI and are part of flavin containing amine oxidoreductase family. It is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis..
Probab=74.94  E-value=3.2  Score=21.96  Aligned_cols=10  Identities=20%  Similarity=0.514  Sum_probs=3.4

Q ss_pred             HHHHHHHCCC
Q ss_conf             8999870389
Q gi|254781016|r  260 KMHATMIAAS  269 (355)
Q Consensus       260 ~mHa~~~~s~  269 (355)
                      ++|+++..+.
T Consensus       191 SFh~l~~Gg~  200 (526)
T TIGR02734       191 SFHALFVGGN  200 (526)
T ss_pred             CCCCEECCCC
T ss_conf             0563210698


No 50 
>KOG0631 consensus
Probab=73.78  E-value=7.4  Score=19.39  Aligned_cols=61  Identities=28%  Similarity=0.354  Sum_probs=39.6

Q ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHH-CCC--CCHHHHHHH-------HHHCCC--CCHHHHCC
Q ss_conf             43999985023321101232247999999999981-889--998899988-------652135--30343105
Q gi|254781016|r  106 VYFLIETSNNIPTKAGLASSASGFAALTLALFRIY-SIP--EKSESLSRV-------ARLGSG--SACRSFYR  166 (355)
Q Consensus       106 ~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~-~~~--~~~~~lS~l-------ARlGSG--SA~RSi~G  166 (355)
                      ..+.|--.-+.||+.||-|||+=.++.++|..++. |.+  ...+++-.+       .-++||  +-+-|++|
T Consensus       141 vGl~~l~~g~vPtgsgLsSsaa~~c~a~lA~~~~~~gpn~~~~kkd~~~i~~~ae~~~G~~~gGmdq~asvl~  213 (489)
T KOG0631         141 VGLSILNDGSVPTGSGLSSSAAWLCAAALATLKLNLGPNFIISKKDLATITVVAESYIGLNSGGMDQAASVLA  213 (489)
T ss_pred             CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             6538986478789988443589999999999997608873421555405217863126758774788999987


No 51 
>KOG4644 consensus
Probab=72.57  E-value=7.9  Score=19.19  Aligned_cols=217  Identities=18%  Similarity=0.248  Sum_probs=95.7

Q ss_pred             HHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHH-----HHHHHH------HCCC--CCHH
Q ss_conf             97421676194399998502332110123224799999999998188999889-----998865------2135--3034
Q gi|254781016|r   96 FCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES-----LSRVAR------LGSG--SACR  162 (355)
Q Consensus        96 ~l~~~r~~~~~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~~~~~~~-----lS~lAR------lGSG--SA~R  162 (355)
                      .++.+.......|.|.+....||++||+.|+--.+....|+.++.+.....+.     +-.+-|      -|-|  .-|-
T Consensus       680 i~d~~~k~f~~GfeihT~SdLPHGSGLGTSSIlA~TaLaAi~~aagr~~gTeaLiHailHtvlrlEQilTTGGGWQDQ~G  759 (948)
T KOG4644         680 ILDIFEKLFCCGFEIHTSSDLPHGSGLGTSSILACTALAAICAAAGRADGTEALIHAILHTVLRLEQILTTGGGWQDQCG  759 (948)
T ss_pred             HHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCC
T ss_conf             99999997347547303245888777656888989999999986054456367689999999999988623785365305


Q ss_pred             HHCCCCHHCCCC-CCCCCCCEEEEECCCCC-CCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHH-----
Q ss_conf             310562002578-98765441310156668-64215899972876675210567988761856899997305509-----
Q gi|254781016|r  163 SFYRGFCEWICG-TDQNGMDSFAVPFNNQW-PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDL-----  235 (355)
Q Consensus       163 Si~GG~v~W~~g-~~~~~sds~a~~~~~~~-~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~-----  235 (355)
                      .|+.|.-.=... +...+..-..+-+++.+ ..|..-.++|.+++.. --+.-.+. |-.+ || +|......+.     
T Consensus       760 ~im~GIK~gr~rael~~~ie~eeiTipe~f~ekL~dhLLLVYTGKTR-LAkNLLQd-ViRn-~f-ar~~a~~Q~ah~l~~  835 (948)
T KOG4644         760 AIMEGIKKGRCRAELNHGIEHEEITIPEEFREKLEDHLLLVYTGKTR-LAKNLLQD-VIRN-FF-ARCKATKQKAHKLAE  835 (948)
T ss_pred             CHHHHHHHCCCHHHCCCCCEEEEECCCHHHHHHHHHCEEEEEECCHH-HHHHHHHH-HHHH-HH-HHHHHHHHHHHHHHH
T ss_conf             12210120320212567743521017789999976207998727218-89999999-9999-99-766899999999999


Q ss_pred             --HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECC--CCEEEEEEC
Q ss_conf             --9999999809999999999999998999870389956865788999999999974289619999777--981799955
Q gi|254781016|r  236 --AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA--GPNLKLLFT  311 (355)
Q Consensus       236 --~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DA--GPNv~il~~  311 (355)
                        +++-+-++.+-++-+++.-|+-.-+-.-|...+.|+      +-.++++.+..  +.-..+.+-..|  |-=++++..
T Consensus       836 ~tdecAegf~kGsl~LlgecL~~YweqKk~MapgCEPl------~Vr~lldmLap--h~hgesgw~AGAGGGGFiYLl~k  907 (948)
T KOG4644         836 ATDECAEGFEKGSLELLGECLEHYWEQKKFMAPGCEPL------NVRELLDMLAP--HKHGESGWAAGAGGGGFIYLLIK  907 (948)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCC------CHHHHHHHHCC--CCCCCCCHHCCCCCCCEEEEEEC
T ss_conf             99999998862758789999999987651047899997------48999987460--01132120015788737999965


Q ss_pred             H-HHHHHHHHHHHH
Q ss_conf             8-989999999763
Q gi|254781016|r  312 H-KIEETIKQFFPE  324 (355)
Q Consensus       312 ~-~~~~~i~~~l~~  324 (355)
                      + ...+.|..|++.
T Consensus       908 EpqqkeaiEa~Lak  921 (948)
T KOG4644         908 EPQQKEAIEAFLAK  921 (948)
T ss_pred             CCCCHHHHHHHHCC
T ss_conf             88997899986016


No 52 
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.
Probab=56.96  E-value=15  Score=17.20  Aligned_cols=73  Identities=10%  Similarity=0.069  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHHHH--------CCCCCEE-EECHHHHHHHHHHHHHHHCCCEEE-EEECCCCE--------EEEEECHHHH
Q ss_conf             9999998999870--------3899568-657889999999999742896199-99777981--------7999558989
Q gi|254781016|r  254 AEKNALKMHATMI--------AASPPLL-YWQKETIQGMERVWDARQQSIPIY-FTLDAGPN--------LKLLFTHKIE  315 (355)
Q Consensus       254 ~e~dal~mHa~~~--------~s~P~~~-Y~~~~t~~ii~~v~~~R~~g~~v~-fT~DAGPN--------v~il~~~~~~  315 (355)
                      -..++..|+..+.        +...|+. .+.+......+..+.++++|+-|. +.+-+.|.        ++....++|.
T Consensus       259 L~~~~~~~~~~l~~~g~~i~~~~~~~i~~~~~~~~~~a~~~~~~L~~~Gi~v~~~~~Ptvp~~~~~lRi~~sa~ht~edI  338 (349)
T cd06454         259 LQENVRYLRRGLKELGFPVGGSPSHIIPPLIGDDPAKAVAFSDALLERGIYVQAIRYPTVPRGTARLRISLSAAHTKEDI  338 (349)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEEECCCCCHHHH
T ss_conf             99999999999997699757999972799986999999999999988796286379897899983599986877999999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999976321
Q gi|254781016|r  316 ETIKQFFPEIT  326 (355)
Q Consensus       316 ~~i~~~l~~i~  326 (355)
                      +.+.+.|.+++
T Consensus       339 d~li~~l~ev~  349 (349)
T cd06454         339 DRLLEALKEVG  349 (349)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999749


No 53 
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263   Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta-semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue . Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC, IPR005264 from INTERPRO) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Sinorhizobium meliloti protein mosA , which is involved in the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry . Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.   This family represents a subclass of dihydrodipicolinate synthase. ; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process.
Probab=56.23  E-value=16  Score=17.12  Aligned_cols=40  Identities=18%  Similarity=0.293  Sum_probs=35.4

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             0550999999998099999999999999989998703899
Q gi|254781016|r  231 ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP  270 (355)
Q Consensus       231 ~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P  270 (355)
                      +++++.+|.+...++||++.-||=.+=.--|++++..++|
T Consensus       209 ~P~~~~emv~~a~~G~~~~A~EIh~kL~~L~~~LF~etNP  248 (288)
T TIGR00674       209 APKLMKEMVENALEGDFAEAREIHQKLMPLFKALFIETNP  248 (288)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             6899999999985389789999998788898875288898


No 54 
>pfam10673 DUF2487 Protein of unknown function (DUF2487). This is a bacterial family of uncharacterized proteins.
Probab=54.20  E-value=15  Score=17.31  Aligned_cols=46  Identities=15%  Similarity=0.251  Sum_probs=26.3

Q ss_pred             HHHCCCCCEEEECHHHHH-----HHHHHHHHHHCCC-E-EEEEEC-------CCCEEEEEEC
Q ss_conf             870389956865788999-----9999999742896-1-999977-------7981799955
Q gi|254781016|r  264 TMIAASPPLLYWQKETIQ-----GMERVWDARQQSI-P-IYFTLD-------AGPNLKLLFT  311 (355)
Q Consensus       264 ~~~~s~P~~~Y~~~~t~~-----ii~~v~~~R~~g~-~-v~fT~D-------AGPNv~il~~  311 (355)
                      +|+  .|||.|+..+..+     +=++..+++.+|. . +|.|.|       .+-+-.++..
T Consensus        52 v~L--~P~ftY~~~~~~~~~~~rL~~w~~~l~~~Gf~HV~~vTsD~~Wk~~~~~~~~~l~wl  111 (143)
T pfam10673        52 VLL--LPAFTYLASEQKDEAGERLKEWTNALKEEGFRHVFFLTSDSSWKEEEEELEGDLFWL  111 (143)
T ss_pred             EEE--CCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCCCCCEEEEE
T ss_conf             784--278031045666789999999999999759846999955713433114667608995


