BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781016|ref|YP_003065429.1| diphosphomevalonate
decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781016|ref|YP_003065429.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040693|gb|ACT57489.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 355

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL
Sbjct: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA
Sbjct: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM
Sbjct: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ
Sbjct: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL
Sbjct: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
Sbjct: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355


>gi|315122513|ref|YP_004063002.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495915|gb|ADR52514.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 351

 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/347 (79%), Positives = 307/347 (88%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           M LSLRHIL  Y+G+C+P+IN+K SAFLPSNIALCKYWGKRD KLNLPLNNSLSLSLG L
Sbjct: 1   MPLSLRHILRIYLGKCSPQINKKGSAFLPSNIALCKYWGKRDEKLNLPLNNSLSLSLGRL 60

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GT+T ITVI+++ DCIILNGQK+S QS FFKKTTQFCDLFRQF KVYFLIET NNIPTKA
Sbjct: 61  GTLTEITVINANEDCIILNGQKVSPQSDFFKKTTQFCDLFRQFEKVYFLIETFNNIPTKA 120

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAALTLALFR+YS+PE  E+LSRVARLGSGSACRSFYRGFCEWICGTD NG+
Sbjct: 121 GLASSASGFAALTLALFRLYSLPEHIETLSRVARLGSGSACRSFYRGFCEWICGTDPNGI 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DSFA+P  NQWPDLRIGLL II+ EKKIGSREAMEITRH SPFFTQW QQI  D AHIKQ
Sbjct: 181 DSFAIPLKNQWPDLRIGLLNIIETEKKIGSREAMEITRHSSPFFTQWNQQIPVDFAHIKQ 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI+DQDFIKLGEV+E NALKMHATM+ ASP +LYWQ+ETI+GM+RVW+ARQ+SIPIYFTL
Sbjct: 241 AIVDQDFIKLGEVSENNALKMHATMLTASPSILYWQEETIKGMQRVWNARQKSIPIYFTL 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
           DAGPNLK LFTH  EE I++ FPEI +I+PLDSP+L S KD     N
Sbjct: 301 DAGPNLKFLFTHDKEEIIRENFPEIMVINPLDSPNLQSNKDDFQLGN 347


>gi|89094695|ref|ZP_01167631.1| diphosphomevalonate decarboxylase [Oceanospirillum sp. MED92]
 gi|89081041|gb|EAR60277.1| diphosphomevalonate decarboxylase [Oceanospirillum sp. MED92]
          Length = 334

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 160/329 (48%), Positives = 216/329 (65%), Gaps = 1/329 (0%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           MS++ + +++  + E   ++   + AF PSNIALCKYWGKR+++LNLP+N SLS+SLG L
Sbjct: 1   MSITKQSVVNSILTEST-QLGTAAEAFAPSNIALCKYWGKREAELNLPINGSLSISLGEL 59

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           G+ T I   DS +D + LN + I     F  K   F +LFR+  +   +I+T NNIPT A
Sbjct: 60  GSRTSIVESDSGSDQVYLNDKLIEPTDRFATKVISFLNLFRRELQQPVVIKTVNNIPTAA 119

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAAL LA+   Y     +E LS  AR+GSGSA RS ++GF EW  G  ++GM
Sbjct: 120 GLASSASGFAALMLAINDFYRFGLGNEVLSAFARMGSGSASRSVFQGFVEWQKGLREDGM 179

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DS A   + +W   RIGLLK+    KK+ SR  M+ T   +P +  W +Q + DL  IK+
Sbjct: 180 DSCAQRLDLEWQGFRIGLLKVATGAKKVDSRAGMQRTVESAPLYQAWPEQAAKDLQTIKR 239

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI D+D   LG+ AE+NAL MHATMI + PPLLYWQ E++  M RVW+ R   +P+Y T+
Sbjct: 240 AIEDKDIELLGQTAEQNALSMHATMIGSWPPLLYWQPESVAAMHRVWELRALGVPVYLTM 299

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIID 329
           DAGPNLKLLFT + E  ++  FPE+T +D
Sbjct: 300 DAGPNLKLLFTAEYEAQVRDAFPELTDLD 328


>gi|212212910|ref|YP_002303846.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuG_Q212]
 gi|212011320|gb|ACJ18701.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuG_Q212]
          Length = 503

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 209/350 (59%), Gaps = 3/350 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G    
Sbjct: 3   KQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATAA 62

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLASS
Sbjct: 63  ISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A 
Sbjct: 122 ACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYAE 181

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  +
Sbjct: 182 PLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAKK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGPN
Sbjct: 242 DFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGPN 301

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           +KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 302 IKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|154707588|ref|YP_001424026.1| diphosphomevalonate decarboxylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165918973|ref|ZP_02219059.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 334]
 gi|154356874|gb|ABS78336.1| diphosphomevalonate decarboxylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165917298|gb|EDR35902.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 334]
          Length = 503

 Score =  291 bits (746), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 209/350 (59%), Gaps = 3/350 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G    
Sbjct: 3   KQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATAA 62

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLASS
Sbjct: 63  ISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A 
Sbjct: 122 ACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYAE 181

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  +
Sbjct: 182 PLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAKK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGPN
Sbjct: 242 DFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGPN 301

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           +KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 302 IKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|29653945|ref|NP_819637.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 493]
 gi|29541208|gb|AAO90151.1| diphosphomevalonate decarboxylase [Coxiella burnetii RSA 493]
          Length = 503

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 209/350 (59%), Gaps = 3/350 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G    
Sbjct: 3   KQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATAA 62

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLASS
Sbjct: 63  ISPSSTNQHELIINNQPIAIYSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A 
Sbjct: 122 ACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYAE 181

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  +
Sbjct: 182 PLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAKK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGPN
Sbjct: 242 DFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGPN 301

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           +KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 302 IKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|78486075|ref|YP_392000.1| diphosphomevalonate decarboxylase [Thiomicrospira crunogena XCL-2]
 gi|78364361|gb|ABB42326.1| diphosphomevalonate decarboxylase [Thiomicrospira crunogena XCL-2]
          Length = 332

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 195/310 (62%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ 81
           +K +   P NIAL KYWGKR+  LNLP N+SLS+SL  LGT T I  +++ +D I LN  
Sbjct: 20  QKGTGKAPVNIALSKYWGKRNVDLNLPTNSSLSISLPGLGTKTQIEWVENQSDHIYLNET 79

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           K++S  SF ++   F DLFR  ++  F++ T N++PT AGLASSASG+AAL LAL   + 
Sbjct: 80  KVASDDSFAQRIRLFLDLFRPNTQGGFIVNTLNSVPTAAGLASSASGYAALVLALNDCFQ 139

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                + LS +ARLGSGSA RS Y GF  W  G   NGMDS+A   +  WP+L IGLL+I
Sbjct: 140 WDLPLKRLSLLARLGSGSASRSLYDGFALWHKGQLDNGMDSYAEKIDQAWPELCIGLLEI 199

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               K I S + M+ T +H   +  W  +   DL    QAI D+DF +LG+ +E NAL M
Sbjct: 200 DVSTKPISSTQGMQNTVNHCELYQAWPDKAEADLQKTHQAIQDKDFQQLGQTSENNALAM 259

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HATMIA  PP+LYWQ E++  M +VW  R +   +YFT+DAGPNLKLLF  +    I+  
Sbjct: 260 HATMIATWPPILYWQPESVAAMHKVWQLRAEGCDVYFTMDAGPNLKLLFLKQDAPMIQTH 319

Query: 322 FPEITIIDPL 331
           FP I +I P 
Sbjct: 320 FPSIKVIQPF 329


>gi|146329706|ref|YP_001209416.1| diphosphomevalonate decarboxylase [Dichelobacter nodosus VCS1703A]
 gi|146233176|gb|ABQ14154.1| diphosphomevalonate decarboxylase [Dichelobacter nodosus VCS1703A]
          Length = 328

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 199/310 (64%), Gaps = 3/310 (0%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
           ++AF P+NIAL KYWGKRD++LNLP N SLS+SL HLGT T I+    + D +  + + +
Sbjct: 4   ATAFAPANIALAKYWGKRDAQLNLPTNGSLSISLAHLGTTTTISA--GERDQLYCDHRLL 61

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
              ++F +K   F D F Q  +   +I T NNIPT AGLASSASGFAALTLAL   +   
Sbjct: 62  PPDTAFVQKVWHFID-FCQPKRPPLVIHTQNNIPTAAGLASSASGFAALTLALNDFFQWS 120

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID 203
              E LS++AR GSGSACRS ++GF  W  G   +G D +A P  + W DLR+G++ I  
Sbjct: 121 LSREQLSQIARRGSGSACRSLWQGFVYWQKGEKADGSDCYARPIASDWQDLRLGIITIDA 180

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KKI SR+AM  T   SP F+ WTQ    DL  I QA++D+DF+ L + AE NAL MHA
Sbjct: 181 AAKKISSRQAMNHTAASSPLFSSWTQAAEADLKVIYQAVLDRDFLTLAQTAEANALMMHA 240

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           +++AA P + YWQ +T+  ++ +W AR + + +Y TLDAG N+KLL+  + E  I   FP
Sbjct: 241 SLLAARPAIFYWQPQTLAMLQCIWQARAEGLAVYATLDAGANVKLLYRAQDEAEIASMFP 300

Query: 324 EITIIDPLDS 333
           +  +I+P  +
Sbjct: 301 QAQLINPFQT 310


>gi|153207695|ref|ZP_01946342.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218972|ref|YP_002305759.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuK_Q154]
 gi|120576391|gb|EAX33015.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212013234|gb|ACJ20614.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuK_Q154]
          Length = 503

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/350 (44%), Positives = 208/350 (59%), Gaps = 3/350 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G    
Sbjct: 3   KQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATAA 62

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLASS
Sbjct: 63  ISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A 
Sbjct: 122 ACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYAE 181

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           P    WP L IGL  +  + K + SRE M  T   SP ++ W +  + DL  +K+AI  +
Sbjct: 182 PLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEIANRDLTQLKKAIAKK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGPN
Sbjct: 242 DFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGPN 301

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           +KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 302 IKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|161831576|ref|YP_001596532.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 331]
 gi|161763443|gb|ABX79085.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 331]
          Length = 503

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/350 (44%), Positives = 207/350 (59%), Gaps = 3/350 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G    
Sbjct: 3   KQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATAA 62

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP   GLASS
Sbjct: 63  ISPSSTNQHELIINNQPIAIYSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLATGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS A 
Sbjct: 122 ACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSHAE 181

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  +
Sbjct: 182 PLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAKK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGPN
Sbjct: 242 DFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGPN 301

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           +KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 302 IKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|254513287|ref|ZP_05125352.1| diphosphomevalonate decarboxylase [Rhodobacteraceae bacterium
           KLH11]
 gi|221532291|gb|EEE35287.1| diphosphomevalonate decarboxylase [Rhodobacteraceae bacterium
           KLH11]
          Length = 341

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 180/310 (58%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ 81
           E   A+ PSNIAL KYWGKRD  LNLPLN+SLS+SLGHLG+ TH++      D +  +G 
Sbjct: 21  ESYEAYSPSNIALAKYWGKRDQTLNLPLNSSLSISLGHLGSKTHVSSATDGVDGVWFDGD 80

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           K+ +QS F +K   F DLFR+   +   I T N IPT +GLASSASGFAALT A+   + 
Sbjct: 81  KLPNQSRFAQKVLAFADLFRRGQNLPLHIVTKNTIPTASGLASSASGFAALTRAISGAFK 140

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      LS ++R GSGSA RS + GF  W  G   +G D  A    + WP  RI ++ +
Sbjct: 141 LALSDAQLSMISRFGSGSASRSIWHGFVCWDRGVRDDGTDCVARQLPHHWPGFRIAVIPV 200

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               K + S + M  T   SP F  W +    D   ++ A++ +DF  LGE  E NAL M
Sbjct: 201 DTDLKSVPSSDGMRHTVATSPLFEAWPEHAEADCIRVEAAVLARDFTVLGETVEANALAM 260

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HATM+A+ P L Y Q  +   +E +W+AR+  I  Y T+DAG N+K+LF       I+  
Sbjct: 261 HATMLASRPVLNYLQPASWTCLETIWNARKAGIEAYATMDAGANIKVLFLETNRTQIETL 320

Query: 322 FPEITIIDPL 331
           FP+  IIDP 
Sbjct: 321 FPQGLIIDPF 330


>gi|20429112|emb|CAD24423.1| mevalonate diphosphate decarboxylase [Paracoccus
           zeaxanthinifaciens]
          Length = 332

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 190/334 (56%), Gaps = 4/334 (1%)

Query: 1   MSLSLRHILHRYI-GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH 59
           M+ ++R ++ R + G  + +  E   A+ PSNIAL KYWGKRD+  NLPLN+S+S+SL +
Sbjct: 1   MTDAVRDMIARAMAGATDIRAAE---AYAPSNIALSKYWGKRDAARNLPLNSSVSISLAN 57

Query: 60  LGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTK 119
            G+ T +    +  D +  NG  +    +F ++   F DLFR    +   I T N+IPT 
Sbjct: 58  WGSHTRVEGSGTGHDEVHHNGTLLDPGDAFARRALAFADLFRGGRHLPLRITTQNSIPTA 117

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSASGFAALT AL   + +      LSR+AR+GSGSA RS + GF  W  G  ++G
Sbjct: 118 AGLASSASGFAALTRALAGAFGLDLDDTDLSRIARIGSGSAARSIWHGFVRWNRGEAEDG 177

Query: 180 MDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIK 239
            DS  VP + +WP  RI ++ +    K   SR+ M  T   SP F  W  Q   D   I+
Sbjct: 178 HDSHGVPLDLRWPGFRIAIVAVDKGPKPFSSRDGMNHTVETSPLFPPWPAQAEADCRVIE 237

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT 299
            AI  +D   LG   E NAL MHATM+AA PPL Y    + Q +ER+W AR   +  + T
Sbjct: 238 DAIAARDMAALGPRVEANALAMHATMMAARPPLCYLTGGSWQVLERLWQARADGLAAFAT 297

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           +DAGPN+KL+F       +   FP+ ++I P + 
Sbjct: 298 MDAGPNVKLIFEESSAADVLYLFPDASLIAPFEG 331


>gi|332686202|ref|YP_004455976.1| diphosphomevalonate decarboxylase [Melissococcus plutonius ATCC
           35311]
 gi|332370211|dbj|BAK21167.1| diphosphomevalonate decarboxylase [Melissococcus plutonius ATCC
           35311]
          Length = 333

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 143/327 (43%), Positives = 195/327 (59%), Gaps = 15/327 (4%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           +N   SA   +NIAL KYWGK+D+ L +P+NNSLSL+L    T T +    S + D   L
Sbjct: 1   MNNMGSARAYTNIALIKYWGKKDNSLIIPMNNSLSLTLDAFYTDTTVKFTSSLNEDQFFL 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NGQ+ +S+    KK  QF +  RQ   V  Y  IE+ N++PT AGLASSASGFAAL  A 
Sbjct: 61  NGQRQTSKEE--KKIHQFLNFIRQSFGVNEYAKIESKNHVPTGAGLASSASGFAALAGAC 118

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT-DQNGMDSFAVP-FNNQWP-D 193
                +    + LSR+AR GSGSACRS Y GF EW  GT D+N   SFA+P F + W  +
Sbjct: 119 SEALHLNLSLKELSRLARRGSGSACRSIYGGFSEWEKGTKDEN---SFALPLFADNWEKE 175

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           L +  + + D+ K++ SR  M+ T   S F+  W + +  DL   K AI ++DF  LG+ 
Sbjct: 176 LAMLFIVVNDQIKEVSSRSGMQKTVETSCFYPGWLETVDKDLKQAKHAIKEKDFQLLGKT 235

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E NALKMHAT + A PP  YW +E+++ M+ +  AR+Q IP YFT+DAGPN+K+L   K
Sbjct: 236 IEANALKMHATTLGAHPPFTYWSEESMKAMKSIRQARKQGIPCYFTMDAGPNVKVLVEKK 295

Query: 314 ----IEETIKQFFPEITIIDPLDSPDL 336
               + + +  FF E  +I  L  P +
Sbjct: 296 NLKILHDFLINFFSENQLISALAGPGI 322


>gi|213964930|ref|ZP_03393129.1| diphosphomevalonate decarboxylase [Corynebacterium amycolatum SK46]
 gi|213952466|gb|EEB63849.1| diphosphomevalonate decarboxylase [Corynebacterium amycolatum SK46]
          Length = 325

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/308 (41%), Positives = 174/308 (56%), Gaps = 9/308 (2%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCI 76
           +   ++A    NIAL KYWGKRD  + LP   SLSL+LG   T T +++ID     AD  
Sbjct: 1   MTTTATAVAHPNIALIKYWGKRDEAVQLPATGSLSLTLGIAPTTTTVSLIDDPSVTADSG 60

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQ--FSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
            LNGQ++  +     +  +F DL R+   S  +  + ++N IPT AGLASSASGF AL L
Sbjct: 61  TLNGQEMVGKD--LSRVQKFLDLVRERAGSTSFAEVNSTNEIPTGAGLASSASGFGALAL 118

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL 194
           A  + Y +    E LS +AR GSGSACRS + G  EW+ G D     S AV   +   DL
Sbjct: 119 AAAKAYGLDYTPEQLSALARRGSGSACRSIFGGLVEWLPGDDD--ASSHAVALPDSGLDL 176

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  +    KKI SR AM  T   SPFF  W +Q+  D+  +K AI   DF  +GE+A
Sbjct: 177 SLVVAVLAPGRKKIDSRAAMRRTVETSPFFPAWVEQVPRDIEDMKAAIAAADFTAVGELA 236

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E NA++MHATM+ A PP+ YW  +++  ++ V   R +    Y T+DAGPN+K+L     
Sbjct: 237 EANAMRMHATMLGALPPVRYWNPDSVAALDLVATLRDEGTECYATMDAGPNVKVLCRSGD 296

Query: 315 EETIKQFF 322
            ETI   F
Sbjct: 297 AETIADRF 304


>gi|23097681|ref|NP_691147.1| mevalonate diphosphate decarboxylase [Oceanobacillus iheyensis
           HTE831]
 gi|22775904|dbj|BAC12182.1| mevalonate diphosphate decarboxylase [Oceanobacillus iheyensis
           HTE831]
          Length = 324

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 188/314 (59%), Gaps = 8/314 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +NIAL KYWGKR+  + LP N++LSL+L    T+T +   +   +D   LN +
Sbjct: 2   KATAKAHTNIALIKYWGKRNEPIILPTNSNLSLTLDGFSTVTTVHFQEELSSDEFFLNDR 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +   +S  ++ T F D  R  +  ++Y  I + N++PT AG ASSASGFAAL  A  + 
Sbjct: 62  LVEDAAS--QRVTGFLDKVRAMAGKEMYARIHSLNHVPTAAGFASSASGFAALAAASTKA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIG 197
             +      LS + R GSGSACRS Y GF EW  G  ++G DS+AVP    + W D+R+ 
Sbjct: 120 IGLELNDTELSILTRQGSGSACRSIYGGFVEWQMGEKEDGSDSYAVPIASKDHW-DIRVA 178

