HHsearch alignment for GI: 254781016 and conserved domain: pfam08544

>pfam08544 GHMP_kinases_C GHMP kinases C terminal. This family includes homoserine kinases, galactokinases and mevalonate kinases.
Probab=96.44  E-value=0.021  Score=37.19  Aligned_cols=75  Identities=23%  Similarity=0.177  Sum_probs=53.9

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCEEEEEECC--CCEEEEEE-CHHHH
Q ss_conf             9999809999999999999998999870389956865788999999999974289619999777--98179995-58989
Q gi|254781016|r  239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA--GPNLKLLF-THKIE  315 (355)
Q Consensus       239 ~~ai~~~Df~~l~~i~e~dal~mHa~~~~s~P~~~Y~~~~t~~ii~~v~~~R~~g~~v~fT~DA--GPNv~il~-~~~~~  315 (355)
T Consensus         2 ~~~l~~~d~~~~~~~~~~~~~~---------~~~~~~~~~i~~~~---~~~~~~G~~~a~~sGsg~G~~v~~l~~~~~~a   69 (82)
T pfam08544         2 LEALREGDLELLGELLNENALL---------LYLGILSPELDELL---EELRELGALGAKLSGSGGGPTVFALFKDEEDA   69 (82)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHC---------CHHHCCCHHHHHHH---HHHHHCCCCEEECCCCCCCCEEEEEECCHHHH
T ss_conf             3788818999999999999864---------05505778899999---99998599855412589888588885898999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999997632
Q gi|254781016|r  316 ETIKQFFPEI  325 (355)
Q Consensus       316 ~~i~~~l~~i  325 (355)
T Consensus        70 ~~i~~~l~~~   79 (82)
T pfam08544        70 EEVAEALREA   79 (82)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999987