No 55 
>PRK05912 tyrosyl-tRNA synthetase; Validated
Probab=53.81  E-value=17  Score=16.85  Aligned_cols=63  Identities=17%  Similarity=0.226  Sum_probs=47.8

Q ss_pred             CEEEEEEECCCCCCCCCCHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             21589997287667521056798876185--6899997305509999999980999999999999
Q gi|254781016|r  194 LRIGLLKIIDREKKIGSREAMEITRHHSP--FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       194 l~~~i~iv~~~~K~vsSt~gm~~~v~tSp--~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      +.+.++.-.++.|.-+.|.|--.-...||  ||+-|.....+++.+....+..-+.+++.++.+.
T Consensus       213 lT~PLLt~~dG~K~gsKS~gnaIwLd~sp~~~yq~~~n~~D~dv~~ylklfT~l~~~eI~~l~~~  277 (402)
T PRK05912        213 LTMPLLTGLDGVKKMSKSLGNYIWLDESPYEMYQKWMNIPDALVWRYLELLTFLSLEEIAALEEE  277 (402)
T ss_pred             EEECCEECCCCCCCCCCCCCCCEECCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             98450577876843566799870178998999999963878899999999645999999999997


No 56 
>KOG4520 consensus
Probab=47.92  E-value=19  Score=16.51  Aligned_cols=17  Identities=35%  Similarity=0.481  Sum_probs=14.8

Q ss_pred             HCCCCCHHHHCCCCHHC
Q ss_conf             21353034310562002
Q gi|254781016|r  155 LGSGSACRSFYRGFCEW  171 (355)
Q Consensus       155 lGSGSA~RSi~GG~v~W  171 (355)
                      ||-|+|.||+.++...=
T Consensus       115 LG~Gnas~s~vh~~~~s  131 (238)
T KOG4520         115 LGAGNASRSIVHSTSRS  131 (238)
T ss_pred             HCCCCCCCCHHCCCCCC
T ss_conf             05776530121122103


No 57 
>TIGR01122 ilvE_I branched-chain amino acid aminotransferase; InterPro: IPR005785   Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue. On the basis of sequence similarity, these various enzymes can be grouped  into subfamilies.   One of these, called class-IV, currently consists of proteins of about 270 to 415 amino-acid residues that share a few regions of sequence similarity. Surprisingly, the best conserved region does not include the lysine residue to which the pyridoxal-phosphate group is known to be attached, in ilvE, but is located some 40 residues at the C-terminus side of the PlP-lysine.    Among the class IV aminotransferases are two phylogenetically separable groups of branched-chain amino acid aminotransferase (IlvE) (2.6.1.42 from EC). The last common ancestor of the two lineages appears also to have given rise to a family of D-amino acid aminotransferases (DAAT). This model represents the IlvE family more strongly similar to the DAAT family. ; GO: 0004084 branched-chain-amino-acid transaminase activity, 0009081 branched chain family amino acid metabolic process.
Probab=45.75  E-value=9  Score=18.80  Aligned_cols=25  Identities=24%  Similarity=0.396  Sum_probs=9.6

Q ss_pred             CCCEEEEEECCCCEEEEEECHHHHHHHH
Q ss_conf             8961999977798179995589899999
Q gi|254781016|r  292 QSIPIYFTLDAGPNLKLLFTHKIEETIK  319 (355)
Q Consensus       292 ~g~~v~fT~DAGPNv~il~~~~~~~~i~  319 (355)
                      ||+.||=| |-||-|  |-+++|.+++.
T Consensus        29 EGiRaY~~-~~G~~I--FRl~EH~~RL~   53 (302)
T TIGR01122        29 EGIRAYDT-DKGPAI--FRLKEHVDRLY   53 (302)
T ss_pred             EEEEEECC-CCCCEE--EEHHHHHHHHH
T ss_conf             23887558-998888--83755588885


No 58 
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=43.15  E-value=25  Score=15.74  Aligned_cols=96  Identities=22%  Similarity=0.381  Sum_probs=53.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECC---------C---CEEEEEECHHH
Q ss_conf             99999999999998999870389956865788999999999974289619999777---------9---81799955898
Q gi|254781016|r  247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA---------G---PNLKLLFTHKI  314 (355)
Q Consensus       247 f~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DA---------G---PNv~il~~~~~  314 (355)
                      |-.+|++.       ...+....-|++-+..+    .+.|+.+|+.|.++||= ||         |   +.+.|++-.+.
T Consensus       408 ~GR~Gq~v-------ar~L~~~gi~~vviD~d----~~~V~~~r~~G~~v~yG-Dat~~~vL~~AGi~~A~~vViai~d~  475 (602)
T PRK03659        408 FGRFGQVI-------GRLLMANKMRITVLERD----ISAVNLMRKYGYKVYYG-DATQLELLRAAGAEKAEAIVITCNEP  475 (602)
T ss_pred             CCHHHHHH-------HHHHHHCCCCEEEEECC----HHHHHHHHHCCCEEEEE-CCCCHHHHHHCCCCCCCEEEEEECCH
T ss_conf             87568999-------99999789998999786----79999999789908975-89999999867904058899982989


Q ss_pred             ------HHHHHHHHHHCCCCCCCC----------------CCCCCCCCCCCCCCCHHHHCCC
Q ss_conf             ------999999976321003688----------------8751200000243202320235
Q gi|254781016|r  315 ------EETIKQFFPEITIIDPLD----------------SPDLWSTKDSLSQKNSIELGIS  354 (355)
Q Consensus       315 ------~~~i~~~l~~i~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~  354 (355)
                            .+.+++.+|++.++.-..                -++.+++..++..+-+..+|++
T Consensus       476 ~~~~~iv~~~r~~~P~l~I~aRar~~~~~~~L~~~Ga~~vv~Et~essL~l~~~~L~~lG~~  537 (602)
T PRK03659        476 EDTMKLVELCQQHFPHLHILARARGRVEAHELLQAGVTQFSRETFSSALELGRKTLVSLGMH  537 (602)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999878699699986978999999978999786627899999999999980999


No 59 
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763    This entry represents the well-conserved first N-terminal domain of DnaX, approx. 365 aa. The full-length product of the dnaX gene in Escherichia coli encodes the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the extreme thermophile Thermus thermophilis.; GO: 0003887 DNA-directed DNA polymerase activity, 0005524 ATP binding, 0006260 DNA replication, 0009360 DNA polymerase III complex.
Probab=42.69  E-value=25  Score=15.70  Aligned_cols=102  Identities=20%  Similarity=0.172  Sum_probs=65.1

Q ss_pred             CCCCEEEEEEECCCCCCEEEECCEECCCCCHHHHHHHHHHHHH---HHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2781079999717888579987872566520689999997421---6761943999985023321101232247999999
Q gi|254781016|r   58 GHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLF---RQFSKVYFLIETSNNIPTKAGLASSASGFAALTL  134 (355)
Q Consensus        58 ~~~~T~T~v~~~~~~~d~~~lnG~~~~~~~~~~~ri~~~l~~~---r~~~~~~~~I~S~N~fPtaaGLASSASgfAALa~  134 (355)
                      +.|..+..++ .+..-|.+.+||-..+    -.+-|+..+|.+   +...++|++|--+=|.       =|.++|-||-+
T Consensus        71 n~C~~C~~i~-~g~~~DviEiDAASN~----gVD~IR~l~e~v~y~P~~~kYKvYIIDEVHM-------LS~~AFNALLK  138 (363)
T TIGR02397        71 NECESCKEIN-SGSSLDVIEIDAASNN----GVDDIRELRENVKYAPSKGKYKVYIIDEVHM-------LSKSAFNALLK  138 (363)
T ss_pred             CCCCHHHHHH-CCCCCCEEEECCCCCC----CHHHHHHHHHHHCCCCCCCCCCEEEEECCCC-------CCHHHHHHHHH
T ss_conf             7750227765-2898666886486568----7889999987303687554433588732302-------86568999876


Q ss_pred             HH-----------------------------------------------HHHHCCCCCHHHHHHHHHHCCCCC--HHHHC
Q ss_conf             99-----------------------------------------------998188999889998865213530--34310
Q gi|254781016|r  135 AL-----------------------------------------------FRIYSIPEKSESLSRVARLGSGSA--CRSFY  165 (355)
Q Consensus       135 Al-----------------------------------------------~~~~~~~~~~~~lS~lARlGSGSA--~RSi~  165 (355)
                      .|                                               .+-.+...+.+-|..+||.+.||.  +=|++
T Consensus       139 TLEEPP~hV~FIlATTE~~KiP~TIlSRCQrF~Fk~i~~~~i~~~L~~I~~~E~I~~e~~AL~~IA~~a~GS~RDAlsll  218 (363)
T TIGR02397       139 TLEEPPEHVVFILATTEPHKIPATILSRCQRFDFKRIPLEDIVERLKKILDKEGIKIEDEALELIARAADGSMRDALSLL  218 (363)
T ss_pred             HHCCCCCCEEEEEECCCHHHCCCCCEEECEEECCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             52279876288873487112055402100031267899899999999999870883177899999996289610688999


Q ss_pred             CCCHHC
Q ss_conf             562002
Q gi|254781016|r  166 RGFCEW  171 (355)
Q Consensus       166 GG~v~W  171 (355)
                      --.+..
T Consensus       219 DQ~~~~  224 (363)
T TIGR02397       219 DQAISF  224 (363)
T ss_pred             HHHHHH
T ss_conf             999982


No 60 
>TIGR01219 Pmev_kin_ERG8 phosphomevalonate kinase; InterPro: IPR016005    Phosphomevalonate kinase (2.7.4.2 from EC) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the higher eukaryotic form and the ERG8 type . This model represents plant and fungal forms of the ERG8 type of phosphomevalonate kinase..
Probab=41.68  E-value=19  Score=16.50  Aligned_cols=137  Identities=18%  Similarity=0.280  Sum_probs=75.7