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + +   EKK+ SR+ M  T   SPF+  W +Q   DL  IK AI D+DF K G +AE N
Sbjct: 179 AVVLSATEKKVSSRDGMRRTVETSPFYDGWLKQTPKDLEEIKTAIHDKDFEKTGSIAEAN 238

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
            ++MHAT + A+PP  YWQ  T++ M+ V   R++ IP YFT+DAGPN+K+L+  K E  
Sbjct: 239 CMRMHATTLGANPPFTYWQDTTMRVMQNVQQMREEGIPAYFTIDAGPNVKVLYLPKDESK 298

Query: 318 IKQFFPEITIIDPL 331
           +KQ   +I  ++ +
Sbjct: 299 VKQRLEQIMGVEDV 312


>gi|229542021|ref|ZP_04431081.1| diphosphomevalonate decarboxylase [Bacillus coagulans 36D1]
 gi|229326441|gb|EEN92116.1| diphosphomevalonate decarboxylase [Bacillus coagulans 36D1]
          Length = 326

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 184/302 (60%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +NIAL KYWGKRD KL LP+N+SLS++L    T T +    +  AD   LNG+
Sbjct: 2   EATARAHTNIALIKYWGKRDEKLFLPMNSSLSITLDRFYTTTKVAYDPALKADVFFLNGK 61

Query: 82  -KISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
             I ++++   K ++F D  R F+  K Y  IE+ N +P  AGLASSASG AAL  A  +
Sbjct: 62  PAIDAETA---KISRFMDKIRAFAGEKRYAYIESQNEVPIAAGLASSASGMAALAAAAVK 118

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
              I     +LS +AR GSGSACRS Y GF EW  G   +G DS+AVP    + W +L I
Sbjct: 119 ALGIEVDGRTLSILARQGSGSACRSIYGGFVEWQKGEKADGSDSYAVPILGEDDW-NLSI 177

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
               +  ++KKI SRE M+ T   SPF+  W + +  DLA  K AI  +DF  LG V E 
Sbjct: 178 LSCLVESKQKKISSREGMKRTVTTSPFYKAWMETVEKDLAAAKSAIAARDFALLGRVLEA 237

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NALKMHAT I+A PP LYWQ  T+  M+ V   R++ I  YFT+DAGPN+K+L   K EE
Sbjct: 238 NALKMHATTISADPPFLYWQSATLDVMQEVALLRERGIEAYFTIDAGPNVKVLCERKDEE 297

Query: 317 TI 318
           T+
Sbjct: 298 TV 299


>gi|328958132|ref|YP_004375518.1| diphosphomevalonate decarboxylase [Carnobacterium sp. 17-4]
 gi|328674456|gb|AEB30502.1| diphosphomevalonate decarboxylase [Carnobacterium sp. 17-4]
          Length = 328

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 185/306 (60%), Gaps = 11/306 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKRD  L LP ++SLSL+L    T T ++  +S   D   LN       ++
Sbjct: 14  TNIALIKYWGKRDDALILPTSSSLSLTLDAFYTETSVSFDESIGKDTFYLNDTLQDEAAT 73

Query: 89  FFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++F +LFR+ + V    +I+++N +PT AGLASSASG AAL  A      +    
Sbjct: 74  L--KVSRFLNLFRETADVKTPAIIKSTNYVPTAAGLASSASGMAALAGAANLATGLNLSP 131

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LS  AR GSGSA RS Y GF EW  GT    +DS+AV  ++   D+ + ++ +   +K
Sbjct: 132 QELSIFARQGSGSATRSIYGGFVEWQKGT--TSLDSYAVKIDDAAWDIGMLVVVVNKNQK 189

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           ++ SRE M+ T   SPF++ W +  + DL +IK+AI DQDF  +GE+ E N +KMH TM+
Sbjct: 190 ELSSREGMKQTVATSPFYSGWVESTAVDLVNIKKAIRDQDFELVGEITESNGMKMHGTML 249

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFF 322
            A+PP+ YW+ +++  M+ V   R+Q IP YFT+DAGPN+K+L     + KI+     +F
Sbjct: 250 GANPPISYWEPDSVVAMQLVRQLRKQGIPCYFTMDAGPNVKVLCRLSDSQKIKTAFLNYF 309

Query: 323 PEITII 328
            E  +I
Sbjct: 310 NEEQLI 315


>gi|290892049|ref|ZP_06555046.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J2-071]
 gi|290558643|gb|EFD92160.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J2-071]
          Length = 339

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 182/295 (61%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCII 77
           K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++ A D  I
Sbjct: 14  KVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEQKTDA-----KVARFIDKMREEFGIPAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|116871434|ref|YP_848215.1| mevalonate diphosphate decarboxylase [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116740312|emb|CAK19430.1| mevalonate diphosphate decarboxylase [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 323

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 185/302 (61%), Gaps = 9/302 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    +S  D  ILNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDKNSAQDTFILNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +    +I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGITSKAIITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFA+PF N+  D + + +
Sbjct: 117 AGRDDTKEYISRLARFGSGSASRSVFGDFVIWEKGQQPDGNDSFAIPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +K+AI+++DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKKAILNEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQ 320
            +
Sbjct: 297 AE 298


>gi|217965923|ref|YP_002351601.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HCC23]
 gi|217335193|gb|ACK40987.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HCC23]
 gi|307569534|emb|CAR82713.1| diphosphomevalonate decarboxylase [Listeria monocytogenes L99]
          Length = 323

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 183/300 (61%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++ A D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296


>gi|81428518|ref|YP_395518.1| diphosphomevalonate decarboxylase [Lactobacillus sakei subsp. sakei
           23K]
 gi|78610160|emb|CAI55209.1| Diphosphomevalonate decarboxylase [Lactobacillus sakei subsp. sakei
           23K]
          Length = 324

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 187/299 (62%), Gaps = 10/299 (3%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           + + ++A   +NIAL KYWGK+D+ L +P N+SLSL+L H  T T +T  ++   D II 
Sbjct: 1   MGQSATARAHTNIALIKYWGKKDANLIIPQNSSLSLTLDHFYTDTTVTFSETLTRDQIIF 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NGQ+   Q+    K +QF DL RQ +    +  +ET+N++P  AGLASSASG+AAL  A 
Sbjct: 61  NGQEADEQTQ--TKMSQFLDLIRQQAGRSTFASVETTNHVPNAAGLASSASGYAALAAAG 118

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDL 194
            R   +      LSR+AR GSGSA RS Y GF EW  G  +N  DS+A+P   +  W D+
Sbjct: 119 SRAAGLDLNRRDLSRLARRGSGSATRSIYGGFVEWQRG--RNDQDSYAIPVQEEIDW-DI 175

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
           ++  + + DR+K++ SR  M      SP++  W +    DL  +K AII +D   +G++A
Sbjct: 176 QMIAIVLNDRKKRVASRAGMASVVATSPYYPSWVETAQADLPKMKDAIIKKDINLVGQLA 235

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           EK+A++MHAT ++A PP  Y++ ET+Q +E V   RQQ +  Y+T+DAGPN+K++ T +
Sbjct: 236 EKSAMQMHATTLSAVPPFTYFEPETLQAIEVVERLRQQGVSCYYTMDAGPNVKVICTSR 294


>gi|47093021|ref|ZP_00230800.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 4b
           H7858]
 gi|47018589|gb|EAL09343.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 4b
           H7858]
          Length = 339

 Score =  209 bits (532), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 182/295 (61%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCII 77
           K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++ A D  I
Sbjct: 14  KVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|46906236|ref|YP_012625.1| diphosphomevalonate decarboxylase [Listeria monocytogenes serotype
           4b str. F2365]
 gi|46879500|gb|AAT02802.1| diphosphomevalonate decarboxylase [Listeria monocytogenes serotype
           4b str. F2365]
          Length = 323

 Score =  208 bits (530), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 183/300 (61%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++ A D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296


>gi|293596254|ref|ZP_06684161.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J1-194]
 gi|293596797|ref|ZP_06684343.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HPB2262]
 gi|293582403|gb|EFF94435.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HPB2262]
 gi|293594007|gb|EFG01768.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J1-194]
          Length = 339

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 180/295 (61%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCII 77
           K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    + A D  I
Sbjct: 14  KVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN +  +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEHKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|226222650|ref|YP_002756757.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes
           Clip81459]
 gi|255519790|ref|ZP_05387027.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes FSL
           J1-175]
 gi|225875112|emb|CAS03800.1| Putative mevalonate diphosphate decarboxylase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|328476152|gb|EGF46858.1| diphosphomevalonate decarboxylase [Listeria monocytogenes 220]
          Length = 323

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 181/300 (60%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    + A D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  HKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296


>gi|289433384|ref|YP_003463256.1| mevalonate diphosphate decarboxylase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289169628|emb|CBH26162.1| mevalonate diphosphate decarboxylase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 323

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 185/307 (60%), Gaps = 9/307 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  +LNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLKQDRFMLNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K T+F D  R+   +    LI + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVTRFIDKMREEFGITAKALIISENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
               +  + +S++AR GSGSA RS Y  F  W  G   +G DSFA+PF  +  D    ++
Sbjct: 117 AGRNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAIPFTKKLSDKMSMVI 176

Query: 200 KII-DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
            ++ D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+ +DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFKEWVAAAETDLEEMKQAILAEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V   R++ IP YFT+DAGPN+K++   K E+ +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDEVRALREEGIPAYFTMDAGPNVKVICERKNEKIV 296

Query: 319 KQFFPEI 325
            +   E+
Sbjct: 297 AEKLSEL 303


>gi|254992955|ref|ZP_05275145.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes FSL
           J2-064]
          Length = 323

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 181/300 (60%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    + A D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  HKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296


>gi|258612252|ref|ZP_05711813.1| diphosphomevalonate decarboxylase [Listeria monocytogenes F6900]
 gi|293596646|ref|ZP_06684296.1| diphosphomevalonate decarboxylase [Listeria monocytogenes J2818]
 gi|258610105|gb|EEW22713.1| diphosphomevalonate decarboxylase [Listeria monocytogenes F6900]
 gi|293591124|gb|EFF99458.1| diphosphomevalonate decarboxylase [Listeria monocytogenes J2818]
          Length = 339

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 178/295 (60%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  I
Sbjct: 14  KVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|258611417|ref|ZP_05711501.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N3-165]
 gi|258599813|gb|EEW13138.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N3-165]
          Length = 339

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 178/295 (60%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  I
Sbjct: 14  KVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFAVDKFYTKTTVEWDEKLTQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFKNWVSAAEIDLEEMKQAILDEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|313625778|gb|EFR95404.1| diphosphomevalonate decarboxylase [Listeria innocua FSL J1-023]
          Length = 323

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 181/300 (60%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +  A D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGNDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296


>gi|255025416|ref|ZP_05297402.1| hypothetical protein LmonocytFSL_02134 [Listeria monocytogenes FSL
           J2-003]
          Length = 323

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 176/291 (60%), Gaps = 9/291 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSNA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWENGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 287


>gi|16802059|ref|NP_463544.1| hypothetical protein lmo0011 [Listeria monocytogenes EGD-e]
 gi|47097294|ref|ZP_00234852.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498297|ref|ZP_03666646.1| hypothetical protein LmonF1_00820 [Listeria monocytogenes Finland
           1988]
 gi|224503065|ref|ZP_03671372.1| hypothetical protein LmonFR_11181 [Listeria monocytogenes FSL
           R2-561]
 gi|254830696|ref|ZP_05235351.1| hypothetical protein Lmon1_05029 [Listeria monocytogenes 10403S]
 gi|254899674|ref|ZP_05259598.1| hypothetical protein LmonJ_07671 [Listeria monocytogenes J0161]
 gi|284803254|ref|YP_003415119.1| hypothetical protein LM5578_3011 [Listeria monocytogenes 08-5578]
 gi|284996395|ref|YP_003418163.1| hypothetical protein LM5923_2960 [Listeria monocytogenes 08-5923]
 gi|16409370|emb|CAC98226.1| lmo0011 [Listeria monocytogenes EGD-e]
 gi|47014339|gb|EAL05314.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|284058816|gb|ADB69757.1| hypothetical protein LM5578_3011 [Listeria monocytogenes 08-5578]
 gi|284061862|gb|ADB72801.1| hypothetical protein LM5923_2960 [Listeria monocytogenes 08-5923]
          Length = 323

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 176/291 (60%), Gaps = 9/291 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSNA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 287


>gi|16799090|ref|NP_469358.1| hypothetical protein lin0011 [Listeria innocua Clip11262]
 gi|16412432|emb|CAC95244.1| lin0011 [Listeria innocua Clip11262]
          Length = 339

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 185/306 (60%), Gaps = 9/306 (2%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCII 77
           K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++ A D  I
Sbjct: 14  KVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+++DFIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILEEDFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+N +KMHAT + A PP  Y+Q  +++ M+ V + R+  IP YFT+DAGPN+K++   + 
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPLSLEIMDAVRELRENGIPAYFTMDAGPNVKVICEREN 308

Query: 315 EETIKQ 320
           E  + +
Sbjct: 309 ENIVAE 314


>gi|163790895|ref|ZP_02185319.1| mevalonate diphosphate decarboxylase [Carnobacterium sp. AT7]
 gi|159873848|gb|EDP67928.1| mevalonate diphosphate decarboxylase [Carnobacterium sp. AT7]
          Length = 325

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 182/296 (61%), Gaps = 7/296 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKRD KL LP ++SLSL+L    T T ++  +S + D   L+       ++
Sbjct: 11  TNIALIKYWGKRDDKLILPTSSSLSLTLDAFYTETAVSFDESLEKDTFYLDDNLQDEAAT 70

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++F +LFR+ +  K   LI+++N +PT AGLASSASG AAL  A      +    
Sbjct: 71  L--KVSRFLNLFREQADLKAPALIKSTNYVPTAAGLASSASGMAALAGAANLASGLNLTP 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LS  AR GSGSA RS Y GF EW  GT  + +DS+AV  +N   D+ + ++ +   +K
Sbjct: 129 QELSIFARQGSGSASRSVYGGFVEWQKGT--SSVDSYAVKVDNADWDIGMVVVVVNKNQK 186

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           ++ SRE M+ T   SPF+  W +  + DL +IK+AI  +DF ++GE+ E N +KMH TM+
Sbjct: 187 ELSSREGMKQTVATSPFYAGWIESTAVDLVNIKKAIGQRDFEQVGEITESNGMKMHGTML 246

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
            A+PP+ YW+ +++  M+ V   R+Q IP YFT+DAGPN+K+L      + IK  F
Sbjct: 247 GANPPISYWEPDSVLAMQLVRKLRKQGIPCYFTMDAGPNVKVLCRLSDSKEIKTAF 302


>gi|313640107|gb|EFS04731.1| diphosphomevalonate decarboxylase [Listeria seeligeri FSL S4-171]
          Length = 323

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 183/307 (59%), Gaps = 9/307 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  +LNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLKQDRFMLNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K T+F D  R+   +    LI + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTDA-----KVTRFIDKMREEFGITAKALIISENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
               +  + +S++AR GSGSA RS Y  F  W  G   +G DSFA+PF  +  D     +
Sbjct: 117 AGRNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAIPFTKKLSDKMXXXI 176

Query: 200 KII-DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
            ++ D+EKK+ SR+ M +T   SPFF  W     TDL  +KQAI+ +DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFKDWVAAAETDLEEMKQAILAEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V   R++ IP YFT+DAGPN+K++   K E+ +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDAVRALREEGIPAYFTMDAGPNVKVICERKNEKIV 296

Query: 319 KQFFPEI 325
            +   E+
Sbjct: 297 AEKLSEL 303


>gi|325568464|ref|ZP_08144831.1| diphosphomevalonate decarboxylase [Enterococcus casseliflavus ATCC
           12755]
 gi|325158233|gb|EGC70386.1| diphosphomevalonate decarboxylase [Enterococcus casseliflavus ATCC
           12755]
          Length = 334

 Score =  205 bits (521), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 134/301 (44%), Positives = 173/301 (57%), Gaps = 10/301 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQ 81
           K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +    D   DC  L+G 
Sbjct: 5   KGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFPQDCFTLDG- 63

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +       KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 64  -VVQTDVATKKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSEA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIG 197
             +    + LSR+AR GSGSACRS Y GF EW  GTD+    SFA  VP N    +L + 
Sbjct: 123 LDLNLSEQELSRLARRGSGSACRSIYGGFAEWHQGTDET---SFATQVPSNGWEEELSMI 179

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I  + K++ SRE M  T   S F+  W    +TDL  +KQAI ++DF  LGE  E N
Sbjct: 180 FILINAQAKEVSSREGMRRTVETSSFYPGWLTATATDLVKMKQAIAEKDFTALGETTEAN 239

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           ALKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+T
Sbjct: 240 ALKMHGTTLAAEPPFTYWSSESLRAMECVRMLRKKGLACYFTMDAGPNVKVLCQKQEEQT 299

Query: 318 I 318
           I
Sbjct: 300 I 300


>gi|258611654|ref|ZP_05711586.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           R2-503]
 gi|300763376|ref|ZP_07073374.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N1-017]
 gi|258605122|gb|EEW17730.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           R2-503]
 gi|300515653|gb|EFK42702.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N1-017]
          Length = 339

 Score =  205 bits (521), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 180/295 (61%), Gaps = 9/295 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCII 77
           K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    + A D  I
Sbjct: 14  KVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFI 73

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LN +  +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA
Sbjct: 74  LNNEHKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALA 128

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-L 194
                   +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D +
Sbjct: 129 GSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKM 188

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D++FIK+GE+ 
Sbjct: 189 SLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDENFIKVGEIT 248

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 249 ERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 303


>gi|228475116|ref|ZP_04059843.1| diphosphomevalonate decarboxylase [Staphylococcus hominis SK119]
 gi|228270880|gb|EEK12277.1| diphosphomevalonate decarboxylase [Staphylococcus hominis SK119]
          Length = 327

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 181/310 (58%), Gaps = 5/310 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D  L +P+NNSLS++L    T TH+T  DS   D +ILN + ++++ S
Sbjct: 11  TNIALIKYWGKADENLIIPMNNSLSVTLERFYTETHVTFDDSLTEDQLILNKEAVNAKES 70

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ D+ R+ + +  Y LIE+ N +PT AGLASSAS +AAL  A      +    
Sbjct: 71  --AKIQRYMDMIRKEAGISTYALIESDNFVPTAAGLASSASAYAALAGACNEALDLNLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     +  +  +    DL +  + I ++ K
Sbjct: 129 KDLSRLARRGSGSASRSIYGGFAEWEKGYDDKTSYAHQIESDGFENDLAMIFVVINNKSK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M +TR  S F+  W   +  DL  +KQAI  +DF ++GEV E N L+MHAT +
Sbjct: 189 KVSSRSGMSLTRDTSRFYQYWLDHVEEDLKVVKQAIAQKDFKRMGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
            A PP  Y   E+ + M  V + R+  +P YFT+DAGPN+K+L   K ++ I   F E+ 
Sbjct: 249 GAQPPFTYLVPESYEAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKHQQAIVNQFLEVF 308