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCC------------CHHH-HHHHHH---------HCCC-CCHHHHCCCC--HHC-
Q ss_conf             211012322479999999999818899------------9889-998865---------2135-3034310562--002-
Q gi|254781016|r  118 TKAGLASSASGFAALTLALFRIYSIPE------------KSES-LSRVAR---------LGSG-SACRSFYRGF--CEW-  171 (355)
Q Consensus       118 taaGLASSASgfAALa~Al~~~~~~~~------------~~~~-lS~lAR---------lGSG-SA~RSi~GG~--v~W-  171 (355)
                      +--||+|||+=.-+|+.||..++....            +..+ +=+||.         .||| --+-..||-.  ++. 
T Consensus       178 ~KTGLGSSAam~T~l~~aL~~~l~~~~~~~~dK~~K~~~S~~~viH~lAQ~aHC~AQGKvGSGFDV~aA~yGS~rYrRF~  257 (499)
T TIGR01219       178 AKTGLGSSAAMVTALVAALLLYLRSVDEDDVDKELKIDDSDKEVIHNLAQVAHCSAQGKVGSGFDVAAAVYGSIRYRRFD  257 (499)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCEEEEECC
T ss_conf             65676314899999999999986542045787343326750455554478888632785346323777643351144468


Q ss_pred             ------CC-CCCCC-CCCEEE----EECCCCCCCCEEE-------EEEECCCCC-CCCCCHHHHHHHHHCHHHHHHHHHH
Q ss_conf             ------57-89876-544131----0156668642158-------999728766-7521056798876185689999730
Q gi|254781016|r  172 ------IC-GTDQN-GMDSFA----VPFNNQWPDLRIG-------LLKIIDREK-KIGSREAMEITRHHSPFFTQWTQQI  231 (355)
Q Consensus       172 ------~~-g~~~~-~sds~a----~~~~~~~~dl~~~-------i~iv~~~~K-~vsSt~gm~~~v~tSp~y~~r~~~~  231 (355)
                            .. ..+.+ +.-.|.    .-+...|.++.+.       .++.=.+.+ --|||-+|-.-|+  ..|..-.+.+
T Consensus       258 P~lis~l~vPyd~~i~~~~~~~~l~~iv~~kw~Ni~~~~f~LP~~~~L~mGd~~sgGSsTp~mV~kVk--~Wq~s~pees  335 (499)
T TIGR01219       258 PELISQLLVPYDVDIKSLTYSEKLAKIVKEKWDNIKVKEFSLPALLTLLMGDVKSGGSSTPKMVKKVK--KWQKSDPEES  335 (499)
T ss_pred             HHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCCCCCEECCCCCHHHHHHCCCCCCCCCCCHHHHHHHH--HHHCCCCHHH
T ss_conf             79996416860131145753789998741235653010045762447550443788867367889997--1301583688


Q ss_pred             HHHHHHHHHHH--HHCCHHHHHHHHHH
Q ss_conf             55099999999--80999999999999
Q gi|254781016|r  232 STDLAHIKQAI--IDQDFIKLGEVAEK  256 (355)
Q Consensus       232 ~~~~~~~~~ai--~~~Df~~l~~i~e~  256 (355)
                      .+.+.++..|-  ....+.+|-++.+.
T Consensus       336 ~~~~~~L~~aN~~l~~~L~~L~~L~~~  362 (499)
T TIGR01219       336 KEIYDDLDDANLRLEDKLSDLDKLAKD  362 (499)
T ss_pred             HHHHHCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             986403666567887313477776520


No 61 
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; InterPro: IPR006234    These sequences represent O-succinylhomoserine sulfhydrylase, one of several related pyridoxal phosphate-dependent enzymes of cysteine and methionine metabolism. This enzyme is part of an alternative pathway of homocysteine biosynthesis, a step in methionine biosynthesis..
Probab=41.68  E-value=19  Score=16.58  Aligned_cols=111  Identities=22%  Similarity=0.217  Sum_probs=47.3

Q ss_pred             EEEEECCCCCCCCEEEEEEECCCCCCC------------CCCHHHHHHHHH---------CHHHHHHHHH--HHHHHHHH
Q ss_conf             131015666864215899972876675------------210567988761---------8568999973--05509999
Q gi|254781016|r  182 SFAVPFNNQWPDLRIGLLKIIDREKKI------------GSREAMEITRHH---------SPFFTQWTQQ--ISTDLAHI  238 (355)
Q Consensus       182 s~a~~~~~~~~dl~~~i~iv~~~~K~v------------sSt~gm~~~v~t---------Sp~y~~r~~~--~~~~~~~~  238 (355)
                      ||+.|+-..-.+|...|+|- ..-|.|            +|.+-|+.-|..         ||| ++|+--  .+---.+|
T Consensus       177 ~f~tP~~qqPL~lGaDvvv~-SATK~IDGqGRvlGGv~~G~~e~~~~~v~~~lr~~GpalSpF-NAW~lLkGlETL~lR~  254 (386)
T TIGR01325       177 VFATPVLQQPLKLGADVVVY-SATKHIDGQGRVLGGVILGSEELMEEFVAKFLRHTGPALSPF-NAWVLLKGLETLSLRV  254 (386)
T ss_pred             HHHHHHHCCCCCCCCEEEEE-CCCEEECCCCCEECCEEECCHHHHHHHHHHHHHCCCCCCCHH-HHHHHHHHHHHHHHHH
T ss_conf             56410013886456407986-462011387540121453607775348999974257432367-8999850345789999


Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHH-CCCEEEEEECCCCE
Q ss_conf             99998099999999999999989998703899568657889999999999742-89619999777981
Q gi|254781016|r  239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-QSIPIYFTLDAGPN  305 (355)
Q Consensus       239 ~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~-~g~~v~fT~DAGPN  305 (355)
                      +.     .++.-..|+  +.++-|--...-  .+-|+=++=  --+.++.... .|+-+.|-+|.|-.
T Consensus       255 ~~-----~~~sAl~lA--~~L~~~p~v~~V--~Y~~lP~HP--q~~lar~Q~~GGG~Vv~f~l~~~ed  311 (386)
T TIGR01325       255 QK-----QADSALALA--EWLEEQPKVQAV--YYPGLPDHP--QHELARRQQSGGGTVVAFDLKGGED  311 (386)
T ss_pred             HH-----HHHHHHHHH--HHHHHCCCEEEE--ECCCCCCCC--CHHHHHHHCCCCCEEEEEECCCCHH
T ss_conf             86-----147899999--999708955798--758787885--2689998418996799973268645


No 62 
>PRK08745 ribulose-phosphate 3-epimerase; Provisional
Probab=39.50  E-value=28  Score=15.37  Aligned_cols=74  Identities=11%  Similarity=0.197  Sum_probs=43.7

Q ss_pred             HHHHCCCCCEEE--ECHHHHHHHHHHHHHHH-CCCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             987038995686--57889999999999742-896199997779817999558989999999763210036888751200
Q gi|254781016|r  263 ATMIAASPPLLY--WQKETIQGMERVWDARQ-QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST  339 (355)
Q Consensus       263 a~~~~s~P~~~Y--~~~~t~~ii~~v~~~R~-~g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~~~~~~~~~~~~~  339 (355)
                      -+.|+..|+|--  +.|.+++=|+.+++++. .+..+-.-.|.|=|.         +.+.+...        .|.|.++.
T Consensus       136 VliMtV~PGf~GQ~f~~~~l~KI~~l~~~~~~~~~~~~I~VDGGI~~---------~ti~~l~~--------aGad~~V~  198 (223)
T PRK08745        136 VLVMSVNPGFGGQAFIPSALDKLRAIRKKIDALGKPIRLEIDGGVKA---------DNIGAIAA--------AGADTFVA  198 (223)
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCH---------HHHHHHHH--------CCCCEEEE
T ss_conf             99987569988754568899999999999986499945999788798---------99999998--------69999997


Q ss_pred             CCCCCCCCHHHHCC
Q ss_conf             00024320232023
Q gi|254781016|r  340 KDSLSQKNSIELGI  353 (355)
Q Consensus       340 ~~~~~~~~~~~~~~  353 (355)
                      +.-+....+....|
T Consensus       199 GSaiF~~~d~~~~i  212 (223)
T PRK08745        199 GSAIFNAPDYAQVI  212 (223)
T ss_pred             CHHHHCCCCHHHHH
T ss_conf             41775799999999


No 63 
>PRK08883 ribulose-phosphate 3-epimerase; Provisional
Probab=39.45  E-value=28  Score=15.36  Aligned_cols=42  Identities=14%  Similarity=0.188  Sum_probs=29.8

Q ss_pred             HHHCCCCCEEEE--CHHHHHHHHHHHHHHHC-CCEEEEEECCCCE
Q ss_conf             870389956865--78899999999997428-9619999777981
Q gi|254781016|r  264 TMIAASPPLLYW--QKETIQGMERVWDARQQ-SIPIYFTLDAGPN  305 (355)
Q Consensus       264 ~~~~s~P~~~Y~--~~~t~~ii~~v~~~R~~-g~~v~fT~DAGPN  305 (355)
                      +.|+..|+|--.  .|.+++-|+.+++++.+ +..+-.-.|.|=|
T Consensus       133 LvMtV~PGf~GQ~f~~~~l~Ki~~l~~~~~~~~~~~~I~VDGGI~  177 (220)
T PRK08883        133 LLMSVNPGFGGQSFIPHTLDKLRAVRKMIDASGRDIRLEIDGGVK  177 (220)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             998745898875455779999999999887449980799989878


No 64 
>pfam12017 Transposase_37 Transposase protein. Protein in this family are transposases found in insects. This region is about 230 amino acids in length and is found associated with pfam05485.
Probab=37.97  E-value=8.5  Score=18.98  Aligned_cols=45  Identities=9%  Similarity=0.183  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHHC-CCEEEEEECCCCEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             8899999999997428-96199997779817999558989999999763210
Q gi|254781016|r  277 KETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITI  327 (355)
Q Consensus       277 ~~t~~ii~~v~~~R~~-g~~v~fT~DAGPNv~il~~~~~~~~i~~~l~~i~~  327 (355)
                      |.+....-.|+-+++. .-|+||.||..      ...+....|...+.+++.
T Consensus       165 pa~~vqv~mvrGl~~~WKQPI~y~f~t~------m~~~~L~~II~kL~~iG~  210 (236)
T pfam12017       165 PSNYVQLAIVRGLKKSWKQPVFFDFNTR------MDADTLNNIIRKLHKRGY  210 (236)
T ss_pred             CCCEEEEEEHHHHHHCCCCCEEEEECCC------CCHHHHHHHHHHHHHCCC
T ss_conf             6655653002776506667579983687------899999999999998798


No 65 
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed
Probab=37.51  E-value=27  Score=15.42  Aligned_cols=25  Identities=16%  Similarity=0.395  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             0550999999998099999999999
Q gi|254781016|r  231 ISTDLAHIKQAIIDQDFIKLGEVAE  255 (355)
Q Consensus       231 ~~~~~~~~~~ai~~~Df~~l~~i~e  255 (355)
                      ...++..+.++|++.|.+.+.++..
T Consensus       884 ~gk~~~~v~~~i~~~~~~~i~~~~~  908 (1042)
T PRK06039        884 LGKDVKAVIKAIKSGDWEEIADLLK  908 (1042)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             6488999999998089999999996


No 66 
>PRK05581 ribulose-phosphate 3-epimerase; Validated
Probab=37.15  E-value=30  Score=15.12  Aligned_cols=44  Identities=16%  Similarity=0.307  Sum_probs=32.1

Q ss_pred             HHHHCCCCCEEE--ECHHHHHHHHHHHHHHHC-CCEEEEEECCCCEE
Q ss_conf             987038995686--578899999999997428-96199997779817
Q gi|254781016|r  263 ATMIAASPPLLY--WQKETIQGMERVWDARQQ-SIPIYFTLDAGPNL  306 (355)
Q Consensus       263 a~~~~s~P~~~Y--~~~~t~~ii~~v~~~R~~-g~~v~fT~DAGPNv  306 (355)
                      -+.|+..|+|.-  +.|.+++=++.+++++.+ +..+-.-.|.|=|-
T Consensus       135 VlvMtV~PGf~GQ~f~~~~l~ki~~l~~~~~~~~~~~~I~VDGGIn~  181 (220)
T PRK05581        135 VLLMSVNPGFGGQKFIPEVLEKIREVRKLIDERGLDILIEVDGGVNA  181 (220)
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH
T ss_conf             58998658878764556699999999999984599755999789898


No 67 
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=36.91  E-value=30  Score=15.09  Aligned_cols=86  Identities=14%  Similarity=0.300  Sum_probs=46.8

Q ss_pred             HHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECC---------C---CEEEEEECHHH------HHHHHHHHHHC
Q ss_conf             870389956865788999999999974289619999777---------9---81799955898------99999997632
Q gi|254781016|r  264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA---------G---PNLKLLFTHKI------EETIKQFFPEI  325 (355)
Q Consensus       264 ~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DA---------G---PNv~il~~~~~------~~~i~~~l~~i  325 (355)
                      .+....-|++-+..+    -+.|+..|+.|.++||= ||         |   +.+.|++-.+.      .+.+++.+|++
T Consensus       417 ~L~~~gi~~vviD~d----~~~V~~~r~~G~~v~yG-Dat~~~vL~~AGi~~Ar~vViaidd~~~~~~iv~~~r~~~P~l  491 (615)
T PRK03562        417 LLLSSGVKMVVLDHD----PDHIETLRKFGMKVFYG-DATRMDLLESAGAAKAEVLINAIDDPQTNLQLTELVKEHFPHL  491 (615)
T ss_pred             HHHHCCCCEEEEECC----HHHHHHHHHCCCEEEEE-CCCCHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             999789987999799----99999999679908976-8999999986791406889999498999999999999758998


Q ss_pred             CCCCCCCC----------------CCCCCCCCCCCCCCHHHHCCC
Q ss_conf             10036888----------------751200000243202320235
Q gi|254781016|r  326 TIIDPLDS----------------PDLWSTKDSLSQKNSIELGIS  354 (355)
Q Consensus       326 ~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~  354 (355)
                      .++.-...                ++.++...++..+-+..+|++
T Consensus       492 ~IiaRard~~~~~~L~~~Ga~~vv~Et~essL~l~~~~L~~lG~~  536 (615)
T PRK03562        492 QIIARARDVDHYIRLRQAGVEKPERETFEGALKSGRLALESLGLG  536 (615)
T ss_pred             EEEEEECCHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHCCCC
T ss_conf             699983977889999978999896665899999999999980999


No 68 
>KOG4743 consensus
Probab=35.66  E-value=12  Score=17.85  Aligned_cols=11  Identities=36%  Similarity=0.785  Sum_probs=6.7

Q ss_pred             CCCHHHHCCCC
Q ss_conf             53034310562
Q gi|254781016|r  158 GSACRSFYRGF  168 (355)
Q Consensus       158 GSA~RSi~GG~  168 (355)
                      -||||++||.-
T Consensus        16 ~sAcR~LFGpv   26 (195)
T KOG4743          16 SSACRCLFGPV   26 (195)
T ss_pred             CHHHHHHCCCC
T ss_conf             05778744899


No 69 
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional
Probab=34.47  E-value=29  Score=15.21  Aligned_cols=42  Identities=21%  Similarity=0.185  Sum_probs=24.0

Q ss_pred             HHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEE
Q ss_conf             8703899568657889999999999742896199997779817
Q gi|254781016|r  264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL  306 (355)
Q Consensus       264 ~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv  306 (355)
                      +.|+..|+|-- ++---.++++|+++|+.....-.-.|.|=|.
T Consensus       140 LlMsV~PGf~G-Q~Fi~~~l~KI~~lr~~~~~~~I~VDGGIn~  181 (224)
T PTZ00170        140 LVMTVEPGFGG-QSFMHDMMPKVRQLRQRYPHLNIQVDGGINP  181 (224)
T ss_pred             EEEEECCCCCC-CCCCHHHHHHHHHHHHCCCCCEEEEECCCCH
T ss_conf             99855699876-2145889999999985489975999589998


No 70 
>PRK12864 YciI-like protein; Reviewed
Probab=33.33  E-value=35  Score=14.71  Aligned_cols=43  Identities=23%  Similarity=0.269  Sum_probs=29.2

Q ss_pred             HHHHHHHHHCCCEEE-EEECCCCEEEEEECHHHHHHHHHHHHHC
Q ss_conf             999999742896199-9977798179995589899999997632
Q gi|254781016|r  283 MERVWDARQQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEI  325 (355)
Q Consensus       283 i~~v~~~R~~g~~v~-fT~DAGPNv~il~~~~~~~~i~~~l~~i  325 (355)
                      +..++.+.++|..+. --...++.+.+++.-++.+.+++++.+-
T Consensus        26 la~l~~l~~~G~lv~aGP~~~~~g~~~I~~a~s~e~v~~~~~~D   69 (89)
T PRK12864         26 LDRLANLKEQGILITLGPTKDSTYVFGIFEAEDEETVRQLIEED   69 (89)
T ss_pred             HHHHHHHHHCCCEEEECCCCCCCCEEEEEEECCHHHHHHHHHCC
T ss_conf             99999998779789847899987669999809999999998649


No 71 
>TIGR01239 galT_2 galactose-1-phosphate uridylyltransferase; InterPro: IPR000766   Galactose-1-phosphate uridyl transferase 2.7.7.12 from EC (galT) catalyzes the transfer of an uridyldiphosphate group on galactose (or glucose) 1-phosphate. During the reaction, the uridyl moiety links to a histidine residue. In the Escherichia coli enzyme, it has been shown  that two histidine residues separated by a single proline residue are essential for enzyme activity.   On the basis of sequence similarities, two apparently unrelated families seem to exist. Class-I enzymes are found in eukaryotes as well as some bacteria such as E. coli or Streptomyces lividans, while class-II enzymes have been found so far only in bacteria such as Bacillus subtilis or Lactobacillus helveticus .; GO: 0008108 UDP-glucose:hexose-1-phosphate uridylyltransferase activity, 0006012 galactose metabolic process, 0005737 cytoplasm.
Probab=33.05  E-value=20  Score=16.36  Aligned_cols=52  Identities=13%  Similarity=0.278  Sum_probs=36.3

Q ss_pred             EECC---CCCCEEEECCE--ECCCCCHHHHHHHHHHHHHHHH-----CCCEE---EEEEECCCCC
Q ss_conf             9717---88857998787--2566520689999997421676-----19439---9998502332
Q gi|254781016|r   67 TVID---SDADCIILNGQ--KISSQSSFFKKTTQFCDLFRQF-----SKVYF---LIETSNNIPT  118 (355)
Q Consensus        67 ~~~~---~~~d~~~lnG~--~~~~~~~~~~ri~~~l~~~r~~-----~~~~~---~I~S~N~fPt  118 (355)
                      .|+|   -.++.++|+|+  ++.+..+-|.|..+|++.|+.+     +++++   -|=|.|+|-+
T Consensus       209 QfSPYaYF~EHSI~L~~~HePM~I~k~tF~~LL~fl~~FP~Yf~GSNADLPIVGGsILsHdHYQ~  273 (502)
T TIGR01239       209 QFSPYAYFPEHSIVLKGKHEPMEISKKTFERLLSFLEKFPHYFIGSNADLPIVGGSILSHDHYQG  273 (502)
T ss_pred             CCCCCCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             35872324602331026889853284768889989752587502145666655772156344468


No 72 
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and   subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. 2-aminophenol 1,6-dioxygenase is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, the enzyme has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=32.77  E-value=34  Score=14.77  Aligned_cols=48  Identities=19%  Similarity=0.218  Sum_probs=35.7

Q ss_pred             CHHHHHHHHHHHHHH-------HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             856899997305509-------999999980999999999999999899987038
Q gi|254781016|r  221 SPFFTQWTQQISTDL-------AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA  268 (355)
Q Consensus       221 Sp~y~~r~~~~~~~~-------~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s  268 (355)
                      -|-...|+...++.+       .+=++|+.++||..+.-+--+--++||=.|++-
T Consensus        16 ~p~~~e~~~~dp~av~e~y~Lt~~E~~AL~eg~~gaL~~iGVhp~l~MHy~m~~n   70 (81)
T cd07922          16 DPGLIERFQDDPSAVFEEYGLTPAERAALREGTFGALTSIGVHPILQMHYLMYTN   70 (81)
T ss_pred             CHHHHHHHHHCHHHHHHHCCCCHHHHHHHHCCCHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             9888999874989987752899899999863886467736736999999999819


No 73 
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism]
Probab=32.60  E-value=35  Score=14.63  Aligned_cols=19  Identities=16%  Similarity=-0.067  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             0123224799999999998
Q gi|254781016|r  121 GLASSASGFAALTLALFRI  139 (355)
Q Consensus       121 GLASSASgfAALa~Al~~~  139 (355)
                      .++..+|-...||..+.+-
T Consensus       185 vI~~tps~~l~lae~~~~~  203 (438)
T COG1541         185 VIAATPSYLLYLAEEAEEE  203 (438)
T ss_pred             EEEECHHHHHHHHHHHHHC
T ss_conf             9997869999999999974