Query: 327 IIDPLDSPDL 336
             D + + D+
Sbjct: 309 NKDQIITSDI 318


>gi|314937085|ref|ZP_07844432.1| diphosphomevalonate decarboxylase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655704|gb|EFS19449.1| diphosphomevalonate decarboxylase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 327

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 180/310 (58%), Gaps = 5/310 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D  L +P+NNSLS++L    T TH+T  DS   D +ILN + ++++ S
Sbjct: 11  TNIALIKYWGKADENLIIPMNNSLSVTLERFYTETHVTFDDSLTEDQLILNKEAVNAKES 70

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ D+ R+ + +  Y LIE+ N +PT AGLASSAS +AAL  A      +    
Sbjct: 71  --AKIQRYMDMIRKEAGISTYALIESDNFVPTAAGLASSASAYAALAGACNEALDLNLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     +  +  +    DL +  + I ++ K
Sbjct: 129 KDLSRLARRGSGSASRSIYGGFAEWEKGYDDKTSYAHQIESDGFENDLAMIFVVINNKSK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M +TR  S F+  W   +  DL   KQAI  +DF ++GEV E N L+MHAT +
Sbjct: 189 KVSSRSGMSLTRDTSRFYQYWLDHVEEDLKVTKQAIAQKDFKRMGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
            A PP  Y   E+ + M  V + R+  +P YFT+DAGPN+K+L   K ++ I   F E+ 
Sbjct: 249 GAQPPFTYLVPESYEAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKHQQAIVNQFLEVF 308

Query: 327 IIDPLDSPDL 336
             D + + D+
Sbjct: 309 NKDQIITSDI 318


>gi|257877200|ref|ZP_05656853.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC20]
 gi|257811366|gb|EEV40186.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC20]
          Length = 332

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/301 (43%), Positives = 173/301 (57%), Gaps = 10/301 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQ 81
           K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +    D   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFTQDRFTLDG- 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +    +  KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 62  -VVQTDAATKKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSEA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIG 197
             +    + LSR+AR GSGSACRS Y GF EW  GTD+    SFA  VP N    +L + 
Sbjct: 121 LDLNLSEQELSRLARRGSGSACRSIYGGFAEWHQGTDET---SFATQVPSNGWEEELSMI 177

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I  + K++ SRE M  T   S F+  W    ++DL  +KQAI ++DF  LGE  E N
Sbjct: 178 FILINAQAKEVSSREGMRRTVETSSFYPGWLSATASDLVKMKQAIAEKDFTALGETTEAN 237

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           ALKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+T
Sbjct: 238 ALKMHGTTLAAEPPFTYWSSESLRAMECVRTLRKKGLACYFTMDAGPNVKVLCQKQEEQT 297

Query: 318 I 318
           I
Sbjct: 298 I 298


>gi|257867121|ref|ZP_05646774.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC30]
 gi|257873456|ref|ZP_05653109.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC10]
 gi|257801177|gb|EEV30107.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC30]
 gi|257807620|gb|EEV36442.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC10]
          Length = 332

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/301 (43%), Positives = 174/301 (57%), Gaps = 10/301 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQ 81
           K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +    D   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFTQDRFTLDG- 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +    +  KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 62  -VVQTDAATKKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSEA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIG 197
             +    ++LSR+AR GSGSACRS Y GF EW  GTD+    SFA  VP N    +L + 
Sbjct: 121 LDLNLSEQALSRLARRGSGSACRSIYGGFAEWHQGTDET---SFATQVPSNGWEEELSMI 177

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I  + K++ SRE M  T   S F+  W    ++DL  +KQAI ++DF  LGE  E N
Sbjct: 178 FILINAQAKEVSSREGMRRTVETSSFYPGWLSATASDLVKMKQAIAEKDFTALGETTEAN 237

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           ALKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+T
Sbjct: 238 ALKMHGTTLAAEPPFTYWSSESLRAMECVRMLRKKGLACYFTMDAGPNVKVLCQKQEEQT 297

Query: 318 I 318
           I
Sbjct: 298 I 298


>gi|299820831|ref|ZP_07052720.1| diphosphomevalonate decarboxylase [Listeria grayi DSM 20601]
 gi|299817852|gb|EFI85087.1| diphosphomevalonate decarboxylase [Listeria grayi DSM 20601]
          Length = 323

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 178/300 (59%), Gaps = 9/300 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K+ A   +N+AL KYWGKRD  L LP N+SLSL++    T T +   +S   D  +LNG+
Sbjct: 2   KAIARAHTNVALIKYWGKRDETLMLPANSSLSLTVDQFYTTTALEWDESLQKDSFVLNGK 61

Query: 82  KISSQSSFFKKTTQFCDLFRQ-FSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRI 139
           ++        K ++F  + RQ F    F  I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  EVEDA-----KVSRFLSIMRQQFQLTSFARISSENHVPTAAGLASSASAFAALALAGSAA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW-PDLRIGL 198
               +  + LS++ARLGSGSA RS Y     W  G   +G DSF VPF ++   DL I +
Sbjct: 117 AGRNDDRKYLSKLARLGSGSASRSLYGDLVIWEKGNRDDGEDSFGVPFTSELTKDLAIVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D  KK+ SR  M+ T   SPFF  W Q+   DL  +K+A    DFI +GE+ E NA
Sbjct: 177 AVVSDEVKKVPSRLGMQSTVATSPFFPTWVQEAEKDLVAMKEAFAAADFITIGEITEHNA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A+PP  Y+Q +++Q M++V + R Q I  YFT+DAGPN+K+L   K E+ +
Sbjct: 237 MKMHATTLGANPPFTYFQPKSLQVMDKVRELRLQGIAAYFTMDAGPNVKVLCERKNEKLV 296


>gi|229824272|ref|ZP_04450341.1| hypothetical protein GCWU000282_01577 [Catonella morbi ATCC 51271]
 gi|229786245|gb|EEP22359.1| hypothetical protein GCWU000282_01577 [Catonella morbi ATCC 51271]
          Length = 333

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 176/296 (59%), Gaps = 5/296 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQKISSQSS 88
           +NIAL KYWGKRD  L LP+ +SLSL+L    T T +T     A D  IL+GQ+   ++S
Sbjct: 17  TNIALIKYWGKRDQALFLPVTSSLSLTLDAFYTDTQVTFDTQLAHDRFILDGQE--QETS 74

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K + F D FR F++     L+ ++N++PT AGLASSAS +AAL  A      +    
Sbjct: 75  QVAKVSAFLDRFRAFAQTDCRALVTSTNHVPTAAGLASSASAYAALACATNAALGLDLSQ 134

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
             LS +AR GSGSA RS + GF  W  G  ++   S+A PF     DL + ++ +    K
Sbjct: 135 RQLSILARQGSGSASRSLFGGFVIWHAGQGEDSDSSYAEPFEAAEWDLAMLVVMVNKGTK 194

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           KI SR+ M +T   SPF+  W  +++ DLA I+ AI+  D   +G++AE NA+KMHATMI
Sbjct: 195 KISSRQGMALTMETSPFYALWPDEVAKDLAAIQPAILAHDLASVGQIAEHNAMKMHATMI 254

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AA+P   YW+ ++++ M+ V   RQ+    YFT+DAGPN+K+L      E I+  F
Sbjct: 255 AANPSFSYWEADSLKAMDLVRQLRQEGFTAYFTMDAGPNVKVLCPASQAEAIRDRF 310


>gi|257871001|ref|ZP_05650654.1| diphosphomevalonate decarboxylase [Enterococcus gallinarum EG2]
 gi|257805165|gb|EEV33987.1| diphosphomevalonate decarboxylase [Enterococcus gallinarum EG2]
          Length = 339

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 181/316 (57%), Gaps = 15/316 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K  A   +NIAL KYWGK +  L LP+NNSLSL+L    T T +T  +    D   L+ +
Sbjct: 3   KGKARAYTNIALIKYWGKENETLILPMNNSLSLTLDAFYTETSVTFSEEYTQDRFFLDDK 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
           + S  ++  KK + F DL R  +   F   + + N +PT AGLASSASG AAL  A    
Sbjct: 63  QQSEAAT--KKISAFLDLVRAKANCPFFAQVNSRNFVPTAAGLASSASGLAALAGACNAA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +      LSR+AR GSGSACRS + GF EW  G D     S+A P  ++  +  + +L
Sbjct: 121 LDLQLSQTELSRLARRGSGSACRSIFGGFVEWHTGDDDT---SYATPIASEGWEKELSML 177

Query: 200 KII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            I+  D+EK + SR+ M  T   S +++ W +    DL  +KQAI ++DF  LGE  E N
Sbjct: 178 FILINDKEKDVSSRDGMRRTVETSSYYSGWLESTPHDLKKLKQAIREKDFQLLGETTEAN 237

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           ALKMHAT +AA+PP  YW  E+++ M+ V   RQ+ +  YFT+DAGPN+K+L   K EE 
Sbjct: 238 ALKMHATTMAATPPFTYWSPESLRAMDCVRSLRQKGLACYFTMDAGPNVKVLCQRKDEEA 297

Query: 318 I-----KQFFPEITII 328
           I     K F PE  I+
Sbjct: 298 ILTQLKKDFHPEQLIV 313


>gi|69246578|ref|ZP_00604008.1| Diphosphomevalonate decarboxylase [Enterococcus faecium DO]
 gi|257878884|ref|ZP_05658537.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,230,933]
 gi|257881520|ref|ZP_05661173.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,502]
 gi|257885792|ref|ZP_05665445.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,501]
 gi|257890742|ref|ZP_05670395.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,410]
 gi|258615044|ref|ZP_05712814.1| mevalonate diphosphate decarboxylase [Enterococcus faecium DO]
 gi|293560305|ref|ZP_06676802.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1162]
 gi|293567762|ref|ZP_06679103.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1071]
 gi|294620918|ref|ZP_06700119.1| diphosphomevalonate decarboxylase [Enterococcus faecium U0317]
 gi|314938976|ref|ZP_07846241.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a04]
 gi|314943473|ref|ZP_07850240.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133C]
 gi|314948234|ref|ZP_07851628.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0082]
 gi|314951594|ref|ZP_07854640.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133A]
 gi|314991543|ref|ZP_07857019.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133B]
 gi|314994876|ref|ZP_07860003.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a01]
 gi|68195186|gb|EAN09642.1| Diphosphomevalonate decarboxylase [Enterococcus faecium DO]
 gi|257813112|gb|EEV41870.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,230,933]
 gi|257817178|gb|EEV44506.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,502]
 gi|257821648|gb|EEV48778.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,501]
 gi|257827102|gb|EEV53728.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,410]
 gi|291589347|gb|EFF21154.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1071]
 gi|291599529|gb|EFF30545.1| diphosphomevalonate decarboxylase [Enterococcus faecium U0317]
 gi|291605755|gb|EFF35192.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1162]
 gi|313590858|gb|EFR69703.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a01]
 gi|313593827|gb|EFR72672.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133B]
 gi|313596288|gb|EFR75133.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133A]
 gi|313597845|gb|EFR76690.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133C]
 gi|313641685|gb|EFS06265.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a04]
 gi|313645367|gb|EFS09947.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0082]
          Length = 325

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 183/321 (57%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDGT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVFV 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|260558443|ref|ZP_05830639.1| mevalonate diphosphate decarboxylase [Enterococcus faecium C68]
 gi|260075617|gb|EEW63923.1| mevalonate diphosphate decarboxylase [Enterococcus faecium C68]
          Length = 325

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 183/321 (57%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDGT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVFV 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSNFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|309806238|ref|ZP_07700252.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           03V1-b]
 gi|308167385|gb|EFO69550.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           03V1-b]
          Length = 325

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 176/297 (59%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   KKI S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKKISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|223042897|ref|ZP_03612945.1| diphosphomevalonate decarboxylase [Staphylococcus capitis SK14]
 gi|222443751|gb|EEE49848.1| diphosphomevalonate decarboxylase [Staphylococcus capitis SK14]
          Length = 327

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/299 (41%), Positives = 176/299 (58%), Gaps = 6/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG+++ ++ +
Sbjct: 11  TNIALIKYWGKADESYIIPMNNSLSVTLERFYTETQVTFDASLTEDQLILNGEEVDAKET 70

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ D+ R    + ++  IE++N +PT AGLASSAS +AAL  A      +   S
Sbjct: 71  --TKIQKYMDIVRDVAATDLHAKIESNNFVPTAAGLASSASAYAALAAACNEALQLGLSS 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     + A+  N+   DL +  + I ++ K
Sbjct: 129 KDLSRLARRGSGSASRSIYGGFAEWEKGHDDATSYAHAIDANDWEKDLSMIFVVINNQSK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M +TR  S F+  W   +  DLA  K+AI ++DF  LGEV E N L+MHAT +
Sbjct: 189 KVSSRSGMSLTRETSRFYQYWLDHVDQDLAETKEAIKNKDFKHLGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-TIKQFFPE 324
            A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++  ++QF  E
Sbjct: 249 GAQPPFTYLVQESYDAMAVVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAVVEQFLKE 307


>gi|314932817|ref|ZP_07840186.1| diphosphomevalonate decarboxylase [Staphylococcus caprae C87]
 gi|313654498|gb|EFS18251.1| diphosphomevalonate decarboxylase [Staphylococcus caprae C87]
          Length = 327

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/299 (41%), Positives = 176/299 (58%), Gaps = 6/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG+++ ++ +
Sbjct: 11  TNIALIKYWGKADESYIIPMNNSLSVTLERFYTETQVTFDASLTEDQLILNGEEVDAKET 70

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ D+ R    + ++  IE++N +PT AGLASSAS +AAL  A      +   S
Sbjct: 71  --TKIQKYMDIVRDVAATDLHAKIESNNFVPTAAGLASSASAYAALAAACNEALQLGLSS 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     + A+  N+   DL +  + I ++ K
Sbjct: 129 KDLSRLARRGSGSASRSIYGGFAEWEKGHDDATSYAHAIDANDWEKDLSMIFVVINNQSK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M +TR  S F+  W   +  DLA  K+AI ++DF  LGEV E N L+MHAT +
Sbjct: 189 KVSSRSGMSLTRETSRFYQYWLDHVDQDLAEAKEAIKNKDFKHLGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-TIKQFFPE 324
            A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++  ++QF  E
Sbjct: 249 GAQPPFTYLVQESYDAMAVVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAAVEQFLKE 307


>gi|28378415|ref|NP_785307.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum WCFS1]
 gi|28271251|emb|CAD64155.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum WCFS1]
          Length = 325

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 168/292 (57%), Gaps = 6/292 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D I  N Q + +  S
Sbjct: 10  TNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQIYFNHQHLPTGKS 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL  A  R   +   +
Sbjct: 70  --ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALAGAASRAAGLQLDA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
             LSR+AR GSGSA RS + GF EW  G D     +  +     W D+++  + +   +K
Sbjct: 128 ADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-DIQMIAVVLKATKK 186

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I S + M      SP++  W     TDL  ++QAI D+D   +G++AE NA++MHA  +
Sbjct: 187 TISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQIAETNAMRMHALNL 246

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +  +TI
Sbjct: 247 SAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQDTDTI 298


>gi|227550900|ref|ZP_03980949.1| possible diphosphomevalonate decarboxylase [Enterococcus faecium
           TX1330]
 gi|257887849|ref|ZP_05667502.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,141,733]
 gi|257896533|ref|ZP_05676186.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com12]
 gi|257899514|ref|ZP_05679167.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com15]
 gi|293379312|ref|ZP_06625458.1| diphosphomevalonate decarboxylase [Enterococcus faecium PC4.1]
 gi|293572991|ref|ZP_06683933.1| diphosphomevalonate decarboxylase [Enterococcus faecium E980]
 gi|227179998|gb|EEI60970.1| possible diphosphomevalonate decarboxylase [Enterococcus faecium
           TX1330]
 gi|257823903|gb|EEV50835.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,141,733]
 gi|257833098|gb|EEV59519.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com12]
 gi|257837426|gb|EEV62500.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com15]
 gi|291606893|gb|EFF36273.1| diphosphomevalonate decarboxylase [Enterococcus faecium E980]
 gi|292642108|gb|EFF60272.1| diphosphomevalonate decarboxylase [Enterococcus faecium PC4.1]
          Length = 325

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 182/321 (56%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++  L LP+NNSLSL+L    T T +   DS  AD   L+  
Sbjct: 3   KGKARAYTNIALIKYWGKKNEALILPMNNSLSLTLDAFYTETEVIFSDSYIADEFYLDDT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGISLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|261207165|ref|ZP_05921854.1| mevalonate diphosphate decarboxylase [Enterococcus faecium TC 6]
 gi|289565286|ref|ZP_06445737.1| diphosphomevalonate decarboxylase [Enterococcus faecium D344SRF]
 gi|294615073|ref|ZP_06694959.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1636]
 gi|9937394|gb|AAG02446.1|AF290095_2 mevalonate diphosphate decarboxylase [Enterococcus faecium]
 gi|260078793|gb|EEW66495.1| mevalonate diphosphate decarboxylase [Enterococcus faecium TC 6]
 gi|289162942|gb|EFD10791.1| diphosphomevalonate decarboxylase [Enterococcus faecium D344SRF]
 gi|291592015|gb|EFF23638.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1636]
          Length = 325

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 182/321 (56%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDGT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVFV 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSNFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW   +++ M+ V   R+Q IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPNSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|329723157|gb|EGG59689.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU144]
          Length = 327

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 178/299 (59%), Gaps = 10/299 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T   D   DC+ILNG +++++  
Sbjct: 11  TNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTEDCLILNGNEVNAKEK 70

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K   + ++ R  +  +++  IE+ N +PT AGLASSAS +AAL  A     S+    
Sbjct: 71  --EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNEALSLNLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIIDR 204
             LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I ++
Sbjct: 129 TDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINNQ 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHAT
Sbjct: 187 SKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI-KQFF 322
            + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + +QFF
Sbjct: 247 NLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFF 305


>gi|283469882|emb|CAQ49093.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 327

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFIVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|257893353|ref|ZP_05673006.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,408]
 gi|257829732|gb|EEV56339.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,408]
          Length = 325