No 74 
>PRK13193 pyrrolidone-carboxylate peptidase; Provisional
Probab=32.33  E-value=25  Score=15.67  Aligned_cols=33  Identities=24%  Similarity=0.197  Sum_probs=24.4

Q ss_pred             EEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEE
Q ss_conf             86578899999999997428961999977798179
Q gi|254781016|r  273 LYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLK  307 (355)
Q Consensus       273 ~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~  307 (355)
                      -|+  .|+-+-..++.+|+.|+++..+-|||--|+
T Consensus       110 ay~--stLPi~~i~~~l~~~Gipa~vS~~AGtyvC  142 (201)
T PRK13193        110 GIF--TNIPVEDLVDLLNENGIPAELSLSAGSYLC  142 (201)
T ss_pred             CCC--CCCCHHHHHHHHHHCCCCEEEECCCCCCHH
T ss_conf             144--578999999999867998799588653141


No 75 
>KOG3282 consensus
Probab=32.02  E-value=36  Score=14.57  Aligned_cols=39  Identities=18%  Similarity=0.151  Sum_probs=33.0

Q ss_pred             CCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECCCCE
Q ss_conf             389956865788999999999974289619999777981
Q gi|254781016|r  267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN  305 (355)
Q Consensus       267 ~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPN  305 (355)
                      ...|-+..--+.+.+++....+-++.|.+.|++.|||-+
T Consensus       122 ~GQ~KIvvk~~~e~~l~~l~~~A~~~gl~t~~i~DAGrT  160 (190)
T KOG3282         122 CGQAKIVVKAESEEELMELQKDAKKLGLYTHLIQDAGRT  160 (190)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             699349997188899999999998769858999718842


No 76 
>TIGR03266 methan_mark_1 putative methanogenesis marker protein 1. Members of this protein family represent a distinct clade among the larger set of proteins that belong to families TIGR00702 and pfam02624. Proteins from this clade are found in genome sequence if and only if the species sequenced is one of the methanogens. All methanogens belong to the archaea; some but not all of those sequenced are hyperthermophiles. This protein family was detected by the method of partial phylogenetic profiling (see Haft, et al., 2006).
Probab=31.97  E-value=36  Score=14.56  Aligned_cols=16  Identities=38%  Similarity=0.455  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999899
Q gi|254781016|r  247 FIKLGEVAEKNALKMH  262 (355)
Q Consensus       247 f~~l~~i~e~dal~mH  262 (355)
                      +..|.|++|+|+..+-
T Consensus       167 l~GL~EvIERDA~~l~  182 (376)
T TIGR03266       167 FHGLLEVIERDAWSLA  182 (376)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999998999


No 77 
>TIGR03604 docking_ocin bacteriocin biosynthesis docking scaffold, SagD family. prokaryotic systems for making a general class of heterocycle-containing bacteriocins.
Probab=31.94  E-value=36  Score=14.56  Aligned_cols=27  Identities=22%  Similarity=0.210  Sum_probs=21.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             233211012322479999999999818
Q gi|254781016|r  115 NIPTKAGLASSASGFAALTLALFRIYS  141 (355)
Q Consensus       115 ~fPtaaGLASSASgfAALa~Al~~~~~  141 (355)
                      ...++.|||+-.+---|+.-++.++..
T Consensus       109 ~~~~SnGlAaG~t~~eA~~~gL~EviE  135 (377)
T TIGR03604       109 VPSTSTGLAAGETLEEAILNGLLEVIE  135 (377)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             246787168889999999999999999


No 78 
>PRK00068 hypothetical protein; Validated
Probab=31.82  E-value=37  Score=14.55  Aligned_cols=33  Identities=15%  Similarity=0.192  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             899997305509999999980999999999999
Q gi|254781016|r  224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       224 y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      ..+-++++.+.+.++.+|++++||.++|+..++
T Consensus       934 ~~~~l~~A~~a~~~a~~Alk~GDw~~yG~a~~~  966 (978)
T PRK00068        934 KAAALKEAQDAYNKAIEAQKNGDFAEYGEALQR  966 (978)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999999999999999998875999999999999


No 79 
>pfam04788 DUF620 Protein of unknown function (DUF620). Family of uncharacterized proteins.
Probab=31.60  E-value=9.8  Score=18.54  Aligned_cols=63  Identities=16%  Similarity=0.330  Sum_probs=36.9

Q ss_pred             CCCHHHHCCCCHHCCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHH-HH
Q ss_conf             53034310562002578987654413101566686421589997287667521056798876185689999730550-99
Q gi|254781016|r  158 GSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LA  236 (355)
Q Consensus       158 GSA~RSi~GG~v~W~~g~~~~~sds~a~~~~~~~~dl~~~i~iv~~~~K~vsSt~gm~~~v~tSp~y~~r~~~~~~~-~~  236 (355)
                      +....+--||||+|++.+             +.|    .+=++| .+.|-+.-++| +....++|....-...-+.+ +.
T Consensus        24 ~~~~~~e~GgFVlWQ~~P-------------d~W----~~ELvv-~G~KV~AGsdG-kv~WR~tpw~~~hAakGp~RPLR   84 (242)
T pfam04788        24 GGGGGGESGGFVLWQMNP-------------DMW----LVELVV-GGTKVSAGSDG-KVAWRHTPWLGAHAAKGPPRPLR   84 (242)
T ss_pred             CCCCCCCCCCEEEEEECC-------------CEE----EEEEEE-CCEEEEECCCC-EEEEECCCCCCCCCCCCCCCCHH
T ss_conf             888765445479998677-------------758----999985-22278644787-05631286543510248996267


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781016|r  237 HIK  239 (355)
Q Consensus       237 ~~~  239 (355)
                      +..
T Consensus        85 R~l   87 (242)
T pfam04788        85 RAL   87 (242)
T ss_pred             HHH
T ss_conf             886


No 80 
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5.1.3.1 from EC) (also known as pentose-5-phosphate 3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In Alcaligenes eutrophus two copies of the gene coding for PPE are known , one is chromosomally encoded P40117 from SWISSPROT, the other one is on a plasmid Q04539 from SWISSPROT. PPE has been found in a wide range of bacteria, archaebacteria, fungi and plants. All the proteins have from 209 to 241 amino acid residues. The enzyme has a TIM barrel structure.; GO: 0004750 ribulose-phosphate 3-epimerase activity, 0005975 carbohydrate metabolic process.
Probab=31.60  E-value=37  Score=14.52  Aligned_cols=144  Identities=13%  Similarity=0.123  Sum_probs=86.6

Q ss_pred             CCCCEEEEEEECCCCCC-CCCCHHHHHHHHHCHHHHHHHHHH-----------HHHHHHHHHHHHHCCHH----------
Q ss_conf             86421589997287667-521056798876185689999730-----------55099999999809999----------
Q gi|254781016|r  191 WPDLRIGLLKIIDREKK-IGSREAMEITRHHSPFFTQWTQQI-----------STDLAHIKQAIIDQDFI----------  248 (355)
Q Consensus       191 ~~dl~~~i~iv~~~~K~-vsSt~gm~~~v~tSp~y~~r~~~~-----------~~~~~~~~~ai~~~Df~----------  248 (355)
                      -|++.+...|+..=+|- ..=.--=|++++.-..|=..+.++           ..++.++.+-||+--.+          
T Consensus        39 VPNlT~Gp~v~~~~r~~g~~~P~DVHLMv~~pd~~~~~Fa~aGA~~I~vH~Ea~~h~~R~l~~Ik~~G~~AG~v~NP~TP  118 (216)
T TIGR01163        39 VPNLTFGPPVLEALRKYGTKLPIDVHLMVENPDRYIEDFAEAGADIITVHAEATEHIHRLLQLIKELGAKAGIVLNPATP  118 (216)
T ss_pred             CCCCCCCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             77100277899988740795212663035785777889997089989984377626799999999718970688679999


Q ss_pred             --HHHHHHHHHHHHHHHHHHCCCCCEEEEC--HHHHHHHHHHHHHHH--C-CCEEEEEECCCCEEEEEECHHHHHHHHHH
Q ss_conf             --9999999999989998703899568657--889999999999742--8-96199997779817999558989999999
Q gi|254781016|r  249 --KLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQ--Q-SIPIYFTLDAGPNLKLLFTHKIEETIKQF  321 (355)
Q Consensus       249 --~l~~i~e~dal~mHa~~~~s~P~~~Y~~--~~t~~ii~~v~~~R~--~-g~~v~fT~DAGPNv~il~~~~~~~~i~~~  321 (355)
                        .+-.+-+.   .=-=+.|+-+|+|-=.+  |.|++=|+.+|++.+  + +..+.--.|.|=|.      +....+.  
T Consensus       119 l~~~~~~L~~---~D~VLlMSVnPGFgGQkFIP~~~~Kir~~R~~id~~~~~~~~~ieVDGGv~~------~ni~~~~--  187 (216)
T TIGR01163       119 LEALEYVLED---VDLVLLMSVNPGFGGQKFIPETLEKIRELRKMIDKLELGLSILIEVDGGVNE------DNIAEVA--  187 (216)
T ss_pred             HHHHHHHHHH---CCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCH------HHHHHHH--
T ss_conf             8789989876---2989988760799884110578999999999998602799558997179897------6799999--


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCC--HHHHCCC
Q ss_conf             76321003688875120000024320--2320235
Q gi|254781016|r  322 FPEITIIDPLDSPDLWSTKDSLSQKN--SIELGIS  354 (355)
Q Consensus       322 l~~i~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~  354 (355)
                               .+|-|.++.+.=...+.  +++..|.
T Consensus       188 ---------~AGAD~~VaGSaiF~~~s~d~~~~i~  213 (216)
T TIGR01163       188 ---------EAGADILVAGSAIFGADSLDYKEAIR  213 (216)
T ss_pred             ---------HCCCCEEEEEEEEECCCCCCHHHHHH
T ss_conf             ---------75898999831020888668799997


No 81 
>pfam07014 Hs1pro-1_C Hs1pro-1 protein C-terminus. This family represents the C-terminus (approximately 270 residues) of a number of plant Hs1pro-1 proteins, which are believed to confer nematode resistance.
Probab=31.28  E-value=37  Score=14.49  Aligned_cols=54  Identities=20%  Similarity=0.290  Sum_probs=39.1

Q ss_pred             CHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH---HH------HHHHHHHHH
Q ss_conf             05679887618568999973055099999999809999999999---99------999899987
Q gi|254781016|r  211 REAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA---EK------NALKMHATM  265 (355)
Q Consensus       211 t~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~---e~------dal~mHa~~  265 (355)
                      .+.+-. -.++...+.|+..+..-+.++.+.|..+||++.+.-+   |+      +-..||-+|
T Consensus        47 ~En~tl-~t~hQIlEsWi~~a~~LL~ri~~ri~~~~~ekAa~dC~~vERiWKLL~~ieDlhllM  109 (261)
T pfam07014        47 YENQTL-YTIHQILESWIYASSKLLTRISERIEERKFEKAASDCWLLERIWKLLADIEDLHLLM  109 (261)
T ss_pred             CCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             230079-999999999999999999999999862556777656889999999999888998615


No 82 
>TIGR02683 upstrm_HI1419 probable addiction module killer protein; InterPro: IPR014056   Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family IPR001387 from INTERPRO. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module..
Probab=31.15  E-value=23  Score=15.93  Aligned_cols=69  Identities=20%  Similarity=0.277  Sum_probs=38.3

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHH---CCC
Q ss_conf             76185689999730550999999998099999999999999989998703899568657889999999999742---896
Q gi|254781016|r  218 RHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSI  294 (355)
Q Consensus       218 v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~---~g~  294 (355)
                      +++.+.|..|++...+......  |.    ..+..+..=|       +           -+..-|=+=|.|||-   -|.
T Consensus         3 ~~~t~~F~~Wl~~LKD~~Aka~--I~----~Ri~Rl~~Gn-------~-----------GD~KpVG~GV~ElRId~GpGY   58 (95)
T TIGR02683         3 IKRTDTFDKWLDGLKDPRAKAR--IA----ARIDRLALGN-------F-----------GDVKPVGEGVSELRIDYGPGY   58 (95)
T ss_pred             CCCCHHHHHHHHHCCCHHHHHH--HH----HHHHHHHHCC-------C-----------CCEEECCCCEEEEEECCCCCE
T ss_conf             5653247898773168889999--99----9999997388-------9-----------980033478035432269964


Q ss_pred             EEEEEECCCCEEEEEE
Q ss_conf             1999977798179995
Q gi|254781016|r  295 PIYFTLDAGPNLKLLF  310 (355)
Q Consensus       295 ~v~fT~DAGPNv~il~  310 (355)
                      .|||+..-+-=|.|||
T Consensus        59 RvYf~~~G~~~ilLLc   74 (95)
T TIGR02683        59 RVYFTQRGKVIILLLC   74 (95)
T ss_pred             EEEEEEECCEEEEEEC
T ss_conf             6887644888899851


No 83 
>pfam01522 Polysacc_deac_1 Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyses glucosidic bonds in xylan.
Probab=31.09  E-value=37  Score=14.46  Aligned_cols=15  Identities=20%  Similarity=0.401  Sum_probs=8.4

Q ss_pred             CCEEEECHHHHHHHH
Q ss_conf             956865788999999
Q gi|254781016|r  270 PPLLYWQKETIQGME  284 (355)
Q Consensus       270 P~~~Y~~~~t~~ii~  284 (355)
                      ||+-.+++.++++++
T Consensus       102 ~P~G~~~~~~~~~~~  116 (123)
T pfam01522       102 PPYGSYNDDTLAIAK  116 (123)
T ss_pred             CCCCCCCHHHHHHHH
T ss_conf             998787999999999


No 84 
>PRK06606 branched-chain amino acid aminotransferase; Validated
Probab=30.75  E-value=30  Score=15.13  Aligned_cols=42  Identities=17%  Similarity=0.169  Sum_probs=20.0

Q ss_pred             CCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             885799878725665206899999974216761943999985023
Q gi|254781016|r   72 DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNI  116 (355)
Q Consensus        72 ~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~~~I~S~N~f  116 (355)
                      ..--+|+||+..+.++.   +|.-+=+-+.--.+.+=.++..|+-
T Consensus         5 ~~~~v~~NG~~v~~~~a---~Isv~Drg~~yGdgvFEtir~y~~~   46 (306)
T PRK06606          5 RAGYIWFNGELVPWEDA---KVHVLTHALHYGTGVFEGIRAYDTP   46 (306)
T ss_pred             CCCEEEECCEEEEHHHC---EECHHHHHHHHEEEEEEEEEEEECC
T ss_conf             68769999999686887---4070021455432767647999868


No 85 
>pfam06434 Aconitase_2_N Aconitate hydratase 2 N-terminus. This family represents the N-terminal region of several bacterial Aconitate hydratase 2 proteins and is found in conjunction with pfam00330.
Probab=30.67  E-value=32  Score=14.91  Aligned_cols=22  Identities=32%  Similarity=0.554  Sum_probs=13.2

Q ss_pred             HCCCCCHHHHCCCCHHCCCCCCC
Q ss_conf             21353034310562002578987
Q gi|254781016|r  155 LGSGSACRSFYRGFCEWICGTDQ  177 (355)
Q Consensus       155 lGSGSA~RSi~GG~v~W~~g~~~  177 (355)
                      .|-||.-.|-..-. +|+.|.+.
T Consensus        63 vGtGSSRkSa~Nsv-LW~~g~di   84 (204)
T pfam06434        63 VGTGSSRKSATNSV-LWHIGEDI   84 (204)
T ss_pred             CCCCCCCCCCEEEE-EEECCCCC
T ss_conf             25675642110025-65156888


No 86 
>KOG3262 consensus
Probab=30.64  E-value=38  Score=14.41  Aligned_cols=68  Identities=12%  Similarity=0.095  Sum_probs=36.8

Q ss_pred             HHHHHCCCCCCCCCEEE------ECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCCCCCEEEECCE
Q ss_conf             88740346787763789------7488424881167767011757898434681278107999971788857998787
Q gi|254781016|r   10 HRYIGECNPKINEKSSA------FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ   81 (355)
Q Consensus        10 ~~~~~~~~~~~~~~~ta------~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~~~d~~~lnG~   81 (355)
                      -+|+-.|-..++-+.++      -||+-.+=-+--||-||.+--+-....|+.+++---.|    +-.+.|+||++..
T Consensus        57 g~flh~Cegd~Vck~~~~kIPyfNAPIylenk~qIGKVDEIfG~i~d~~fsIK~~dgv~as----sfk~g~k~fi~p~  130 (215)
T KOG3262          57 GKFLHMCEGDLVCKLTNKKIPYFNAPIYLENKEQIGKVDEIFGPINDVHFSIKPSDGVQAS----SFKPGDKLFIDPD  130 (215)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCEEECCHHHHCCHHHHCCCCCCCEEEEECCCCCEEE----CCCCCCEEEECCC
T ss_conf             3455433775587503566777888512116302131665306633117988537882651----1467885775602


No 87 
>KOG0616 consensus
Probab=30.05  E-value=35  Score=14.67  Aligned_cols=85  Identities=21%  Similarity=0.314  Sum_probs=46.3

Q ss_pred             EEEECCCC-CCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             99972876-67521056798876185689999730550999999998099999999999999989998703899568657
Q gi|254781016|r  198 LLKIIDRE-KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ  276 (355)
Q Consensus       198 i~iv~~~~-K~vsSt~gm~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~  276 (355)
                      |-++|.+- |+|+-+ -+-.|- |-.|...       .+...+..-+.-||+.||-++-.        |+...|||.-++
T Consensus       183 iKitDFGFAK~v~~r-T~TlCG-TPeYLAP-------Eii~sk~ynkavDWWalGVLIYE--------MlaG~pPF~~~~  245 (355)
T KOG0616         183 IKITDFGFAKRVSGR-TWTLCG-TPEYLAP-------EIIQSKGYNKAVDWWALGVLIYE--------MLAGYPPFYDDN  245 (355)
T ss_pred             EEEEECCCEEEECCC-EEEECC-CCCCCCH-------HHHHCCCCCCCHHHHHHHHHHHH--------HHCCCCCCCCCC
T ss_conf             788743634885686-787428-8100372-------66505888850258888899999--------972799876787


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             88999999999974289619999777
Q gi|254781016|r  277 KETIQGMERVWDARQQSIPIYFTLDA  302 (355)
Q Consensus       277 ~~t~~ii~~v~~~R~~g~~v~fT~DA  302 (355)
                      +  +++-+.|-+-+- ..|-||+.||
T Consensus       246 ~--~~iY~KI~~~~v-~fP~~fs~~~  268 (355)
T KOG0616         246 P--IQIYEKILEGKV-KFPSYFSSDA  268 (355)
T ss_pred             H--HHHHHHHHHCCC-CCCCCCCHHH
T ss_conf             6--899999981776-6886568789


No 88 
>PRK13354 tyrosyl-tRNA synthetase; Provisional
Probab=29.34  E-value=40  Score=14.26  Aligned_cols=62  Identities=21%  Similarity=0.337  Sum_probs=47.2

Q ss_pred             EEEEEEECCCCCCCCCCHHHHHHHHHCH--HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             1589997287667521056798876185--6899997305509999999980999999999999
Q gi|254781016|r  195 RIGLLKIIDREKKIGSREAMEITRHHSP--FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       195 ~~~i~iv~~~~K~vsSt~gm~~~v~tSp--~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      .+.++.-.++.+|.+-|.|--.-...||  ||+-|.....+++.+....+..-+.+++.++.+.
T Consensus       218 T~PLL~~~dG~~KmgKS~gnaIwLd~sp~~~yq~~~n~~D~~v~~yl~l~T~l~~eeI~~l~~~  281 (405)
T PRK13354        218 TMPLLEGLDGTEKMSKSLGNYIGLDESPNEFYQKWMSIPDRDIVKYLELATDLHPEEIDEIAAQ  281 (405)
T ss_pred             EECCEECCCCCCCCCCCCCCCEECCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             6061578877553250127863147988999999972655889999999666999999999998


No 89 
>PRK13195 pyrrolidone-carboxylate peptidase; Provisional
Probab=28.50  E-value=32  Score=14.98  Aligned_cols=24  Identities=21%  Similarity=0.237  Sum_probs=12.4

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCEE
Q ss_conf             999999742896199997779817
Q gi|254781016|r  283 MERVWDARQQSIPIYFTLDAGPNL  306 (355)
Q Consensus       283 i~~v~~~R~~g~~v~fT~DAGPNv  306 (355)
                      -..++.+|+.|+|+..+.+||.=|
T Consensus       122 k~iv~~l~~~GIPa~vS~tAGTyV  145 (222)
T PRK13195        122 RAMVLAMRKAGVPADVSDAAGTFV  145 (222)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCH
T ss_conf             999999997799726844764004