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 182/321 (56%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++  L LP+NNSLSL+L    T T +   DS  AD   L+  
Sbjct: 3   KGKARAYTNIALIKYWGKKNEALILPMNNSLSLTLDAFYTETEVIFSDSYIADEFYLDDT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGISLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWDKGHDDLSSYAKPVPSDSFEDDLAMVFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|15923581|ref|NP_371115.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926269|ref|NP_373802.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148267051|ref|YP_001245994.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393099|ref|YP_001315774.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156978920|ref|YP_001441179.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253316616|ref|ZP_04839829.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|255005384|ref|ZP_05143985.2| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257427378|ref|ZP_05603777.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430010|ref|ZP_05606394.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257432712|ref|ZP_05609072.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257435616|ref|ZP_05611664.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M876]
 gi|257793173|ref|ZP_05642152.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9781]
 gi|258407658|ref|ZP_05680793.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9763]
 gi|258420346|ref|ZP_05683291.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9719]
 gi|258436525|ref|ZP_05689183.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9299]
 gi|258442341|ref|ZP_05691104.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A8115]
 gi|258446287|ref|ZP_05694445.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6300]
 gi|258450054|ref|ZP_05698151.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6224]
 gi|269202213|ref|YP_003281482.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282895030|ref|ZP_06303252.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8117]
 gi|282904969|ref|ZP_06312827.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282907925|ref|ZP_06315759.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910234|ref|ZP_06318038.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282913427|ref|ZP_06321216.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282915916|ref|ZP_06323681.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus D139]
 gi|282918380|ref|ZP_06326117.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C427]
 gi|282923345|ref|ZP_06331025.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282928727|ref|ZP_06336322.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A10102]
 gi|283769746|ref|ZP_06342638.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus H19]
 gi|283957392|ref|ZP_06374845.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293500474|ref|ZP_06666325.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293509419|ref|ZP_06668130.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M809]
 gi|293524006|ref|ZP_06670693.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|295406969|ref|ZP_06816772.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8819]
 gi|296275506|ref|ZP_06858013.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297246130|ref|ZP_06929985.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8796]
 gi|297590518|ref|ZP_06949157.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|9937365|gb|AAG02425.1|AF290087_2 mevalonate diphosphate decarboxylase [Staphylococcus aureus]
 gi|13700483|dbj|BAB41780.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14246359|dbj|BAB56753.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147740120|gb|ABQ48418.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945551|gb|ABR51487.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156721055|dbj|BAF77472.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|257275571|gb|EEV07044.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257279207|gb|EEV09808.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257282127|gb|EEV12262.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284807|gb|EEV14926.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M876]
 gi|257787145|gb|EEV25485.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9781]
 gi|257840738|gb|EEV65196.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9763]
 gi|257843660|gb|EEV68064.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9719]
 gi|257848796|gb|EEV72782.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9299]
 gi|257852070|gb|EEV76002.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A8115]
 gi|257854881|gb|EEV77826.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6300]
 gi|257856673|gb|EEV79577.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6224]
 gi|262074503|gb|ACY10476.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282314213|gb|EFB44603.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282317514|gb|EFB47886.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C427]
 gi|282320212|gb|EFB50557.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus D139]
 gi|282322459|gb|EFB52781.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325626|gb|EFB55934.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282328170|gb|EFB58449.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282331794|gb|EFB61305.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282589610|gb|EFB94697.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A10102]
 gi|282762613|gb|EFC02751.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8117]
 gi|283459893|gb|EFC06983.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus H19]
 gi|283790843|gb|EFC29658.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816292|gb|ADC36779.1| Diphosphomevalonate decarboxylase [Staphylococcus aureus 04-02981]
 gi|290920969|gb|EFD98030.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095479|gb|EFE25740.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291467516|gb|EFF10031.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M809]
 gi|294968200|gb|EFG44226.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8819]
 gi|297176976|gb|EFH36232.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8796]
 gi|297576817|gb|EFH95532.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|312438988|gb|ADQ78059.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312829086|emb|CBX33928.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315128901|gb|EFT84899.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315193960|gb|EFU24354.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|329724387|gb|EGG60898.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 327

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|254556624|ref|YP_003063041.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum JDM1]
 gi|308180570|ref|YP_003924698.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|254045551|gb|ACT62344.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum JDM1]
 gi|308046061|gb|ADN98604.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 325

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 168/292 (57%), Gaps = 6/292 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D I  N Q + +  S
Sbjct: 10  TNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQIYFNHQHLPTGKS 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL  A  R   +   +
Sbjct: 70  --ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALAGAASRAAGLQLDA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
             LSR+AR GSGSA RS + GF EW  G D     +  +     W D+++  + +   +K
Sbjct: 128 ADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-DIQMIAVVLKATKK 186

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I S + M      SP++  W     TDL  ++QAI D+D   +G++AE NA++MHA  +
Sbjct: 187 PISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQIAETNAMRMHALNL 246

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +  +TI
Sbjct: 247 SAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQDTDTI 298


>gi|300767358|ref|ZP_07077270.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300495177|gb|EFK30333.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 336

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 168/292 (57%), Gaps = 6/292 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D I  N Q + +  S
Sbjct: 21  TNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQIYFNHQHLPTGKS 80

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL  A  R   +   +
Sbjct: 81  --ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALAGAASRAAGLQLDA 138

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
             LSR+AR GSGSA RS + GF EW  G D     +  +     W D+++  + +   +K
Sbjct: 139 ADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-DIQMIAVVLKATKK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I S + M      SP++  W     TDL  ++QAI D+D   +G++AE NA++MHA  +
Sbjct: 198 PISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQIAETNAMRMHALNL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +  +TI
Sbjct: 258 SAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQDTDTI 309


>gi|293556924|ref|ZP_06675485.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1039]
 gi|294617089|ref|ZP_06696756.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1679]
 gi|291596647|gb|EFF27873.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1679]
 gi|291601008|gb|EFF31299.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1039]
          Length = 325

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 183/321 (57%), Gaps = 9/321 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNGQ 81
           K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDGT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
               +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A    
Sbjct: 63  LQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNTA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  +
Sbjct: 121 LKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVFV 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N L
Sbjct: 181 LINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           KMH T +AA PP  YW  ++++ M+ V   R++ IP YFT+DAGPN+K+L  +    +++
Sbjct: 241 KMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKKGIPCYFTMDAGPNVKVLVENSHLSEVQ 300

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           ET  + F +  +I     P +
Sbjct: 301 ETFTKLFSKEQVITAHAGPGI 321


>gi|49482821|ref|YP_040045.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|295427133|ref|ZP_06819769.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|49240950|emb|CAG39617.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|295128921|gb|EFG58551.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus EMRSA16]
          Length = 327

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEGLIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|242372815|ref|ZP_04818389.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           M23864:W1]
 gi|242349487|gb|EES41088.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           M23864:W1]
          Length = 326

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 179/308 (58%), Gaps = 13/308 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG+K+  + +
Sbjct: 10  TNIALIKYWGKADEAYIIPMNNSLSITLDRFYTETKVTFDSSLTEDKLILNGEKVDDKET 69

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ D+ R+   +++Y +IE+ N +PT AGLASSAS +AAL  A      +    
Sbjct: 70  --AKIQKYMDIVREVADTELYAVIESENFVPTSAGLASSASAYAALAAACNEALHLGLSD 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPD-LRIGLLKIIDR 204
           + LSR+AR GSGSA RS + GF EW  G D     SFA P + Q W D L +  + I ++
Sbjct: 128 KDLSRLARRGSGSASRSIFGGFAEWEKGHDD--ATSFAHPIDAQHWEDELSMIFVVINNK 185

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR  S F+  W   +  DLA  K+AI  +DF  LGEV E N L+MHAT
Sbjct: 186 SKKVSSRSGMSLTRDTSRFYQYWLDHVDQDLADAKEAIHHKDFKHLGEVIEANGLRMHAT 245

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-TIKQF-- 321
            + A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++  I QF  
Sbjct: 246 NLGAQPPFTYMVQESYDAMAIVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAVIDQFLK 305

Query: 322 -FPEITII 328
            F E  II
Sbjct: 306 AFDEKQII 313


>gi|258455093|ref|ZP_05703055.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5937]
 gi|257862733|gb|EEV85499.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5937]
          Length = 327

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWFDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|258422778|ref|ZP_05685681.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9635]
 gi|257847009|gb|EEV71020.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9635]
          Length = 327

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 178/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEEFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYVEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|312871713|ref|ZP_07731801.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           3008A-a]
 gi|311092655|gb|EFQ51011.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           3008A-a]
          Length = 325

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 176/297 (59%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|82750296|ref|YP_416037.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus RF122]
 gi|82655827|emb|CAI80229.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus RF122]
          Length = 327

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N ++MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGMRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|27467280|ref|NP_763917.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           ATCC 12228]
 gi|282874951|ref|ZP_06283826.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           SK135]
 gi|9937380|gb|AAG02436.1|AF290091_2 mevalonate diphosphate decarboxylase [Staphylococcus epidermidis]
 gi|27314823|gb|AAO03959.1|AE016745_58 mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           ATCC 12228]
 gi|281296279|gb|EFA88798.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           SK135]
 gi|329735925|gb|EGG72201.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU028]
          Length = 327

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   DC+ILNG +++++ 
Sbjct: 11  TNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVT-FDPDFTEDCLILNGNEVNAKE 69

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N +PT AGLASSAS +AAL  A     S+   
Sbjct: 70  K--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNEALSLNLS 127

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 128 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINN 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 186 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 246 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 305

Query: 324 EI 325
           ++
Sbjct: 306 KV 307


>gi|251810013|ref|ZP_04824486.1| possible diphosphomevalonate decarboxylase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|251806464|gb|EES59121.1| possible diphosphomevalonate decarboxylase [Staphylococcus
           epidermidis BCM-HMP0060]
          Length = 326

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 178/301 (59%), Gaps = 9/301 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T   D   DC+ILNG +++++  
Sbjct: 10  TNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTEDCLILNGNEVNAKEK 69

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K   + ++ R  +  +++  IE+ N +PT AGLASSAS +AAL  A     S+    
Sbjct: 70  --EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNEALSLNLSD 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIIDR 204
             LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I ++
Sbjct: 128 TDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINNQ 185

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHAT
Sbjct: 186 SKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHAT 245

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F +
Sbjct: 246 NLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFLK 305

Query: 325 I 325
           +
Sbjct: 306 V 306


>gi|332639847|pdb|3QT5|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase
 gi|332639848|pdb|3QT5|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase
 gi|332639849|pdb|3QT6|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor Dpgp
 gi|332639850|pdb|3QT6|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor Dpgp
 gi|332639851|pdb|3QT7|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor
           6-Fmvapp
 gi|332639852|pdb|3QT7|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor
           6-Fmvapp
          Length = 332

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   DC+ILNG +++++ 
Sbjct: 16  TNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVT-FDPDFTEDCLILNGNEVNAKE 74

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N +PT AGLASSAS +AAL  A     S+   
Sbjct: 75  K--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNEALSLNLS 132

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 133 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINN 190

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 191 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 250

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 251 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 310

Query: 324 EI 325
           ++
Sbjct: 311 KV 312


>gi|309803981|ref|ZP_07698063.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           11V1-d]
 gi|308163900|gb|EFO66165.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           11V1-d]
          Length = 325

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 175/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R   I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRNNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|239636793|ref|ZP_04677795.1| diphosphomevalonate decarboxylase [Staphylococcus warneri L37603]
 gi|239598148|gb|EEQ80643.1| diphosphomevalonate decarboxylase [Staphylococcus warneri L37603]
          Length = 327

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 179/300 (59%), Gaps = 12/300 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D KL +P+NNSLS+SL    T T +T  DSD  AD +ILNG++ + + 
Sbjct: 11  TNIALIKYWGKADEKLIIPMNNSLSVSLDKFYTETKVT-FDSDYPADQLILNGKEANEKE 69

Query: 88  SFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           +  KK   + D+ R+ +   ++  I++ N +PT AGLASSAS +AAL  A      +   
Sbjct: 70  T--KKIQSYMDIVREIANTDLHTRIDSQNFVPTAAGLASSASAYAALAAACNEALQLELS 127

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWPD-LRIGLLKIID 203
            + LSR+AR GSGSA RS + GF EW  G D     S+A P + + W D L +  + I +
Sbjct: 128 DKDLSRLARRGSGSASRSIFGGFAEWEKGHDDET--SYAHPIDADHWEDELSMIFVVINN 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  D+   KQAI  +DF +LGEV E N L+MHA
Sbjct: 186 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDIKEAKQAIEAKDFKQLGEVIEANGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-TIKQFF 322
           T + + PP  Y  +E+   M  V + R+  +P YFT+DAGPN+K+L   K ++  I QF 
Sbjct: 246 TNLGSQPPFTYLVQESYDAMAIVHECRKMGVPCYFTMDAGPNVKVLVEKKNKQLVIDQFL 305


>gi|312875613|ref|ZP_07735614.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2053A-b]
 gi|325912578|ref|ZP_08174961.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 60-B]
 gi|311088867|gb|EFQ47310.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2053A-b]
 gi|325477999|gb|EGC81128.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 60-B]
          Length = 325

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 175/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ +  Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVDDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|329920253|ref|ZP_08277037.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN 1401G]
 gi|328936298|gb|EGG32746.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN 1401G]
          Length = 325

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 175/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ +  Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVDDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDI 296


>gi|325912161|ref|ZP_08174559.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 143-D]
 gi|325476111|gb|EGC79279.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 143-D]
          Length = 325

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 176/297 (59%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMLIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDI 296


>gi|323442137|gb|EGA99771.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus O46]
          Length = 327

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 178/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|21282275|ref|NP_645363.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49485457|ref|YP_042678.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651466|ref|YP_185522.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87162286|ref|YP_493276.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194352|ref|YP_499145.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151220766|ref|YP_001331588.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161508830|ref|YP_001574489.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141881|ref|ZP_03566374.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450955|ref|ZP_05699007.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5948]
 gi|262049685|ref|ZP_06022552.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus D30]
 gi|282925434|ref|ZP_06333089.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9765]
 gi|284023606|ref|ZP_06378004.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 132]
 gi|294849236|ref|ZP_06789979.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9754]
 gi|297208693|ref|ZP_06925121.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300912784|ref|ZP_07130226.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381809|ref|ZP_07364456.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|21203712|dbj|BAB94411.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49243900|emb|CAG42325.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57285652|gb|AAW37746.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87128260|gb|ABD22774.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87201910|gb|ABD29720.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150373566|dbj|BAF66826.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160367639|gb|ABX28610.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|257861375|gb|EEV84184.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5948]
 gi|259162228|gb|EEW46803.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus D30]
 gi|269940163|emb|CBI48539.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282592528|gb|EFB97539.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9765]
 gi|294823768|gb|EFG40194.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9754]
 gi|296886638|gb|EFH25543.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|298693921|gb|ADI97143.1| Diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300885888|gb|EFK81091.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302750481|gb|ADL64658.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339595|gb|EFM05542.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|315196518|gb|EFU26867.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139842|gb|EFW31704.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320141825|gb|EFW33653.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|329313312|gb|AEB87725.1| Mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329729931|gb|EGG66323.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 327

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 178/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDMQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|302332303|gb|ADL22496.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 327

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 179/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D  +LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFMLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFNNQWPDLRIGLLKII--D 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP  +   +  + ++ ++   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESDHFEDELAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|323439454|gb|EGA97176.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus O11]
          Length = 327

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 178/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|282903182|ref|ZP_06311073.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282596137|gb|EFC01098.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C160]
          Length = 327

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 175/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK  SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKAPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|257424709|ref|ZP_05601136.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257272279|gb|EEV04402.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 55/2053]
          Length = 327

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 175/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DLA  K  I D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAVIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|253732970|ref|ZP_04867135.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|253729150|gb|EES97879.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH130]
          Length = 327

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/294 (42%), Positives = 175/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDR 204
           + LSR+AR+GSGSA RS Y GF EW  G   N   S+AVP   N+   DL +  + I   
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGY--NDETSYAVPLESNHFEDDLAMIFVVINQH 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W   I  DL   K AI D+DF +LGEV E+N L+MHAT
Sbjct: 187 SKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLTEAKAAIQDKDFKRLGEVIEENGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 247 NLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|149241985|pdb|2HK2|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 gi|149241986|pdb|2HK2|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 gi|149241989|pdb|2HK3|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
 gi|149241990|pdb|2HK3|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
          Length = 331

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 178/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 15  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 73

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 74  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDMQLSD 132

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 133 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 189

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 190 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 249

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 250 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 304


>gi|332639853|pdb|3QT8|A Chain A, Crystal Structure Of Mutant S192a Staphylococcus
           Epidermidis Mevalonate Diphosphate Decarboxylase
           Complexed With Inhibitor 6- Fmvapp
 gi|332639854|pdb|3QT8|B Chain B, Crystal Structure Of Mutant S192a Staphylococcus
           Epidermidis Mevalonate Diphosphate Decarboxylase
           Complexed With Inhibitor 6- Fmvapp
          Length = 332

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   DC+ILNG +++++ 
Sbjct: 16  TNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVT-FDPDFTEDCLILNGNEVNAKE 74

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N +PT AGLASSAS +AAL  A     S+   
Sbjct: 75  K--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNEALSLNLS 132

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 133 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINN 190

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ +R  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 191 QSKKVSARSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 250

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 251 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 310

Query: 324 EI 325
           ++
Sbjct: 311 KV 312


>gi|309809852|ref|ZP_07703702.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN
           2503V10-D]
 gi|308169804|gb|EFO71847.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN
           2503V10-D]
          Length = 325

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 174/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ +  Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTDTEFTHNVDLANDMVIMNGKAVDDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + LL I +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTLLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTRGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMQSFSYFQSTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDI 296


>gi|90961661|ref|YP_535577.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius UCC118]
 gi|301300768|ref|ZP_07206952.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|90820855|gb|ABD99494.1| Diphosphomevalonate decarboxylase [Lactobacillus salivarius UCC118]
 gi|300851618|gb|EFK79318.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 322

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 188/308 (61%), Gaps = 13/308 (4%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           ++  ++A   +NIAL KYWGK+D++L LP+NNSLSL+L H  T T +T   S   D  IL
Sbjct: 1   MSNHAAARAHTNIALIKYWGKKDTELILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFIL 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NG++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A 
Sbjct: 61  NGKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAA 115

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
            +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVPF  N  W D+
Sbjct: 116 SKASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSW-DI 172

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
           ++  + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+A
Sbjct: 173 KMIAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANRSIPLMKEAISKQDFTTMGELA 232

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K 
Sbjct: 233 EENAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKD 292

Query: 315 EETIKQFF 322
             +I  F 
Sbjct: 293 TASITSFL 300


>gi|227890749|ref|ZP_04008554.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius ATCC
           11741]
 gi|227867687|gb|EEJ75108.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius ATCC
           11741]
          Length = 322

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 188/308 (61%), Gaps = 13/308 (4%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           ++  ++A   +NIAL KYWGK+D++L LP+NNSLSL+L H  T T +T   S   D  IL
Sbjct: 1   MSNHAAARAHTNIALIKYWGKKDTELILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFIL 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NG++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A 
Sbjct: 61  NGKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAA 115

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
            +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVPF  N  W D+
Sbjct: 116 SKASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSW-DI 172

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
           ++  + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+A
Sbjct: 173 KMIAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANCSIPLMKEAISKQDFTTMGELA 232

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K 
Sbjct: 233 EENAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKD 292

Query: 315 EETIKQFF 322
             +I  F 
Sbjct: 293 TASITSFL 300


>gi|315641783|ref|ZP_07896787.1| diphosphomevalonate decarboxylase [Enterococcus italicus DSM 15952]
 gi|315482458|gb|EFU72997.1| diphosphomevalonate decarboxylase [Enterococcus italicus DSM 15952]
          Length = 330