No 90 
>pfam11159 DUF2939 Protein of unknown function (DUF2939). This bacterial family of proteins has no known function.
Probab=26.14  E-value=45  Score=13.89  Aligned_cols=33  Identities=33%  Similarity=0.426  Sum_probs=23.6

Q ss_pred             HHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             618568999973055099999999809999999999999998
Q gi|254781016|r  219 HHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK  260 (355)
Q Consensus       219 ~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~dal~  260 (355)
                      -.|||+         -+-.+++|+.++|-.++.+.++-.+++
T Consensus        10 ~asPy~---------al~~l~~Ai~~~D~~~l~~~VDfpalR   42 (95)
T pfam11159        10 AASPYL---------ALYQLKQAARANDAAALSEYVDFPALR   42 (95)
T ss_pred             HHHHHH---------HHHHHHHHHHHCCHHHHHHHCCCHHHH
T ss_conf             987999---------999999999964899999877829999


No 91 
>PRK08005 ribulose-phosphate 3-epimerase; Validated
Probab=25.87  E-value=38  Score=14.43  Aligned_cols=21  Identities=5%  Similarity=0.074  Sum_probs=10.2

Q ss_pred             CCCCCCCCCCCCCCCHHHHCC
Q ss_conf             875120000024320232023
Q gi|254781016|r  333 SPDLWSTKDSLSQKNSIELGI  353 (355)
Q Consensus       333 ~~~~~~~~~~~~~~~~~~~~~  353 (355)
                      |.|..+.+.-+...+++...|
T Consensus       184 Gad~~V~GSaiF~~~d~~~~i  204 (210)
T PRK08005        184 GAQHLVIGRALFTTANYDVTL  204 (210)
T ss_pred             CCCEEEECHHHHCCCCHHHHH
T ss_conf             999999790653699999999


No 92 
>COG4012 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.71  E-value=43  Score=14.04  Aligned_cols=19  Identities=5%  Similarity=0.055  Sum_probs=10.3

Q ss_pred             CCCEEEEEECCCCEEEEEEC
Q ss_conf             89619999777981799955
Q gi|254781016|r  292 QSIPIYFTLDAGPNLKLLFT  311 (355)
Q Consensus       292 ~g~~v~fT~DAGPNv~il~~  311 (355)
                      +|.-.++.+|-+ -++-++.
T Consensus       236 ngHttaalvded-RI~gv~E  254 (342)
T COG4012         236 NGHTTAALVDED-RIVGVYE  254 (342)
T ss_pred             CCCEEEEEECCC-EEEEEEE
T ss_conf             872578885177-1798732


No 93 
>cd01576 AcnB_Swivel Aconitase B swivel domain. Aconitate hydratase B is involved in energy metabolism as part of the TCA cycle. It catalyses the formation of cis-aconitate from citrate. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The domain structure of Aconitase B is different from other Aconitases in that he swivel domain that is found at N-terminus of B family is normally found at C-terminus for other Aconitases. In most members of the family, there is also a HEAT domain before domain 4, which is believed to play a role in protein-protein interaction.
Probab=25.53  E-value=46  Score=13.81  Aligned_cols=32  Identities=9%  Similarity=0.269  Sum_probs=18.8

Q ss_pred             HHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             8999870389956865788999999999974289619999
Q gi|254781016|r  260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT  299 (355)
Q Consensus       260 ~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT  299 (355)
                      -|||.+|-..+     .+   ..+..+.+++.+|.++.|-
T Consensus        25 pLHa~aMlk~~-----~~---~~~~~i~~lk~~g~~~~~v   56 (131)
T cd01576          25 PLHALAMLKNK-----RE---GEIVAIAQLKPKGHPVAYV   56 (131)
T ss_pred             HHHHHHHHCCC-----CC---CHHHHHHHHHHCCCEEEEE
T ss_conf             45899862054-----34---1789999996649838998


No 94 
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed
Probab=25.09  E-value=17  Score=16.86  Aligned_cols=21  Identities=5%  Similarity=0.134  Sum_probs=12.0

Q ss_pred             CHHHHHHHHHHHHHCCCCCCC
Q ss_conf             589899999997632100368
Q gi|254781016|r  311 THKIEETIKQFFPEITIIDPL  331 (355)
Q Consensus       311 ~~~~~~~i~~~l~~i~~~~~~  331 (355)
                      .++....|++.+++..+..|.
T Consensus       197 ~p~~~~~ir~~~p~~~~LiPG  217 (277)
T PRK00125        197 FPPELAAVRKIVGDMPLLIPG  217 (277)
T ss_pred             CHHHHHHHHHHCCCCEEEECC
T ss_conf             647789999867997598256


No 95 
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase; InterPro: IPR005771   Uridine 5'-triphosphate:glucose-1-phosphate uridylyltransferase (uridine diphosphoglucose pyrophosphorylase, 2.7.7.9 from EC) is responsible for the synthesis of UDP-glucose, a key compound in the biosynthesis of polysaccharides. Glucose is fermented through the glycolysis step to pyruvate, which in turn is converted to lactate. The glycolytic intermediate glucose 6-phosphate is converted to glucose 1-phosphate by phosphoglucomutase activity, and this metabolite is subsequently converted to UDP-glucose by UDP-glucose pyrophosphorylase (GalU) activity. ; GO: 0003983 UTP:glucose-1-phosphate uridylyltransferase activity, 0006011 UDP-glucose metabolic process.
Probab=24.15  E-value=31  Score=15.06  Aligned_cols=37  Identities=16%  Similarity=0.315  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHCCC---EEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9997421676194---39999850233211012322479999999999818
Q gi|254781016|r   94 TQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS  141 (355)
Q Consensus        94 ~~~l~~~r~~~~~---~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~  141 (355)
                      .+.|+.+|+....   .++||=.+    ..||+=       .++|...+-|
T Consensus        81 ~~lL~~v~~I~~~~~~i~yvRQke----~kGLGh-------AvL~a~~~vG  120 (270)
T TIGR01099        81 EELLKEVRKISNLNANIFYVRQKE----QKGLGH-------AVLCARPLVG  120 (270)
T ss_pred             HHHHHHHHHHCCCCCCEEEEECCC----CCCCCH-------HHHHCCCCCC
T ss_conf             889999998626997289981388----885512-------7543521258


No 96 
>COG3345 GalA Alpha-galactosidase [Carbohydrate transport and metabolism]
Probab=23.71  E-value=32  Score=14.97  Aligned_cols=57  Identities=18%  Similarity=0.219  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCE-------EE---EEECHH----HHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             8999999999974289619999777981-------79---995589----899999997632100368887512000
Q gi|254781016|r  278 ETIQGMERVWDARQQSIPIYFTLDAGPN-------LK---LLFTHK----IEETIKQFFPEITIIDPLDSPDLWSTK  340 (355)
Q Consensus       278 ~t~~ii~~v~~~R~~g~~v~fT~DAGPN-------v~---il~~~~----~~~~i~~~l~~i~~~~~~~~~~~~~~~  340 (355)
                      .--++++.+++..+-|+..| -+|-|=-       -.   =++..+    -.|.+.+.+.+.+.     -+++|.-+
T Consensus       307 t~e~ile~vk~akk~gvE~F-vlDDGwfg~rndd~~slGDWlv~seKfPsgiE~li~~I~e~Gl-----~fGIWleP  377 (687)
T COG3345         307 TEEEILENVKEAKKFGVELF-VLDDGWFGGRNDDLKSLGDWLVNSEKFPSGIEELIEAIAENGL-----IFGIWLEP  377 (687)
T ss_pred             CHHHHHHHHHHHHHCCEEEE-EECCCCCCCCCCCHHHHHCEECCHHHCCCCHHHHHHHHHHCCC-----CCCEEECC
T ss_conf             89999999998863682799-9735001566763123321143364355208999999997287-----64055062


No 97 
>COG3603 Uncharacterized conserved protein [Function unknown]
Probab=23.46  E-value=51  Score=13.55  Aligned_cols=42  Identities=17%  Similarity=0.077  Sum_probs=33.4

Q ss_pred             HHHHHHHCCCEEEE--EECCCCEEEEEECHHHHHHHHHHHHHCCCCC
Q ss_conf             99997428961999--9777981799955898999999976321003
Q gi|254781016|r  285 RVWDARQQSIPIYF--TLDAGPNLKLLFTHKIEETIKQFFPEITIID  329 (355)
Q Consensus       285 ~v~~~R~~g~~v~f--T~DAGPNv~il~~~~~~~~i~~~l~~i~~~~  329 (355)
                      -++-++.+|+++|.  |+|+-   |||..++++++-.+.|.+.+.-+
T Consensus        83 V~~pLsd~gigIFavStydtD---hiLVr~~dLekAv~~L~eaGhev  126 (128)
T COG3603          83 VSQPLSDNGIGIFAVSTYDTD---HILVREEDLEKAVKALEEAGHEV  126 (128)
T ss_pred             HHHHHHHCCCCEEEEEECCCC---EEEEEHHHHHHHHHHHHHCCCCC
T ss_conf             544576579527999712574---69983455999999999708711


No 98 
>pfam12187 VirArc_Nuclease Viral/Archaeal nuclease. This family of proteins is found in archaea and viruses. Proteins in this family are typically between 211 and 244 amino acids in length. These proteins are nucleases from fusseloviruses and sulfolobus archaea.
Probab=22.26  E-value=31  Score=15.08  Aligned_cols=34  Identities=12%  Similarity=0.093  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHH--HCCC--EEEEEECCCCEEEEEE
Q ss_conf             88999999999974--2896--1999977798179995
Q gi|254781016|r  277 KETIQGMERVWDAR--QQSI--PIYFTLDAGPNLKLLF  310 (355)
Q Consensus       277 ~~t~~ii~~v~~~R--~~g~--~v~fT~DAGPNv~il~  310 (355)
                      ++-+.+|...+-++  ++|.  +--|-.||+.--.++-
T Consensus       141 EdKlk~i~alqilnLekqgkik~d~fE~~aks~yylIP  178 (190)
T pfam12187       141 EDKLKCISALQILNLEKQGKIKKDEFERDAKSRYYIIP  178 (190)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCEEEEEE
T ss_conf             67665658888753664386111023236766079968


No 99 
>PRK13194 pyrrolidone-carboxylate peptidase; Provisional
Probab=22.21  E-value=43  Score=14.05  Aligned_cols=33  Identities=30%  Similarity=0.440  Sum_probs=20.7

Q ss_pred             EEECHHHHHHHHHHHHHHHCCCEEEEEECCCCEEE
Q ss_conf             86578899999999997428961999977798179
Q gi|254781016|r  273 LYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLK  307 (355)
Q Consensus       273 ~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DAGPNv~  307 (355)
                      -|++  |+-+-..+..+|+.|+++-.+.|||--|+
T Consensus       110 ay~s--tlP~~~i~~~l~~~gipa~vS~~AGtyvC  142 (204)
T PRK13194        110 AYFA--TIPTREIVEEMKENGIPAVLSYTAGTYLC  142 (204)
T ss_pred             CCCC--CCCHHHHHHHHHHCCCCEEEECCCCCCHH
T ss_conf             0017--89999999999976998178478752163


No 100
>PRK12514 RNA polymerase sigma factor; Provisional
Probab=22.16  E-value=54  Score=13.38  Aligned_cols=29  Identities=10%  Similarity=0.130  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             09999999980999999999999999899
Q gi|254781016|r  234 DLAHIKQAIIDQDFIKLGEVAEKNALKMH  262 (355)
Q Consensus       234 ~~~~~~~ai~~~Df~~l~~i~e~dal~mH  262 (355)
                      +...++..+++||-+.|.++.+.-.-.+.
T Consensus         5 d~~~Li~~~~~GD~~Af~~L~~~y~~~l~   33 (179)
T PRK12514          5 DIEKLIVRVSLGDRDAFSSLYDATSAKLF   33 (179)
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             09999999996589999999999999999


No 101
>pfam11101 DUF2884 Protein of unknown function (DUF2884). Some members in this bacterial family of proteins are annotated as YggN which currently has no known function.
Probab=21.76  E-value=55  Score=13.32  Aligned_cols=82  Identities=20%  Similarity=0.260  Sum_probs=49.3

Q ss_pred             CCCEEEECCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHH--HHHHHHHHHHCCCCCHHHH
Q ss_conf             88579987872566520689999997421676194399998502332110123224799--9999999981889998899
Q gi|254781016|r   72 DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA--ALTLALFRIYSIPEKSESL  149 (355)
Q Consensus        72 ~~d~~~lnG~~~~~~~~~~~ri~~~l~~~r~~~~~~~~I~S~N~fPtaaGLASSASgfA--ALa~Al~~~~~~~~~~~~l  149 (355)
                      +...+++||+.+.....-..++..|-+-+|.            -.|-...+|+.+...|  ||-..+..+.|-+.....+
T Consensus        30 ~~g~L~v~G~~v~L~~~Q~q~l~~Y~~~lr~------------~lP~~~~~A~~~l~~a~~ald~V~~~~~g~~~~~~~l   97 (229)
T pfam11101        30 EDGQLFVDGKWVTLSADQQQALEQYSDGLRA------------QLPEVAALASEGVELANDALDEVATGLLGSSAVRAKL   97 (229)
T ss_pred             CCCCEEECCEECCCCHHHHHHHHHHHHHHHH------------HCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             9996789998677999999999999999999------------7868999999999999999999999870887788899


Q ss_pred             HHHHHHCCCCCHHHHC
Q ss_conf             9886521353034310
Q gi|254781016|r  150 SRVARLGSGSACRSFY  165 (355)
Q Consensus       150 S~lARlGSGSA~RSi~  165 (355)
                      ..+=..-....-+++|
T Consensus        98 ~~l~~~l~~~v~~~~~  113 (229)
T pfam11101        98 TTLMDQLKARVDDSFY  113 (229)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999998971


No 102
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=21.43  E-value=52  Score=13.50  Aligned_cols=23  Identities=22%  Similarity=0.199  Sum_probs=18.9

Q ss_pred             CHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             78899999999997428961999
Q gi|254781016|r  276 QKETIQGMERVWDARQQSIPIYF  298 (355)
Q Consensus       276 ~~~t~~ii~~v~~~R~~g~~v~f  298 (355)
                      -=+|+.+|.++..+|++|..+-|
T Consensus        28 GLDSiR~M~L~~~wR~~G~~i~F   50 (74)
T COG3433          28 GLDSIRMMALLERWRKRGADIDF   50 (74)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCH
T ss_conf             42599999999999980776649


No 103
>PRK13728 conjugal transfer protein TrbB; Provisional
Probab=21.36  E-value=55  Score=13.30  Aligned_cols=14  Identities=21%  Similarity=0.598  Sum_probs=6.9

Q ss_pred             CCEEE-EEECCCCEE
Q ss_conf             96199-997779817
Q gi|254781016|r  293 SIPIY-FTLDAGPNL  306 (355)
Q Consensus       293 g~~v~-fT~DAGPNv  306 (355)
                      |++|| ||+|.|+..
T Consensus        99 gi~V~~~SlDG~g~~  113 (181)
T PRK13728         99 GFSVFPYTLDGQGDT  113 (181)
T ss_pred             CCEEEEEEECCCCCC
T ss_conf             971799853698887


No 104
>PRK10456 arginine succinyltransferase; Provisional
Probab=21.26  E-value=56  Score=13.25  Aligned_cols=78  Identities=15%  Similarity=0.247  Sum_probs=47.8

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEE-EECHHHHHHHHHHH--------HHHHCCC--EEEE-EECCCCEEEEE
Q ss_conf             98099999999999999989998703899568-65788999999999--------9742896--1999-97779817999
Q gi|254781016|r  242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLL-YWQKETIQGMERVW--------DARQQSI--PIYF-TLDAGPNLKLL  309 (355)
Q Consensus       242 i~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~-Y~~~~t~~ii~~v~--------~~R~~g~--~v~f-T~DAGPNv~il  309 (355)
                      .-+-||.+.-.++-.....+.|-+|-..|=++ .+.++-.++|-.++        -+.+||.  .-|. -|||||.+  =
T Consensus       183 FF~mdF~~AD~lsg~~~k~FIaeLmP~~PiYv~lLp~~Aq~vIG~vH~~t~pA~~lLe~EGF~~~gyVDIFDaGP~l--e  260 (344)
T PRK10456        183 FFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSEEAQAVIGQVHPQTAPARAVLEKEGFRYRNYIDIFDGGPTL--E  260 (344)
T ss_pred             HCCCCHHHHHHHHCCCCCEEHHHHCCCCCEEHHCCCHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCCEECCCCCCEE--E
T ss_conf             05998678678861577500887689986321049999999839969677999999997489768955444788458--9


Q ss_pred             ECHHHHHHHHHH
Q ss_conf             558989999999
Q gi|254781016|r  310 FTHKIEETIKQF  321 (355)
Q Consensus       310 ~~~~~~~~i~~~  321 (355)
                      |.-++...|++.
T Consensus       261 a~~~~IrtVr~S  272 (344)
T PRK10456        261 CDIDRVRAIRKS  272 (344)
T ss_pred             EEHHHHHHHHHC
T ss_conf             882221533528


No 105
>pfam07765 KIP1 KIP1-like protein. This is a family of sequences found exclusively in plants. They are similar to kinase interacting protein 1 (KIP1), which has been found to interact with the kinase domain of PRK1, a receptor-like kinase. This particular region contains two coiled-coils, which are described as motifs involved in protein-protein interactions. It has also been suggested that the protein's coiled- coils allow it to dimerize in vivo.
Probab=20.70  E-value=57  Score=13.18  Aligned_cols=41  Identities=17%  Similarity=0.259  Sum_probs=29.2

Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             988761856899997305509999999980999999999999
Q gi|254781016|r  215 EITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK  256 (355)
Q Consensus       215 ~~~v~tSp~y~~r~~~~~~~~~~~~~ai~~~Df~~l~~i~e~  256 (355)
                      |.+-+.||..+.=+...+.+++.|...|.+ |=+.|++-+|-
T Consensus         7 H~~~~~SkWL~~nL~dmd~kvk~mlklI~e-dgdSfakrAem   47 (74)
T pfam07765         7 HISPKNSKWLEENLQEMDSKVKEMLKLIEE-DADSFAKRAEM   47 (74)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-CCCCHHHHHHH
T ss_conf             899767889998999999999999999874-05418999999


No 106
>PRK13196 pyrrolidone-carboxylate peptidase; Provisional
Probab=20.69  E-value=53  Score=13.41  Aligned_cols=21  Identities=19%  Similarity=0.129  Sum_probs=9.6

Q ss_pred             HHHHHHCCCEEEEEECCCCEE
Q ss_conf             999742896199997779817
Q gi|254781016|r  286 VWDARQQSIPIYFTLDAGPNL  306 (355)
Q Consensus       286 v~~~R~~g~~v~fT~DAGPNv  306 (355)
                      ++.+|+.|+|+..+-|||-=|
T Consensus       125 v~~l~~~giPa~vS~sAGtyv  145 (212)
T PRK13196        125 LAAWHEAEIPGDISNSAGLYV  145 (212)
T ss_pred             HHHHHHCCCCEEEECCCCCCH
T ss_conf             999998599857857875206


No 107
>PRK08091 ribulose-phosphate 3-epimerase; Validated
Probab=20.62  E-value=57  Score=13.17  Aligned_cols=44  Identities=5%  Similarity=-0.008  Sum_probs=28.9

Q ss_pred             HHHHCCCCCEEEE--CHHHHHHHHHHHHHHHC-CCEEEEEECCCCEE
Q ss_conf             9870389956865--78899999999997428-96199997779817
Q gi|254781016|r  263 ATMIAASPPLLYW--QKETIQGMERVWDARQQ-SIPIYFTLDAGPNL  306 (355)
Q Consensus       263 a~~~~s~P~~~Y~--~~~t~~ii~~v~~~R~~-g~~v~fT~DAGPNv  306 (355)
                      -+.|+..|+|-..  .+.+++=|+.+++++.+ +...-.-.|.|=|.
T Consensus       151 VLvMtV~PGfgGQ~fi~~~l~KI~~l~~~~~~~~~~~~I~VDGGI~~  197 (235)
T PRK08091        151 IQLLTLDPRYGSKMRSSDLHERVAQLLCLLGDKREGKLIVIDGSMTQ  197 (235)
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCH
T ss_conf             99987668988886787899999999999996499915998489898


Done!