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 174/296 (58%), Gaps = 9/296 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQ 81
           K  A   +NIAL KYWGK +  L LP NNSLSL+L    T T +   + +  DC  L+G 
Sbjct: 3   KGKARAYTNIALIKYWGKENQALILPKNNSLSLTLDGFYTETEVLFTEEATKDCFYLDGV 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S Q++  KK T F +L R+ +   F  ++ + N++PT AGLASSASG AAL  A  + 
Sbjct: 63  KQSEQAT--KKVTTFLNLVRERANCPFFAVVRSHNHVPTAAGLASSASGLAALAGACNQA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WP-DLRIG 197
             +    + LS++AR GSGSACRS + GF EW  G       S+A+P + Q W  +L + 
Sbjct: 121 LGLNLAPKELSKLARRGSGSACRSIFGGFVEWDRGDSDE--TSYALPIDAQGWEQELAMI 178

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            L I D+ K + SRE M+ T   S F+ QW ++   DL   K+AI   DF KLG V E N
Sbjct: 179 FLLINDQPKDVSSREGMQRTVETSAFYPQWVKEAQADLHIAKEAIQHHDFQKLGTVMEAN 238

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           ALKMHAT +AA PP  YW  ++++ M  V   RQ  +  YFT+DAGPN+K+L   K
Sbjct: 239 ALKMHATTLAAVPPFTYWSPDSLRAMNLVRSIRQAGLFCYFTMDAGPNVKVLCQKK 294


>gi|70727400|ref|YP_254316.1| mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68448126|dbj|BAE05710.1| mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 327

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 178/307 (57%), Gaps = 7/307 (2%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           K N K+ A   +NIAL KYWGK D  L +P+NNSLS++L    T T +T  ++   D +I
Sbjct: 2   KKNGKARAH--TNIALIKYWGKADEALIIPMNNSLSVTLDRFYTETRVTFDETLTEDQLI 59

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LNG+ ++++ S   K  ++ ++ R+ + +  + LIE+ N +PT AGLASSAS +AAL  A
Sbjct: 60  LNGEAVNAKES--AKIQRYMEMIRKEAGISEHALIESENFVPTAAGLASSASAYAALAGA 117

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
                 +    + LSR+AR GSGSA RS Y GF EW  G D     +  V  +    +L 
Sbjct: 118 CNEALQLGLSDKDLSRLARRGSGSASRSIYGGFAEWEKGNDDETSFAHRVEADGWENELA 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + I ++ KK+ SR  M +TR  S F+  W   +  DL  IK+AI  +DF ++GEV E
Sbjct: 178 MVFVVINNKSKKVSSRSGMSLTRDTSRFYQYWLDNVEPDLKEIKEAIAQKDFKRMGEVIE 237

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
            N L+MHAT + A PP  Y   E+   M  V + R+  +P YFT+DAGPN+K+L   K +
Sbjct: 238 ANGLRMHATNLGAQPPFTYLVPESYDAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKNQ 297

Query: 316 ETIKQFF 322
           + I   F
Sbjct: 298 QAIVDKF 304


>gi|73663430|ref|YP_302211.1| mevalonate diphosphate decarboxylase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495945|dbj|BAE19266.1| mevalonate diphosphate decarboxylase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 327

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 122/313 (38%), Positives = 182/313 (58%), Gaps = 5/313 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  +S   D +ILNG+ +++  S
Sbjct: 11  TNIALIKYWGKADETYIIPMNNSLSVALERFYTETKVTFDESYTKDTLILNGETVTASES 70

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++F D+ R  S   ++  IE+ N++PT AGLASSAS +AAL  A  +  ++    
Sbjct: 71  --AKISRFMDIVRATSGTTMFAYIESDNHVPTAAGLASSASAYAALAAACDKALNLGLTG 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     SF +  ++   +L +  + I ++ K
Sbjct: 129 KGLSRLARRGSGSASRSIYGGFVEWEKGHDDESSYSFPIEADHWEQELAMIFVVINNKTK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M  TR  S F+  W   +  D+A +K AI  +DF+++GEV E N L+MHAT +
Sbjct: 189 KVSSRAGMSHTRDTSRFYQYWLNHVDEDIASVKHAIERKDFMQMGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
            A PP  Y  +++   M+ V   R+   P YFT+DAGPN+K+L   K ++ +     +  
Sbjct: 249 GAQPPFTYMVEDSYLAMDIVDQCRKAGYPCYFTMDAGPNVKILVEKKNQQAVIDALHKSF 308

Query: 327 IIDPLDSPDLWST 339
             D + + D+ ST
Sbjct: 309 DKDQIIASDIIST 321


>gi|312873036|ref|ZP_07733096.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2062A-h1]
 gi|311091558|gb|EFQ49942.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2062A-h1]
          Length = 325

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 174/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
                 +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  -----CRIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSRVARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L I +
Sbjct: 124 LNRQELSRVARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAIEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D   K+I S   M+I +  SPF+  W      +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSPKEISSTCGMKIAQ-TSPFYQTWLNLNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|253731202|ref|ZP_04865367.1| possible diphosphomevalonate decarboxylase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253724943|gb|EES93672.1| possible diphosphomevalonate decarboxylase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
          Length = 327

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 177/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDLQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DL   K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLTEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|312874200|ref|ZP_07734234.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2052A-d]
 gi|311090270|gb|EFQ48680.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2052A-d]
          Length = 325

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 175/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L + +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAVEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D  +K I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSQKDISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMQSFSYFQSTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|224475737|ref|YP_002633343.1| mevalonate diphosphate decarboxylase [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420344|emb|CAL27158.1| mevalonate diphosphate decarboxylase [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 331

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 120/294 (40%), Positives = 176/294 (59%), Gaps = 9/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D  L +P+NNS+SL+L    T T +T   + + D   LNG+K + + +
Sbjct: 11  TNIALIKYWGKADETLIIPMNNSISLTLDKFYTETRVTFDPTFEEDTFFLNGEKANEKET 70

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K + + D+ R+ +  +    I+++N +PT AGLASSAS FAAL  A      +    
Sbjct: 71  --QKISAYLDIVRKQAGTHTKASIDSTNFVPTAAGLASSASAFAALAAACNEALEMRLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPD-LRIGLLKIIDR 204
           + LSR+AR GSGSACRS + GF EW  G D     S++ P + + W D L +  + I ++
Sbjct: 129 KDLSRLARRGSGSACRSIFGGFAEWEKGHDD--ASSYSHPIDAEHWEDELSMIFVVINNK 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +TR+ S F+  W  ++  D+   K AI D+DF +LGEV E N L+MHAT
Sbjct: 187 SKKVKSRAGMSLTRNTSRFYQYWLDRVEADIEEAKAAIKDKDFKRLGEVFEANGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + A PP  Y   ++ + M  V D R+  IP YFT+DAGPN+K+L   K ++ +
Sbjct: 247 NLGAEPPFTYLVSDSYEAMSLVHDCREAGIPAYFTMDAGPNVKVLVQKKDQQAV 300


>gi|300214466|gb|ADJ78882.1| Diphosphomevalonate decarboxylase [Lactobacillus salivarius CECT
           5713]
          Length = 322

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 187/308 (60%), Gaps = 13/308 (4%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           ++  ++A   +NIAL KYWGK+D++  LP+NNSLSL+L H  T T +T   S   D  IL
Sbjct: 1   MSNHAAARAHTNIALIKYWGKKDTEFILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFIL 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NG++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A 
Sbjct: 61  NGKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAA 115

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
            +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVPF  N  W D+
Sbjct: 116 SKASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSW-DI 172

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
           ++  + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+A
Sbjct: 173 KMIAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANRSIPLMKEAISKQDFTTMGELA 232

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K 
Sbjct: 233 EENAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKD 292

Query: 315 EETIKQFF 322
             +I  F 
Sbjct: 293 TASITSFL 300


>gi|319400100|gb|EFV88336.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           FRI909]
          Length = 327

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   D +ILNG +++++ 
Sbjct: 11  TNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVT-FDPDFTEDRLILNGNEVNAKE 69

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N++PT AGLASSAS +AAL  A     S+   
Sbjct: 70  K--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNEALSLNLS 127

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 128 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHEINSNGWEKDLSMIFVVINN 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 186 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 246 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 305

Query: 324 EI 325
           ++
Sbjct: 306 KV 307


>gi|259500611|ref|ZP_05743513.1| diphosphomevalonate decarboxylase [Lactobacillus iners DSM 13335]
 gi|302191300|ref|ZP_07267554.1| mevalonate pyrophosphate decarboxylase [Lactobacillus iners AB-1]
 gi|259167995|gb|EEW52490.1| diphosphomevalonate decarboxylase [Lactobacillus iners DSM 13335]
          Length = 325

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 175/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ ++ Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVNDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L + +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAVEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D  +K I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSQKDISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMQSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDI 296


>gi|242241930|ref|ZP_04796375.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           W23144]
 gi|242234627|gb|EES36939.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           W23144]
          Length = 326

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   D +ILNG +++++ 
Sbjct: 10  TNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVT-FDPDFTEDRLILNGNEVNAKE 68

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N++PT AGLASSAS +AAL  A     S+   
Sbjct: 69  K--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNEALSLNLS 126

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 127 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHEINSNGWEKDLSMIFVVINN 184

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 185 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 244

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 245 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 304

Query: 324 EI 325
           ++
Sbjct: 305 KV 306


>gi|293367975|ref|ZP_06614611.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291317904|gb|EFE58314.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 326

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   D +ILNG +++++ 
Sbjct: 10  TNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVT-FDPDFTEDRLILNGNEVNAKE 68

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N++PT AGLASSAS +AAL  A     S+   
Sbjct: 69  K--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNEALSLNLS 126

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 127 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINN 184

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 185 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 244

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 245 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 304

Query: 324 EI 325
           ++
Sbjct: 305 KV 306


>gi|57866188|ref|YP_187835.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           RP62A]
 gi|57636846|gb|AAW53634.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           RP62A]
 gi|329736912|gb|EGG73174.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU045]
          Length = 327

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 179/302 (59%), Gaps = 11/302 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D    +P+NNSLS++L    T T +T  D D   D +ILNG +++++ 
Sbjct: 11  TNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVT-FDPDFTEDRLILNGNEVNAKE 69

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K   + ++ R  +  +++  IE+ N++PT AGLASSAS +AAL  A     S+   
Sbjct: 70  K--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNEALSLNLS 127

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWP-DLRIGLLKIID 203
              LSR+AR GSGSA RS + GF EW  G D   + S+A   N N W  DL +  + I +
Sbjct: 128 DTDLSRLARRGSGSASRSIFGGFAEWEKGHDD--LTSYAHGINSNGWEKDLSMIFVVINN 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N L+MHA
Sbjct: 186 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           T + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ + + F 
Sbjct: 246 TNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAVMEQFL 305

Query: 324 EI 325
           ++
Sbjct: 306 KV 307


>gi|330685899|gb|EGG97528.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU121]
          Length = 327

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 178/300 (59%), Gaps = 12/300 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGK D KL +P+NNSLS+SL    T T +T  DSD  AD +ILNG+  + + 
Sbjct: 11  TNIALIKYWGKADEKLIIPMNNSLSVSLDKFYTETEVT-FDSDYPADQLILNGKVANEKE 69

Query: 88  SFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           +  KK   + D+ R+   + ++  I++ N +PT AGLASSAS +AAL  A      +   
Sbjct: 70  T--KKIQSYMDIVREIAGTDLHARIDSQNFVPTAAGLASSASAYAALATACNEALQLNLS 127

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWPD-LRIGLLKIID 203
            + LSR+AR GSGSA RS + GF EW  G D     S+A P + + W D L +  + I +
Sbjct: 128 DKDLSRLARRGSGSASRSIFGGFAEWEKGHDDET--SYAHPIDADHWEDELSMIFVVINN 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           + KK+ SR  M +TR  S F+  W   +  D+   KQAI  +DF +LGEV E N L+MHA
Sbjct: 186 QSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDIKEAKQAIEAKDFQQLGEVIEANGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-TIKQFF 322
           T + + PP  Y  +E+   M  V + R+  +P YFT+DAGPN+K+L   K ++  I QF 
Sbjct: 246 TNLGSQPPFTYLVQESYDAMAIVHECREMGVPCYFTMDAGPNVKVLVEKKNKQLVINQFL 305


>gi|315653557|ref|ZP_07906477.1| diphosphomevalonate decarboxylase [Lactobacillus iners ATCC 55195]
 gi|315488919|gb|EFU78561.1| diphosphomevalonate decarboxylase [Lactobacillus iners ATCC 55195]
          Length = 325

 Score =  192 bits (487), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 174/297 (58%), Gaps = 17/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS L +PL +S+S++L    T T  T  +D   D +I+NG+ +  Q+S
Sbjct: 9   TNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVDDQAS 68

Query: 89  FFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +  +  ++   +Y     F I+T N++PT AGLASSASGFAAL  +    Y++ 
Sbjct: 69  Y-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNLN 123

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-I 202
              + LSR+ARLGSGSA RS + GF EW  G D     SFA P  N+ P + + +L + +
Sbjct: 124 LNRQELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPI-NEHPQMDLTMLAVEL 180

Query: 203 D-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           D  +K I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +M
Sbjct: 181 DVSQKDISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           H+  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 240 HSLNLTAMQSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDI 296


>gi|289551605|ref|YP_003472509.1| Diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659059|ref|ZP_07911925.1| diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           M23590]
 gi|289181136|gb|ADC88381.1| Diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495870|gb|EFU84199.1| diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           M23590]
          Length = 327

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 183/315 (58%), Gaps = 9/315 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIA+ KYWGK+D  L +P+NNSLS++L    T T +T   S ++D +ILNG+ +S+  +
Sbjct: 11  TNIAVIKYWGKKDEALIIPMNNSLSVTLERFYTETQVTFNHSYNSDQLILNGEHVSATEN 70

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K  +F D+ R  + +  + LIE++N++PT AGLASSAS +AAL  A      +    
Sbjct: 71  --QKIQRFMDIVRAKAGITMHALIESTNHVPTAAGLASSASAYAALAAACNEALELQMTD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WP-DLRIGLLKIIDR 204
           + LSR+AR GSGSA RS + GF EW  G D   + S+A   + + W  DL +  + I  +
Sbjct: 129 KDLSRLARRGSGSASRSIFGGFVEWHKGYDD--LTSYAEQIDAKDWEKDLAMIFIVINKQ 186

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KK+ SR  M +T+  S F+  W   +  DLA  K AI  +DF + GE  E N L+MHAT
Sbjct: 187 SKKVSSRAGMSLTKETSRFYQYWLDYVEQDLADAKAAIKTKDFQRFGETIEANGLRMHAT 246

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            + A PP  Y   E+   ME V   R+  IP YFT+DAGPN+K++   K  + ++  F E
Sbjct: 247 NLGAQPPFTYLVPESYLAMEIVHQCRENGIPCYFTMDAGPNVKVIVEKKNLQAVQSAFEE 306

Query: 325 ITIIDPLDSPDLWST 339
                 + S D+ S+
Sbjct: 307 TFETSQIMSSDIISS 321


>gi|9937373|gb|AAG02431.1|AF290089_2 mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus]
          Length = 327

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 172/296 (58%), Gaps = 5/296 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D  L +P+NNSLS++L    T T +T  ++   D +ILNG+ ++++ S
Sbjct: 11  TNIALIKYWGKADEALIIPMNNSLSVTLDRFYTETRVTFDETLTEDQLILNGEAVNAKES 70

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K  ++ ++ R+ + +  + LIE+ N +PT AGLASSAS +AAL  A      +    
Sbjct: 71  --AKIQRYMEMIRKEAGISEHALIESENFVPTAAGLASSASAYAALAGACNEALQLGLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSA RS Y GF EW  G D     +  V  +    +L +  + I ++ K
Sbjct: 129 KDLSRLARRGSGSASRSIYGGFAEWEKGNDDETSFAHRVEADGWENELAMVFVVINNKSK 188

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ SR  M +TR  S F+  W   +  DL   K+AI  +DF ++GEV E N L+MHAT +
Sbjct: 189 KVSSRSGMSLTRDTSRFYQYWLDNVEPDLKETKEAIAQKDFKRMGEVIEANGLRMHATNL 248

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
            A PP  Y   E+   M  V + R+  +P YFT+DAGPN+K+L   K ++ I   F
Sbjct: 249 GAQPPFTYLVPESYDAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKNQQAIVDKF 304


>gi|329729707|gb|EGG66108.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 327

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 177/295 (60%), Gaps = 11/295 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG+K+S +  
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNGEKVSGKE- 69

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +    
Sbjct: 70  -LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDMQLSD 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
           + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I  
Sbjct: 129 KDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVINQ 185

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MHA
Sbjct: 186 HSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMHA 245

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           T + ++P   Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 TNLGSTPSFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300


>gi|262051920|ref|ZP_06024134.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus
           930918-3]
 gi|259160177|gb|EEW45207.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus
           930918-3]
          Length = 328

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 179/296 (60%), Gaps = 12/296 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTI-THITVIDS-DADCIILNGQKISSQS 87
           +NIAL KYWGK+D  L +P+NNS+S++L    T+ T +T  D    D   LNG+K+S + 
Sbjct: 11  TNIALIKYWGKKDEALIIPMNNSISVTLSKNFTLETKVTFNDQLTQDQFWLNGEKVSGKE 70

Query: 88  SFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A  +   +   
Sbjct: 71  --LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQALDMQLS 128

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
            + LSR+AR+GSGSA RS Y GF EW  G +D+    S+AVP   N+   DL +  + I 
Sbjct: 129 DKDLSRLARIGSGSASRSIYGGFAEWEKGYSDET---SYAVPLESNHFEDDLAMIFVVIN 185

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N L+MH
Sbjct: 186 QHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENGLRMH 245

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           AT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 246 ATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 301


>gi|9937387|gb|AAG02441.1|AF290093_2 mevalonate diphosphate decarboxylase [Enterococcus faecalis]
          Length = 331

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  ILNG  I     
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILNG--ILQNEK 67

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 68  QTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|307275320|ref|ZP_07556463.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2134]
 gi|306507954|gb|EFM77081.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2134]
          Length = 341

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  ILNG  I     
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILNG--ILQNEK 77

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 78  QTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 137

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 138 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 198 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 258 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|40882372|dbj|BAD07376.1| mevalonate diphosphate decarboxylase [Actinoplanes sp. A40644]
          Length = 334

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 175/320 (54%), Gaps = 22/320 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQ 81
           ++A    NIAL KYWGK D +L +P  +SLS++L  L T+T +  +DS    D + L+G 
Sbjct: 6   ATAVAHPNIALIKYWGKSDERLMIPYVDSLSMTLNILPTVTTVA-LDSGVRTDQVTLDGS 64

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
              ++  F ++   F DL R  +      +++T N +PT AGLASSASGFAAL +A    
Sbjct: 65  P--AKGDFRQRVVTFLDLLRAMAGRDDRAVVDTRNVVPTGAGLASSASGFAALAVAGAAA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS-----FA--VPFNNQWP 192
           Y +     +LSR+AR GS SA RS + GF   IC   Q G ++     FA  VP     P
Sbjct: 123 YGLDLDPTALSRLARRGSASASRSIFGGFA--ICHAGQGGGEAADQSAFAEPVPVTGLDP 180

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
            L I L+      K + SREAM  T   SP +  W      DLA ++ A+   D   +GE
Sbjct: 181 ALVIALVNA--GPKAVSSREAMRRTVATSPLYQSWAASSKIDLAEMRAALHHGDLAVVGE 238

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF-- 310
           +AE+NAL+MHATM+AA P + Y   +T+  ++ V   R   I  Y T+DAGPN+K+L   
Sbjct: 239 IAERNALRMHATMLAARPAVRYLSADTVTVLDSVLRLRADGIAAYATMDAGPNVKVLCHR 298

Query: 311 --THKIEETIKQFFPEITII 328
               ++ + ++   P+ +++
Sbjct: 299 ADAGRVADAVRAAVPDCSVL 318


>gi|54024177|ref|YP_118419.1| putative diphosphomevalonate decarboxylase [Nocardia farcinica IFM
           10152]
 gi|54015685|dbj|BAD57055.1| putative diphosphomevalonate decarboxylase [Nocardia farcinica IFM
           10152]
          Length = 346

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 164/284 (57%), Gaps = 7/284 (2%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGKRD    LP+  SLSL++    T T + +ID  AD + L+G+  S  +   
Sbjct: 26  NIALIKYWGKRDETAVLPVTASLSLTVNIFPTTTAVALIDGPADIVTLDGKPASGPA--L 83

Query: 91  KKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
            +  +F DL R  +      ++ + N+ PT AGLASSASGFAAL  A   ++ +   + S
Sbjct: 84  ARVVRFLDLVRARAGRADRVMVISVNSGPTGAGLASSASGFAALAAAAATVFGLDRDARS 143

Query: 149 LSRVARLGSGSACRSFYRGFCEWICG---TDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
           LSR+AR GSGSACRS + GF  W  G    +   + S+A P  +   D  + +  +    
Sbjct: 144 LSRLARRGSGSACRSIFGGFAVWHAGEGLGEAGDLGSYAEPVEDGGLDPALVVAVVDAAA 203

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K + SREAM  TR  SP +  W    +TDL  ++ A+   D  ++GE+AE+NAL MHATM
Sbjct: 204 KAVSSREAMRRTRATSPLYGAWAASSATDLTRMRAALARGDLAEVGEIAERNALGMHATM 263

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           +AA P + Y    ++  ++RV   R + +P Y T+DAGPN+K+L
Sbjct: 264 LAARPAIRYLSPHSLAVLDRVLALRAEGVPAYATMDAGPNVKIL 307


>gi|257415465|ref|ZP_05592459.1| diphosphomevalonate decarboxylase [Enterococcus faecalis AR01/DG]
 gi|257157293|gb|EEU87253.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ARO1/DG]
          Length = 331

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDTHYSEDVFILDG--ILQNEK 67

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 68  QTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIVEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|294781313|ref|ZP_06746659.1| diphosphomevalonate decarboxylase [Enterococcus faecalis PC1.1]
 gi|307267978|ref|ZP_07549366.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4248]
 gi|307278402|ref|ZP_07559477.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0860]
 gi|294451649|gb|EFG20105.1| diphosphomevalonate decarboxylase [Enterococcus faecalis PC1.1]
 gi|306504908|gb|EFM74103.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0860]
 gi|306515619|gb|EFM84146.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4248]
 gi|315032468|gb|EFT44400.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0017]
 gi|315034298|gb|EFT46230.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0027]
 gi|329577895|gb|EGG59316.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1467]
          Length = 341

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 170/298 (57%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G   + + +
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGTLQNEKQT 79

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 80  --KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 137

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 138 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 198 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 258 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|255973972|ref|ZP_05424558.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T2]
 gi|256761657|ref|ZP_05502237.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T3]
 gi|256957240|ref|ZP_05561411.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DS5]
 gi|257077786|ref|ZP_05572147.1| diphosphomevalonate decarboxylase [Enterococcus faecalis JH1]
 gi|255966844|gb|EET97466.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T2]
 gi|256682908|gb|EEU22603.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T3]
 gi|256947736|gb|EEU64368.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DS5]
 gi|256985816|gb|EEU73118.1| diphosphomevalonate decarboxylase [Enterococcus faecalis JH1]
          Length = 331

 Score =  189 bits (481), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 170/298 (57%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G   + + +
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGTLQNEKQT 69

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 70  --KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|295397032|ref|ZP_06807146.1| diphosphomevalonate decarboxylase [Aerococcus viridans ATCC 11563]
 gi|294974723|gb|EFG50436.1| diphosphomevalonate decarboxylase [Aerococcus viridans ATCC 11563]
          Length = 337

 Score =  189 bits (481), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 180/300 (60%), Gaps = 9/300 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK +  L +P  +SLSL+L  L T T +T  +  DAD   LN Q  +   +
Sbjct: 12  TNIALIKYWGKANKDLFIPTTSSLSLTLDALYTDTRVTFSNELDADIFYLNNQLRNEAET 71

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK- 145
              K ++F D+FRQ + V     +E+ N++PT AGLASS+S F+AL  A  +  ++ ++ 
Sbjct: 72  --AKISKFLDMFRQEAGVDLRAKVESVNHVPTAAGLASSSSAFSALAAATRQALNLEDQI 129

Query: 146 -SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             ++LS  AR GSGSA RS + GF EW  GT     +S AV  ++   D+ + ++ I   
Sbjct: 130 SDQALSTFARQGSGSATRSIFGGFVEWQKGTTNE--NSMAVEIDDASWDVGMVIMAINTA 187

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           EK++ SRE M  T   SPF+ +W +Q   DL  IK AI  QDF  +GE+AE NA++MHAT
Sbjct: 188 EKRVSSREGMAHTMQTSPFYPEWVRQNMIDLERIKAAIAKQDFQLMGEIAEANAMRMHAT 247

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            +A+ P   Y++ +TI+ ++ V D R   +  Y+T+DAGPN+K+L      + ++ FF E
Sbjct: 248 TMASDPSFTYFEPDTIKAIQAVQDLRATGVLAYYTIDAGPNVKVLCKASQMDEVEAFFAE 307


>gi|256617771|ref|ZP_05474617.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ATCC 4200]
 gi|257089313|ref|ZP_05583674.1| diphosphomevalonate decarboxylase [Enterococcus faecalis CH188]
 gi|256597298|gb|EEU16474.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ATCC 4200]
 gi|256998125|gb|EEU84645.1| diphosphomevalonate decarboxylase [Enterococcus faecalis CH188]
          Length = 331

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 67

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 68  QTKKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|312904462|ref|ZP_07763621.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0635]
 gi|310632160|gb|EFQ15443.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0635]
 gi|315577315|gb|EFU89506.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0630]
          Length = 341

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 77

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 78  QTKKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 137

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 138 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 198 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 258 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|256964278|ref|ZP_05568449.1| diphosphomevalonate decarboxylase [Enterococcus faecalis HIP11704]
 gi|256954774|gb|EEU71406.1| diphosphomevalonate decarboxylase [Enterococcus faecalis HIP11704]
          Length = 331

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 67

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 68  QTKKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVKKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|307271902|ref|ZP_07553170.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0855]
 gi|306511408|gb|EFM80410.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0855]
 gi|315172005|gb|EFU16022.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1342]
          Length = 341

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 77

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 78  QTKKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 137

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 138 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 198 DVSSRDGMKRTVETSSFYQGWLDNVKKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 258 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|227517822|ref|ZP_03947871.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX0104]
 gi|229546747|ref|ZP_04435472.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX1322]
 gi|229548839|ref|ZP_04437564.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           ATCC 29200]
 gi|293383781|ref|ZP_06629688.1| diphosphomevalonate decarboxylase [Enterococcus faecalis R712]
 gi|293388743|ref|ZP_06633236.1| diphosphomevalonate decarboxylase [Enterococcus faecalis S613]
 gi|300859603|ref|ZP_07105691.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TUSoD
           Ef11]
 gi|307286710|ref|ZP_07566796.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0109]
 gi|307290919|ref|ZP_07570809.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0411]
 gi|312901555|ref|ZP_07760828.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0470]
 gi|312907003|ref|ZP_07765999.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 512]
 gi|312952830|ref|ZP_07771692.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0102]
 gi|312978739|ref|ZP_07790466.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 516]
 gi|227074712|gb|EEI12675.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX0104]
 gi|229306068|gb|EEN72064.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           ATCC 29200]
 gi|229308096|gb|EEN74083.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX1322]
 gi|291078857|gb|EFE16221.1| diphosphomevalonate decarboxylase [Enterococcus faecalis R712]
 gi|291081900|gb|EFE18863.1| diphosphomevalonate decarboxylase [Enterococcus faecalis S613]
 gi|295113905|emb|CBL32542.1| diphosphomevalonate decarboxylase [Enterococcus sp. 7L76]
 gi|300850421|gb|EFK78170.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TUSoD
           Ef11]
 gi|306497989|gb|EFM67516.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0411]
 gi|306502188|gb|EFM71472.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0109]
 gi|310626988|gb|EFQ10271.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 512]
 gi|310629346|gb|EFQ12629.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0102]
 gi|311288446|gb|EFQ67002.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 516]
 gi|311291350|gb|EFQ69906.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0470]
 gi|315027088|gb|EFT39020.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2137]
 gi|315029772|gb|EFT41704.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4000]
 gi|315145810|gb|EFT89826.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2141]
 gi|315148060|gb|EFT92076.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4244]
 gi|315149662|gb|EFT93678.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0012]
 gi|315152975|gb|EFT96991.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0031]
 gi|315155206|gb|EFT99222.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0043]
 gi|315157534|gb|EFU01551.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0312]
 gi|315163038|gb|EFU07055.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0645]
 gi|315165237|gb|EFU09254.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1302]
 gi|315174854|gb|EFU18871.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1346]
 gi|327534483|gb|AEA93317.1| diphosphomevalonate decarboxylase [Enterococcus faecalis OG1RF]
          Length = 341

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 77

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 78  QTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 137

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 138 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 197

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 198 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 257

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 258 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|259047796|ref|ZP_05738197.1| diphosphomevalonate decarboxylase [Granulicatella adiacens ATCC
           49175]
 gi|259035473|gb|EEW36728.1| diphosphomevalonate decarboxylase [Granulicatella adiacens ATCC
           49175]
          Length = 340

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 184/310 (59%), Gaps = 12/310 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + +L +P+N+SLSL+L    T T + + D+   D   LNG K     +
Sbjct: 12  TNIALIKYWGKENKELFIPMNSSLSLTLEAFYTDTKVELSDTLTEDEFYLNGAK--QDEA 69

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K T+F DLFR  +       +E+ N +PT AGLASSAS FAAL  A+     +   +
Sbjct: 70  AIAKITRFLDLFRTETGDTRRARVESLNFVPTAAGLASSASAFAALAGAMNEATGLNMPA 129

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LS  AR GSGSA RS + GF EW  G D N  +S A+P ++   D+ + ++ +   EK
Sbjct: 130 QKLSTYARRGSGSATRSLFGGFVEWNKG-DSN-ENSMAIPVDDANFDIGMIIIVVSAAEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           KI SR  ME+T   SPF+  W    +TDLA IK+AI D+D  ++G +AE N +KMHATM+
Sbjct: 188 KISSRAGMELTVSTSPFYEGWVTSAATDLADIKEAIKDRDIHRIGSIAEFNGMKMHATML 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHK----IEETIKQF 321
           A++PP  Y++ E+I   + +   R++  IP YFT+DAGPN+K++        I E + + 
Sbjct: 248 ASNPPFCYFEPESIVAQQTIRTIREERGIPAYFTMDAGPNVKVICKASDIPAILEELGKV 307

Query: 322 FPEITIIDPL 331
           FP   +I  L
Sbjct: 308 FPSEKLIPTL 317


>gi|255971353|ref|ZP_05421939.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T1]
 gi|256854253|ref|ZP_05559617.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis T8]
 gi|256960027|ref|ZP_05564198.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Merz96]
 gi|257081146|ref|ZP_05575507.1| diphosphomevalonate decarboxylase [Enterococcus faecalis E1Sol]
 gi|257083815|ref|ZP_05578176.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Fly1]
 gi|257086240|ref|ZP_05580601.1| diphosphomevalonate decarboxylase [Enterococcus faecalis D6]
 gi|257421147|ref|ZP_05598137.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis X98]
 gi|255962371|gb|EET94847.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T1]
 gi|256709813|gb|EEU24857.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis T8]
 gi|256950523|gb|EEU67155.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Merz96]
 gi|256989176|gb|EEU76478.1| diphosphomevalonate decarboxylase [Enterococcus faecalis E1Sol]
 gi|256991845|gb|EEU79147.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Fly1]
 gi|256994270|gb|EEU81572.1| diphosphomevalonate decarboxylase [Enterococcus faecalis D6]
 gi|257162971|gb|EEU92931.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis X98]
 gi|323480083|gb|ADX79522.1| diphosphomevalonate decarboxylase [Enterococcus faecalis 62]
          Length = 331

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 168/298 (56%), Gaps = 5/298 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G  I     
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDG--ILQNEK 67

Query: 89  FFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   +
Sbjct: 68  QTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLSA 127

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           + LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D EK
Sbjct: 128 KDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGEK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T +
Sbjct: 188 DVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 248 GAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|9695271|dbj|BAB07791.1| diphosphomevalonate decarboxylase [Streptomyces sp. CL190]
          Length = 350

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 166/309 (53%), Gaps = 15/309 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQ 81
           ++A    NIAL KYWGKRD +L LP   SLS++L    T T +  +D  A  D   LNG+
Sbjct: 22  ATAVAHPNIALIKYWGKRDERLILPCTTSLSMTLDVFPTTTEVR-LDPAAEHDTAALNGE 80

Query: 82  KISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + ++   ++ + F  L R+   S    +++T N +PT AGLASSASGFAAL +A    
Sbjct: 81  VATGET--LRRISAFLSLVREVAGSDQRAVVDTRNTVPTGAGLASSASGFAALAVAAAAA 138

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD----QNGMDSFA--VPFNNQWPD 193
           Y +      LSR+AR GSGSA RS + GF  W  G D    +  + S+A  VP  +  P 
Sbjct: 139 YGLELDDRGLSRLARRGSGSASRSIFGGFAVWHAGPDGTATEADLGSYAEPVPAADLDPA 198

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           L I ++      K + SREAM  T   SP +  W      DL  ++ A++  D   +GE+
Sbjct: 199 LVIAVVNA--GPKPVSSREAMRRTVDTSPLYRPWADSSKDDLDEMRSALLRGDLEAVGEI 256

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           AE+NAL MHATM+AA P + Y    T+  ++ V   R+  +  Y T+DAGPN+K+L    
Sbjct: 257 AERNALGMHATMLAARPAVRYLSPATVTVLDSVLQLRKDGVLAYATMDAGPNVKVLCRRA 316

Query: 314 IEETIKQFF 322
             E +    
Sbjct: 317 DAERVADVV 325


>gi|227555014|ref|ZP_03985061.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis HH22]
 gi|227175840|gb|EEI56812.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis HH22]
 gi|315574184|gb|EFU86375.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0309B]
 gi|315581673|gb|EFU93864.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0309A]
          Length = 341

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 170/299 (56%), Gaps = 7/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIAL KYWGK + +  LP+N+SLSL+L    T T + + D+    D  IL+G  I    
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTV-IFDAHYSEDVFILDG--ILQNE 76

Query: 88  SFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   
Sbjct: 77  KQTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLS 136

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
           ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D E
Sbjct: 137 AKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGE 196

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T 
Sbjct: 197 KDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTT 256

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 257 LGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|29375487|ref|NP_814641.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis V583]
 gi|29342947|gb|AAO80711.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis V583]
          Length = 331

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 170/299 (56%), Gaps = 7/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIAL KYWGK + +  LP+N+SLSL+L    T T + + D+    D  IL+G  I    
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTV-IFDAHYSEDVFILDG--ILQNE 66

Query: 88  SFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   
Sbjct: 67  KQTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLS 126

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
           ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D E
Sbjct: 127 AKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGE 186

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T 
Sbjct: 187 KDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTT 246

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 247 LGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|319440914|ref|ZP_07990070.1| putative diphosphomevalonate decarboxylase [Corynebacterium
           variabile DSM 44702]
          Length = 341

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/338 (34%), Positives = 179/338 (52%), Gaps = 18/338 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQK 82
           ++A   +NIAL KYWGK D +L +P+ +SLSL+L  L T T +   ID DAD   L+G+ 
Sbjct: 8   ATATAHANIALIKYWGKADDELIIPVTSSLSLTLDALYTTTTVRFGIDGDADEATLDGEV 67

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++ ++  + +     DL R+ + +    E  + N +PT AGLASSASGFAAL  A     
Sbjct: 68  VTGKA--YNRIVDLLDLVRERAGIPDRAEVVSVNTVPTAAGLASSASGFAALAGAAAAAA 125

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP---DLRIG 197
            +      LSR+AR GSGSA RS + G   W  GTD +   S+A P  +      DL + 
Sbjct: 126 GLELSDRELSRLARRGSGSASRSIFGGLAVWHAGTDDD--SSYAEPVADPTGLSGDLAMV 183

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +L +   EK + SRE M  T   SP +  W +  +  LA   +A+ + D  +LG VAE+N
Sbjct: 184 VLVLDAGEKSVSSREGMRRTVQTSPDYRPWVEAHAGHLASAMEAVKNGDLERLGAVAEEN 243

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-------- 309
           A  MH TM +A PP+ Y   ++   +  V   R++ +P + T+DAGPN+K+L        
Sbjct: 244 AAGMHGTMASAVPPVEYVTDQSRAALAAVKTLREEGLPAWATMDAGPNVKVLTRASEAER 303

Query: 310 FTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
              ++ E + +  P++  +     P L  T+    + N
Sbjct: 304 VDARLREMLAEVAPQLGTVVAYSGPGLEITRPDTREAN 341


>gi|315167962|gb|EFU11979.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1341]
          Length = 341

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 170/299 (56%), Gaps = 7/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIAL KYWGK + +  LP+N+SLSL+L    T T + + D+    D  IL+G  I    
Sbjct: 20  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTV-IFDAHYSEDVFILDG--ILQNE 76

Query: 88  SFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   
Sbjct: 77  KQTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLS 136

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
           ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D E
Sbjct: 137 AKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGE 196

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T 
Sbjct: 197 KDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTT 256

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 257 LGAIPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 315


>gi|257418497|ref|ZP_05595491.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T11]
 gi|257160325|gb|EEU90285.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T11]
          Length = 331

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 170/299 (56%), Gaps = 7/299 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIAL KYWGK + +  LP+N+SLSL+L    T T + + D+    D  IL+G  I    
Sbjct: 10  TNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTV-IFDAHYSEDVFILDG--ILQNE 66

Query: 88  SFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              KK  +F +L RQ +   +   +E+ N +PT AGLASSASG AAL  A      +   
Sbjct: 67  KQTKKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVALGLNLS 126

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
           ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  + I D E
Sbjct: 127 AKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFILINDGE 186

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L+MH T 
Sbjct: 187 KDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGLRMHGTT 246

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K F  E
Sbjct: 247 LGAIPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALKTFLSE 305


>gi|146317946|ref|YP_001197658.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis 05ZYH33]
 gi|146320133|ref|YP_001199844.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis 98HAH33]
 gi|253751170|ref|YP_003024311.1| mevalonate diphosphate decarboxylase [Streptococcus suis SC84]
 gi|253753071|ref|YP_003026211.1| mevalonate diphosphate decarboxylase [Streptococcus suis P1/7]
 gi|253754893|ref|YP_003028033.1| mevalonate diphosphate decarboxylase [Streptococcus suis BM407]
 gi|145688752|gb|ABP89258.1| Mevalonate pyrophosphate decarboxylase [Streptococcus suis 05ZYH33]
 gi|145690939|gb|ABP91444.1| Mevalonate pyrophosphate decarboxylase [Streptococcus suis 98HAH33]
 gi|251815459|emb|CAZ51037.1| mevalonate diphosphate decarboxylase [Streptococcus suis SC84]
 gi|251817357|emb|CAZ55093.1| mevalonate diphosphate decarboxylase [Streptococcus suis BM407]
 gi|251819316|emb|CAR44666.1| mevalonate diphosphate decarboxylase [Streptococcus suis P1/7]
 gi|292557730|gb|ADE30731.1| Diphosphomevalonate decarboxylase [Streptococcus suis GZ1]
 gi|319757439|gb|ADV69381.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis JS14]
          Length = 341

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 135/335 (40%), Positives = 191/335 (57%), Gaps = 16/335 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGKRD +L LP+N+SLSL+L    T T + V D +  AD   LNG  I  + 
Sbjct: 12  TNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKV-VFDPELTADEFYLNG--ILQKE 68

Query: 88  SFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
               K ++F DLF ++   + +  +E+ N +PT AGLASSAS FAAL LA      +   
Sbjct: 69  KEILKISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDLDLS 128

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
             +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L +    
Sbjct: 129 PATLSTLARRGSGSSTRSLFGGFVEWGMGTGSE--DSMAHPIDDADWDIGMVVLAVNTGP 186

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KKI SRE M+ T   SPF+T W +    DL  IK AI  +DF KLG++ E N +KMHAT 
Sbjct: 187 KKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAAIASRDFEKLGQITEHNGMKMHATT 246

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLF-THKIEETI---KQ 320
           ++A+PP  YW  +++   E V   R+ + +  Y T+DAGPN+K+L    +++E +    +
Sbjct: 247 LSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRASQMDELVAGLAK 306

Query: 321 FFPEITIIDPLDSPDLW--STKDSLSQKNSIELGI 353
            FP   II     P  +  S KD  + + + E GI
Sbjct: 307 VFPREKIITSKPGPAAYVLSEKDWQASQTAFEKGI 341


>gi|153799376|gb|ABS50447.1| NapT5 [Streptomyces aculeolatus]
          Length = 378

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 164/290 (56%), Gaps = 16/290 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSSF 89
           NIAL KYWGKRD  L LP  +SLS++L    T T + +  ++  D ++L G+    ++  
Sbjct: 55  NIALIKYWGKRDEHLVLPRTDSLSMTLDIFPTTTRVRLAPEAGRDVVVLGGRPAEGEA-- 112

Query: 90  FKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++   F DL R  ++V    ++E+ N +PT AGLASSASGFAAL +A  R Y +   + 
Sbjct: 113 LRRIVTFLDLVRHSARVPHRAVVESHNTVPTGAGLASSASGFAALAVAAARAYGLSLTAT 172

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFA--VPFNNQWPDLRIGLLK 200
            LSR+AR GSGSA RS + GF  W  G     T    + S+A  VP  +  P L   ++ 
Sbjct: 173 GLSRLARRGSGSASRSVFGGFAVWHAGRPGQDTKAADLGSYAEPVPVADLDPAL---VVA 229

Query: 201 IIDR-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           ++D   K + SR AM  T   SP +  W      DL  ++ A++  D   +GE+AE+NAL
Sbjct: 230 VVDAGPKAVSSRAAMRRTVDTSPLYEPWAASSRDDLTQMRAALLRGDLQVVGEIAERNAL 289

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
            MHATM+AA P + Y    T+  ++ V   R+  +  + T+DAGPN+K+L
Sbjct: 290 GMHATMLAARPAVRYLAPATLTVLDAVAQLRRDGVGAWATMDAGPNVKVL 339


>gi|260584343|ref|ZP_05852090.1| diphosphomevalonate decarboxylase [Granulicatella elegans ATCC
           700633]
 gi|260157861|gb|EEW92930.1| diphosphomevalonate decarboxylase [Granulicatella elegans ATCC
           700633]
          Length = 341

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 183/307 (59%), Gaps = 12/307 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK+D  L LP+N+SLSL+L    T T IT+  + + D   LN   +  Q +
Sbjct: 11  TNIALIKYWGKKDKALFLPMNSSLSLTLEAFYTDTKITLDKTLEKDEFYLNN--VLQQEA 68

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K ++F DLFR  +K   +  IE+ N +PT AGLASSAS FAAL  A+ +        
Sbjct: 69  EIQKISKFLDLFRIPAKETRFARIESYNFVPTAAGLASSASAFAALAGAMHQAMGWDLSR 128

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
             LS  AR GSGS+ RS + GF EW  GT  N  DS A+P ++   D+ + ++ +    K
Sbjct: 129 SELSTYARRGSGSSTRSLFGGFVEWNQGT--NSEDSMAIPIDDASWDIGMLIVVVNGAAK 186

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           KI SR  ME T   SPF+  W +   TDL  IK AI +++F ++GE+AE N +KMHATM+
Sbjct: 187 KISSRVGMEQTVATSPFYPAWVESAKTDLEEIKIAIQEKNFTRMGEIAEFNGMKMHATML 246

Query: 267 AASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFT----HKIEETIKQF 321
           A+ PP  Y++ +++   ++V   R+   IP Y+T+DAGPN+K+L       K+ +  +Q+
Sbjct: 247 ASQPPFCYFEPDSLIAQQQVVYLREVLGIPAYYTMDAGPNIKVLCKASDLDKVRDHFEQY 306

Query: 322 FPEITII 328
           F    +I
Sbjct: 307 FASEKLI 313


>gi|313885700|ref|ZP_07819449.1| diphosphomevalonate decarboxylase [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619065|gb|EFR30505.1| diphosphomevalonate decarboxylase [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 328

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 173/294 (58%), Gaps = 5/294 (1%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKR+  L LP+ +SLSL+L    T T +    S   D   L+GQ  + QS 
Sbjct: 14  TNIALVKYWGKRNKNLFLPVTSSLSLTLDAFYTETEVLFDPSLKEDSFTLDGQVQTGQS- 72

Query: 89  FFKKTTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K + F DLFR+   +   ++  + N++PT AGLASSAS FAAL  A  +   +    
Sbjct: 73  -LAKVSNFVDLFRRDFNMSLPVQITSRNHVPTAAGLASSASAFAALAAASNQALGLGLSP 131

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
           E +S  AR GSGSA RS + GF  W  G   +   S+A   +    D+ + ++ +    K
Sbjct: 132 EEVSVYARQGSGSASRSLFGGFALWHKGQGDDSASSYAQQIDPADWDIAMLVVLVNPGPK 191

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           KI SR+ ME T   SPF+  W ++++ DL+ ++ AI D++  ++G +AE NA+KMHATMI
Sbjct: 192 KISSRQGMEHTMQSSPFYALWPEEVAKDLSAMEDAIKDRNIDQIGIIAEHNAMKMHATMI 251

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           A++P   YWQ +++  MERV   RQ     YFT+DAGPN+K++  +   E I+Q
Sbjct: 252 ASNPSFTYWQAQSLLAMERVRQLRQAGYSAYFTMDAGPNVKVICPYSQVEAIRQ 305


>gi|312190949|gb|ADQ43374.1| mevalonate diphosphate decarboxylase [Streptomyces cinnamonensis]
          Length = 351

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 171/311 (54%), Gaps = 14/311 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILN 79
            + ++A    NIAL KYWGKRD +L LP  +SLS++L    T T + +   +D D + L 
Sbjct: 18  TDTATAVAHPNIALIKYWGKRDERLILPRTDSLSMTLDIFPTTTRVHLAPGADHDEVTLG 77

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALF 137
           G     ++   ++   F DL R+ S V    +++T N +PT AGLASSASGFAAL +A  
Sbjct: 78  GTPAEGEAR--RRIVTFLDLVRERSGVADRAVVDTENTVPTGAGLASSASGFAALAVAAA 135

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG----TDQNG-MDSFAVPFNNQWP 192
             Y +  ++ +LSR+AR GSGSA RS +  F  W  G    TD+   + S+A P      
Sbjct: 136 AAYGLDLEAIALSRLARRGSGSASRSLFGDFVVWHAGRETGTDEEADLSSYAEPVPTGPL 195

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           D  + +  +    K + SR AM  T   SP +  W      DLA +++A+   D   +GE
Sbjct: 196 DPALVVAVVNAGPKDVSSRAAMRRTVDTSPLYEPWALSSKGDLAEMRRALGRGDLEAVGE 255

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF-- 310
           +AE+NAL MHATM+AA P + Y    ++  ++ V   R+  +  Y T+DAGPN+K+L   
Sbjct: 256 IAERNALGMHATMLAARPAVRYMSPASLTVLDSVLQLRRDGVAAYATMDAGPNVKVLCRA 315

Query: 311 --THKIEETIK 319
               ++ +T++
Sbjct: 316 ADADRVADTVR 326


>gi|302023328|ref|ZP_07248539.1| diphosphomevalonate decarboxylase [Streptococcus suis 05HAS68]
 gi|330832129|ref|YP_004400954.1| mevalonate diphosphate decarboxylase [Streptococcus suis ST3]
 gi|329306352|gb|AEB80768.1| mevalonate diphosphate decarboxylase [Streptococcus suis ST3]
          Length = 341

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 133/334 (39%), Positives = 188/334 (56%), Gaps = 21/334 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGKRD +L LP+N+SLSL+L    T T + V D +  AD   LNG  +  + 
Sbjct: 12  TNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKV-VFDPELTADEFYLNG--MLQKE 68

Query: 88  SFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
               K ++F DLF ++   + +  +E+ N +PT AGLASSAS FAAL LA      +   
Sbjct: 69  KEILKISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDLDLS 128

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
             +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L +    
Sbjct: 129 PATLSTLARRGSGSSTRSLFGGFVEWDMGTGSE--DSMAHPIDDADWDIGMVVLAVNTGP 186

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KKI SRE M+ T   SPF+T W +    DL  IK AI  +DF KLG++ E N +KMHAT 
Sbjct: 187 KKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAAIASRDFEKLGQITEHNGMKMHATT 246

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLF-THKIEETIKQF-- 321
           ++A+PP  YW  +++   E V   R+ + +  Y T+DAGPN+K+L  T +++E + +   
Sbjct: 247 LSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRTSQMDELVAELAK 306

Query: 322 -FPEITIIDPLDSP-------DLWSTKDSLSQKN 347
            FP   II     P       D W T  +  +K 
Sbjct: 307 VFPREKIITSKPGPAAYVLSEDEWQTSQAAFEKG 340


>gi|238623518|emb|CAX48657.1| putative diphosphomevalonate decarboxylase [Streptomyces anulatus]
          Length = 351

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 171/311 (54%), Gaps = 16/311 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSSF 89
           NIAL KYWGKRD +L LP  +SLS++L  L T TH+ +  +++ D + L+G  +  +   
Sbjct: 28  NIALIKYWGKRDERLVLPRTDSLSMTLDILPTTTHVRLDPEAEHDEVTLDGVPL--EGGP 85

Query: 90  FKKTTQFCDLFRQ--FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++   F +L R+   S     +++ N +PT AGLASSASGFAAL +A    Y +   + 
Sbjct: 86  RQRVITFLELVRERAGSSRRAAVDSRNTVPTGAGLASSASGFAALAVAASAAYGLGLDAT 145

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG------TDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +LSR+AR GSGSA RS +  F  W  G      TD + + S+A P      D  + +  +
Sbjct: 146 ALSRLARRGSGSASRSIFGDFAIWHAGRPTGSATDAD-LGSYAEPVPAAEFDPALVIAVV 204

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               K + SREAM  T   SP +  W      DL  ++ A+   D   +GE+AE+NAL M
Sbjct: 205 NAGPKDVSSREAMRRTVETSPLYGPWAASSEGDLVDMRVALRRGDLDAVGEIAERNALGM 264

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEET 317
           HATM+AA P + Y    T+  ++ V   R+  +P Y T+DAGPN+K+L       ++ + 
Sbjct: 265 HATMLAARPAVRYLSAPTLDVLDSVLRLRRDGVPAYATMDAGPNVKVLCHRTDADRVAQV 324

Query: 318 IKQFFPEITII 328
           ++   P  +++
Sbjct: 325 VRSAAPGGSVL 335


>gi|223934070|ref|ZP_03626020.1| diphosphomevalonate decarboxylase [Streptococcus suis 89/1591]
 gi|223897261|gb|EEF63672.1| diphosphomevalonate decarboxylase [Streptococcus suis 89/1591]
          Length = 341

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 132/334 (39%), Positives = 187/334 (55%), Gaps = 21/334 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIAL KYWGKRD +L LP+N+SLSL+L    T T + V D +  AD   LNG  +  + 
Sbjct: 12  TNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKV-VFDPELTADEFYLNG--MLQKE 68

Query: 88  SFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
               K ++F DLF ++   + +  +E+ N +PT AGLASSAS FAAL LA      +   
Sbjct: 69  KEILKISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDLDLS 128

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
             +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L +    
Sbjct: 129 PATLSTLARRGSGSSTRSLFGGFVEWDMGTGSE--DSMAHPIDDADWDIGMVVLAVNTGP 186

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KKI SRE M+ T   SPF++ W      DLA IK AI  +DF KLG++ E N +KMHAT 
Sbjct: 187 KKIASREGMDHTVATSPFYSAWVDTAKQDLADIKAAIAGRDFEKLGQITEHNGMKMHATT 246

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLF-THKIEETIKQF-- 321
           ++A+PP  YW  +++   E V   R+ + +  Y T+DAGPN+K+L    +++E + +   
Sbjct: 247 LSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRASQMDELVAELAK 306

Query: 322 -FPEITIIDPLDSP-------DLWSTKDSLSQKN 347
            FP   II     P       D W T  +  +K 
Sbjct: 307 VFPREKIITSKPGPAAYVLSEDEWQTSQAAFEKG 340


>gi|237784665|ref|YP_002905370.1| diphosphomevalonate decarboxylase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237757577|gb|ACR16827.1| diphosphomevalonate decarboxylase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 375

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 173/340 (50%), Gaps = 30/340 (8%)

Query: 10  HRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI 69
           H  +G+  P     + A    NIAL KYWGKR++ L LP   SLSL+L    T T   V+
Sbjct: 5   HPSMGDIGPITPRTARATAHPNIALVKYWGKRNADLVLPATGSLSLTLDIYPTDT---VV 61

Query: 70  DSD----ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK--------VYFLIETSNNIP 117
           + D    +D   LNG+      +   +   F DL R+ S         +Y  I + N++P
Sbjct: 62  NPDPSLTSDIFTLNGEPAPGTPTH--RVRAFLDLVRKLSAEQNPELAHMYARINSVNSVP 119

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT-- 175
           T AGLASSASGFAAL  A  + Y +P    SLSR+AR GSGSA RS       W  G   
Sbjct: 120 TGAGLASSASGFAALATAASKAYGLPGDPRSLSRLARRGSGSATRSILGNLVIWHPGDGD 179

Query: 176 DQNG-MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS 232
           D+N  + S+A  VP     PDL + +  +   +K + SR AM  T   SPFF  W     
Sbjct: 180 DENADLTSYAESVP----GPDLAMVICVVSGAQKAVSSRVAMADTIRTSPFFDGWVSSTQ 235

Query: 233 TDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ 292
            DL  ++QA+ + D+ ++GE+ E NAL+MHA +    PP+ Y    ++   + +   R  
Sbjct: 236 RDLVDMQQALAEGDYTRVGEITESNALRMHAAINGNRPPVRYLAPTSVAIFDTIAQLRND 295

Query: 293 SIPIYFTLDAGPNLKLLFTHK----IEETIKQFFPEITII 328
            + +Y T DAGPN+  L   K        +++ FP++ +I
Sbjct: 296 GLEVYGTADAGPNVVALCQAKDLDATHAALRERFPDLELI 335


>gi|260663061|ref|ZP_05863954.1| diphosphomevalonate decarboxylase [Lactobacillus fermentum
           28-3-CHN]
 gi|260552682|gb|EEX25682.1| diphosphomevalonate decarboxylase [Lactobacillus fermentum
           28-3-CHN]
          Length = 329

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 173/294 (58%), Gaps = 10/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+ +S+  +
Sbjct: 9   TNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGELVSANKA 68

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  +   +    
Sbjct: 69  --QKVVKFMDLVRQLSGRTEYAQIASVNNVPMAAGLASSASAFAALAGAAAKDAGLDLSL 126

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DR 204
           + LSR+AR GSGSA RS Y G  EW  G D     SFA P   + PD  I +L I+    
Sbjct: 127 KDLSRLARRGSGSATRSVYGGLVEWHRGVDD--ATSFAEPVQ-EVPDFDIAMLAILVDTS 183

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL+MHA 
Sbjct: 184 QKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENALRMHAL 243

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ +
Sbjct: 244 NLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDL 297


>gi|227514851|ref|ZP_03944900.1| possible diphosphomevalonate decarboxylase [Lactobacillus fermentum
           ATCC 14931]
 gi|227086783|gb|EEI22095.1| possible diphosphomevalonate decarboxylase [Lactobacillus fermentum
           ATCC 14931]
          Length = 329

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 173/294 (58%), Gaps = 10/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+ +S+  +
Sbjct: 9   TNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGELVSANKA 68

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  +   +    
Sbjct: 69  --QKVVKFMDLVRQLSGRTEYAQIASVNNVPMAAGLASSASAFAALAGAAAKDAGLDLSL 126

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DR 204
           + LSR+AR GSGSA RS Y G  EW  G D     SFA P   + PD  I +L I+    
Sbjct: 127 KDLSRLARRGSGSATRSVYGGLVEWHRGVDD--ATSFAEPVQ-EVPDFDIAMLAILVDTS 183

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL+MHA 
Sbjct: 184 QKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENALRMHAL 243

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ +
Sbjct: 244 NLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDL 297


>gi|184155669|ref|YP_001844009.1| mevalonate diphosphate decarboxylase [Lactobacillus fermentum IFO
           3956]
 gi|183227013|dbj|BAG27529.1| mevalonate diphosphate decarboxylase [Lactobacillus fermentum IFO
           3956]
          Length = 329

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 173/294 (58%), Gaps = 10/294 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+ +S+  +
Sbjct: 9   TNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGELVSANKA 68

Query: 89  FFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  +   +    
Sbjct: 69  --QKVVKFMDLVRQLSGRTEYAQITSVNNVPMAAGLASSASAFAALAGAAAKDAGLDLSL 126

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DR 204
           + LSR+AR GSGSA RS Y G  EW  G D     SFA P   + PD  I +L I+    
Sbjct: 127 KDLSRLARRGSGSATRSVYGGLVEWHRGVDD--ATSFAEPVQ-EVPDFDIAMLAILVDTS 183

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL+MHA 
Sbjct: 184 QKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENALRMHAL 243

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ +
Sbjct: 244 NLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDL 297


>gi|312869994|ref|ZP_07730133.1| diphosphomevalonate decarboxylase [Lactobacillus oris PB013-T2-3]
 gi|311094579|gb|EFQ52884.1| diphosphomevalonate decarboxylase [Lactobacillus oris PB013-T2-3]
          Length = 323

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 174/292 (59%), Gaps = 10/292 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T +       AD +++NGQ+
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLDEFYTTTRVNFDQKLTADQVMINGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++  ++   K T   D+ RQ S +     +++ N++PT AGLASSAS FAAL  A  R  
Sbjct: 62  LAGPAA--AKVTHLLDIVRQRSGLSARARVDSQNHVPTAAGLASSASAFAALAGATSRAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +      LSR+AR GSGSA RS Y G  EW  G D     S+A+P   Q  D  I ++ 
Sbjct: 120 GLQLSRRELSRLARRGSGSATRSIYGGLVEWQAGHDDR--TSYALPIMEQ-VDFGIEMIA 176

Query: 201 II--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           I+    +KK+ SR  M+ +   SP++  W + ++ D+A +K+AI  QD  ++G +AE+NA
Sbjct: 177 ILVDTHKKKVSSRFGMQQSVSTSPYYRVWAEVVARDMAAVKKAIAAQDIDQIGAIAEENA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           L+MHA  ++A P   Y+  +TI  M  V + R+  +  YFT+DAGPN+K+++
Sbjct: 237 LRMHALTLSADPGFTYFDSDTITAMTIVRELRENGVNCYFTMDAGPNVKVIY 288


>gi|332310345|gb|EGJ23440.1| Diphosphomevalonate decarboxylase [Listeria monocytogenes str.
           Scott A]
          Length = 300

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 164/276 (59%), Gaps = 9/276 (3%)

Query: 47  LPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQKISSQSSFFKKTTQFCDLFRQFSK 105
           LP N+SLS ++    T T +    + A D  ILN +  +       K  +F D  R+   
Sbjct: 3   LPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNEHKTDA-----KVARFIDKMREEFG 57

Query: 106 V--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRS 163
           +     I + N++PT AGLASSAS FAAL LA        +  E +SR+AR GSGSA RS
Sbjct: 58  ISAKAKITSENHVPTAAGLASSASAFAALALAGSSAAGRKDTKEYISRLARFGSGSASRS 117

Query: 164 FYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGLLKIIDREKKIGSREAMEITRHHSP 222
            +  F  W  G   +G DSFAVPF N+  D + + +  + D+EKK+ SR+ M +T   SP
Sbjct: 118 VFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSP 177

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           FF +W     TDL  +KQAI+D+DFIK+GE+ E+N +KMHAT + A PP  Y+Q ++++ 
Sbjct: 178 FFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNGMKMHATTLGAEPPFTYFQPKSLEI 237

Query: 283 MERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 238 MDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 273


>gi|323339819|ref|ZP_08080088.1| diphosphomevalonate decarboxylase [Lactobacillus ruminis ATCC
           25644]
 gi|323092692|gb|EFZ35295.1| diphosphomevalonate decarboxylase [Lactobacillus ruminis ATCC
           25644]
          Length = 319

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 173/292 (59%), Gaps = 13/292 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D +L +P+N S+SL+L H  T T +    +   D   L+G+
Sbjct: 2   KKTARAHTNIALVKYWGKADEELIIPMNGSVSLTLDHFYTDTTVEFDPALTEDVFCLDGK 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           +         K  +F +L R  +K   +  I++ N++PT AGLASSAS +AAL L+    
Sbjct: 62  QKHDP-----KVAKFMNLVRNLAKKETFARIDSINHVPTAAGLASSASAYAALALSATSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS + GF EW  GTD   + SFA P   +  D  I ++
Sbjct: 117 AGLNLTRKDLSRLARRGSGSATRSIFGGFVEWHKGTDD--LTSFAEPIEEE-TDWEICMI 173

Query: 200 KII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            I+    EKKI SR  M+     SP++ +W +    DL  +KQAI ++DF  LGEV+E +
Sbjct: 174 AIVINGHEKKISSRHGMQQVVKTSPYYHEWVKTAEEDLKLVKQAIKNRDFSLLGEVSEAS 233

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A+KMHA  ++A P   Y+  E+I  M+++ + R Q IP Y+T+DAGPN+K++
Sbjct: 234 AMKMHALNMSAKPHFSYFMPESILAMQKIEELRSQGIPCYYTMDAGPNVKVI 285


>gi|331701430|ref|YP_004398389.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128773|gb|AEB73326.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 328

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 175/305 (57%), Gaps = 8/305 (2%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKI 83
           +A   +NIAL KYWGK++ +L +P   SLSL+L    T T +T   + D D I ++GQ +
Sbjct: 10  TAVAHTNIALIKYWGKQNPELIIPYTGSLSLTLDQFYTQTSVTFNANLDKDQITIDGQPV 69

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           + +S   ++   F  + R+ S +     ++++N++PT AGLASSAS FAAL  A  +   
Sbjct: 70  TGKSG--QRVHNFLSIVRRESGIDLNAQVKSTNHVPTAAGLASSASAFAALAAAASKAAG 127

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRIGLLK 200
           +      LSR+AR GSGSACRS + GF EW  G+D    +S+A+P       D+ I  L 
Sbjct: 128 MNLSLTDLSRLARRGSGSACRSIFGGFVEWQKGSDDT--NSYAIPVETTHLNDICIVALT 185

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I   +K I SRE M ++   SP++  W + +  DL +IK AI D DF + G ++E NA++
Sbjct: 186 IEKHQKPISSREGMALSVTTSPYYPTWVKVVEADLENIKAAIQDDDFTRFGTISELNAMR 245

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA  ++A P  LY+  +T+  M  V   R   I  Y+T+DAGPN+K++      +TI  
Sbjct: 246 MHALTLSADPDFLYFNGDTLTAMNEVKRLRHSGIECYYTIDAGPNIKVICQQANVQTITD 305

Query: 321 FFPEI 325
            F  +
Sbjct: 306 TFSNL 310


>gi|326803271|ref|YP_004321089.1| diphosphomevalonate decarboxylase [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651516|gb|AEA01699.1| diphosphomevalonate decarboxylase [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 413

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 173/292 (59%), Gaps = 7/292 (2%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIAL KYWGKRD  L LP+N++LSL+L    + T +    D   DC  L+G+     +S
Sbjct: 12  TNIALIKYWGKRDDDLILPMNSNLSLTLDRFYSETQVRFSKDIVEDCFQLDGE--WQDNS 69

Query: 89  FFKKTTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +K ++F DLFRQ ++V    E  + N++PT AGLASSAS FAAL  A  +   +    
Sbjct: 70  EVEKISRFVDLFRQIAQVDLACEVISYNHVPTAAGLASSASAFAALAGACNQALHLNLDP 129

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            SLSR+AR GSGSA RS + GF EW  GT     DS A PF++   D+ + +L +  ++K
Sbjct: 130 VSLSRLARRGSGSATRSIFGGFVEWDKGT--GDQDSQAAPFDDANWDVGMVVLALNTKKK 187

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I SR  M+ T   SPF+  W Q     L  +K AI  +D  ++GE+AE +A+ MHAT +
Sbjct: 188 SISSRRGMKHTVETSPFYQLWPQVSEEKLLEMKAAIKARDLDRMGEIAENHAMLMHATTL 247

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +A P   Y + E+++ ++ V   R+Q    YFT+DAGPN+K+L  +   + I
Sbjct: 248 SADPAFTYLEAESLKAIDAVKALRRQGYKAYFTMDAGPNVKILCPYSQSQAI 299


>gi|294790206|ref|ZP_06755364.1| diphosphomevalonate decarboxylase [Scardovia inopinata F0304]
 gi|294458103|gb|EFG26456.1| diphosphomevalonate decarboxylase [Scardovia inopinata F0304]
          Length = 347

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 127/326 (38%), Positives = 181/326 (55%), Gaps = 25/326 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ 81
           + ++A   +NIAL KYWGKRD KL LP + SLSL+L    T TH++    + D +ILNGQ
Sbjct: 3   QAAAARAHTNIALIKYWGKRDDKLILPTSTSLSLTLDSFYTDTHVSPARGEDDQLILNGQ 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFS--KVYFLIETS-----------NNIPTKAGLASSASG 128
               Q +   +   F +LFR  +  K Y   ET+           N++PT AGLASS+S 
Sbjct: 63  VGGLQET--SRVHDFINLFRDEARKKDYSGQETALCAAPIRVDSFNHVPTAAGLASSSSA 120

Query: 129 FAALTLALFRIYSIPEKSES--LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           FAAL  AL   + + +  +   LS  AR GSGSA RS + G  EW+ G+D +  DS+A  
Sbjct: 121 FAALAWALRDYFGLADSMDDRILSTFARQGSGSATRSIFGGLVEWLYGSDSS--DSYAYQ 178

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
            ++   DL + ++ +    KKI SR+ M+ T   S F+  W Q    DLA  +  I + D
Sbjct: 179 IDDGNWDLGMIVVALSTEHKKISSRKGMKHTVDTSAFYPLWRQASEKDLAQAEAGIRNHD 238

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             +LG   E N +K HATM AA PP+ Y    + + +E VWD R++ I  YFT+DAGPN+
Sbjct: 239 LDQLGRAMEANVMKFHATMFAADPPITYLTSRSWEVIEYVWDLRERGISCYFTMDAGPNV 298

Query: 307 KLLFTHK-----IEETIKQFFPEITI 327
           K+L  HK     + E ++  FP+  +
Sbjct: 299 KIL-CHKSQATTLAEDLRTAFPDALV 323


>gi|227544619|ref|ZP_03974668.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri CF48-3A]
 gi|300910251|ref|ZP_07127711.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri SD2112]
 gi|227185402|gb|EEI65473.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri CF48-3A]
 gi|300892899|gb|EFK86259.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri SD2112]
          Length = 323

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 172/292 (58%), Gaps = 10/292 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T +   +   +D + ++ Q 
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQQT 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  KK     D+ RQ S  K +  +E+ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--KKVVHVLDIVRQLSGIKAFARVESINHVPTAAGLASSASAFAALAGAASTAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGL 198
            +   S  LSR+AR GSGSA RS Y G  EW  GTD     SFA P   N  +P   + +
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDD--ASSFAQPVLENVDFPIEMLAV 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L +  + KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NA
Sbjct: 178 L-VDTKRKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           L+MHA   +A P   Y+  ET+  ++ V D R Q I  Y+T+DAGPN+K+++
Sbjct: 237 LRMHALTFSADPGFTYFNGETLTIIKAVEDLRNQGINCYYTMDAGPNVKVIY 288


>gi|57753871|dbj|BAD86801.1| mevalonate diphosphate decarboxylase [Streptomyces sp. KO-3988]
          Length = 350

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/303 (38%), Positives = 167/303 (55%), Gaps = 17/303 (5%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DC 75
           P  N  ++   P NIAL KYWGKRD  L LP  +SLS++L    T T +  +D++A  D 
Sbjct: 15  PGANGVTAVAQP-NIALIKYWGKRDEHLFLPWTSSLSMTLDIFPTTTRVH-LDAEATDDE 72

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALT 133
           +  NG   + +    ++ T F DL RQ + +    +++T N +PT AGLASSA GFAAL 
Sbjct: 73  VTFNGAPAAGEER--RRITGFLDLVRQRAGLTHRAVVDTRNTVPTGAGLASSAGGFAALA 130

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD-----QNGMDSFA--VP 186
           +A    Y +      LSR+AR GSGSA RS + GF  W  GT      +  + S+A  VP
Sbjct: 131 VAAATAYGLDLDDTGLSRLARRGSGSASRSIFGGFAVWNAGTPTAPPAEADLSSYAEPVP 190

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
             +  P L I ++      K + SR AM  T   SP F  W      DL  ++QA++  D
Sbjct: 191 VGDLDPALVIAVVNA--GPKDVSSRAAMRRTVETSPLFEPWAASSRDDLTEMRQALLRAD 248

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL 306
              +GE+AE+N+L MHATM++A P + Y    ++  ++ V   R+  I  Y T+DAGPN+
Sbjct: 249 LDAVGEIAERNSLGMHATMLSARPAVRYLSPASLTVLDSVLRLRRDGISAYATMDAGPNV 308

Query: 307 KLL 309
           K+L
Sbjct: 309 KVL 311


>gi|116333505|ref|YP_795032.1| phosphomevalonate kinase [Lactobacillus brevis ATCC 367]
 gi|116098852|gb|ABJ64001.1| diphosphomevalonate decarboxylase [Lactobacillus brevis ATCC 367]
          Length = 324

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 172/303 (56%), Gaps = 16/303 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIILNGQKISS 85
           +NIAL KYWGK D  L LP  +SLSL+L    T T    ++ D     D + +N Q +++
Sbjct: 10  TNIALVKYWGKADPNLMLPQTSSLSLTLDQFYTDT---TVEFDPRLTHDMVRINAQLLAA 66

Query: 86  QSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
            +S  +K   F ++ R+ S    +  + + N++PT AGLASSAS FAA+  A  R   + 
Sbjct: 67  PAS--QKVVDFLNIVREQSGQSAFAHVTSVNHVPTAAGLASSASAFAAMAGAASRAAGLE 124

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKI 201
               +LSR+AR GSGSA RS Y GF EW  G+D +   S A+P      WP   + L+ +
Sbjct: 125 LTPRALSRLARRGSGSATRSIYGGFVEWQAGSDDH--TSLAIPLQETVDWPIAVVALV-L 181

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               K+I SR+ M+ +   SP++  W   ++ DLA IK AI+ QDF  +GEV E NA++M
Sbjct: 182 DPHHKRISSRQGMQSSVTTSPYYPAWKTVVAQDLATIKPAILHQDFSTMGEVLESNAMRM 241

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA  ++A PP  Y+  +T++ M+ V   RQ     Y+TLDAGPNLK+        TI Q 
Sbjct: 242 HALTLSAQPPYSYFNGDTLRAMDTVRVLRQAGQECYYTLDAGPNLKVFCQTPDLPTITQK 301

Query: 322 FPE 324
           F E
Sbjct: 302 FAE 304


>gi|300361739|ref|ZP_07057916.1| possible diphosphomevalonate decarboxylase [Lactobacillus gasseri
           JV-V03]
 gi|300354358|gb|EFJ70229.1| possible diphosphomevalonate decarboxylase [Lactobacillus gasseri
           JV-V03]
          Length = 321

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 185/302 (61%), Gaps = 13/302 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK +  L  PL +SLS++L    T T      S   D  ILNGQ
Sbjct: 2   KKTARAHTNIALIKYWGKSNQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNGQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQ---FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           K + + S  K+   +  L ++   F+  +F I+++N++PT AGLASSAS FAAL  +   
Sbjct: 62  KQTPEES--KRVFNYIHLLQEKFGFND-HFTIKSTNHVPTSAGLASSASAFAALATSFAA 118

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
            Y +      LS++ARLGSGSA RS Y GF EW  G D     S+AVP +   PDL + L
Sbjct: 119 SYGLDLSRRELSKLARLGSGSATRSIYGGFVEWQKGIDD--ASSYAVPIDEN-PDLDLSL 175

Query: 199 L--KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           L  ++  ++KKI S + M++ +  SPF+  W  +   ++A +KQAI ++DF K+G+++E 
Sbjct: 176 LALEVDTKQKKISSTKGMKLAQT-SPFYQPWLARNKQEIAELKQAIKEKDFTKIGKLSEL 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           +A +MHA  + A+ P  Y++ ETI+ ++ V + RQQ I  Y+T+DAGPN+K+L T + ++
Sbjct: 235 SANEMHACNLTANEPFTYFEPETIKAIKLVENLRQQGIECYYTIDAGPNVKILCTLRNKK 294

Query: 317 TI 318
            I
Sbjct: 295 EI 296


>gi|259503452|ref|ZP_05746354.1| diphosphomevalonate decarboxylase [Lactobacillus antri DSM 16041]
 gi|259168530|gb|EEW53025.1| diphosphomevalonate decarboxylase [Lactobacillus antri DSM 16041]
          Length = 323

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 115/303 (37%), Positives = 180/303 (59%), Gaps = 16/303 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD----ADCIILN 79
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T    +D D    +D +++N
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLDEFYTTT---TVDFDQELASDQVMIN 58

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ++   ++  +K T+  D+ RQ S +     +++ N++PT AGLASSAS FAAL  A  
Sbjct: 59  GQQLGGPAA--RKVTRLLDIVRQRSDLTARARVDSHNHVPTAAGLASSASAFAALAGAAS 116

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
           +   +      LSR+AR GSGSA RS Y G  EW  G D     S+AVP   +  D  I 
Sbjct: 117 QAAGLQLDRRGLSRLARRGSGSATRSVYGGLVEWQAGNDDQ--TSYAVPIMEE-VDFGIE 173

Query: 198 LLKII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           ++ I+   R+KKI SR  M+ +   SP++  W + ++ D+  +K+AI  +D  ++G +AE
Sbjct: 174 MIAILIDTRQKKISSRFGMQQSVATSPYYRLWPEVVAHDMVAVKKAIAARDVDQIGAIAE 233

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +NAL+MHA  ++A+P   Y+  +T++ M  V + R   I  YFT+DAGPN+K+++     
Sbjct: 234 ENALRMHALTLSAAPGFTYFDSDTLKAMAIVRELRANGINCYFTMDAGPNVKVIYDRVNR 293

Query: 316 ETI 318
           E +
Sbjct: 294 EAV 296


>gi|313123654|ref|YP_004033913.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280217|gb|ADQ60936.1| Diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 319

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 172/285 (60%), Gaps = 14/285 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK+D+KL LPL +SLS++L    + T I+  DS+     LNGQ +S  ++ 
Sbjct: 9   TNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKIS--DSEQMSFKLNGQAVSGPAAD 66

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F       D F    K    +E+ N +PT AGLASS+S FA++  A    Y +     
Sbjct: 67  RVFAYLRAMQDRFG--VKGNLAVESVNQVPTAAGLASSSSAFASMAAAFADHYQLGVDRR 124

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFNNQWPDLRIGLL--KIIDR 204
            LSR+AR+GSGSA RS + GF  W  G +DQ    S+A P N + PD+ + LL  +I D+
Sbjct: 125 ELSRMARMGSGSASRSIFGGFSVWQKGDSDQT---SYAYPLNEE-PDMDLRLLAVEINDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           EKKI S + ME+++  SPF+  W  +  +++  +++AI   DF KLG +AE NA +MHA 
Sbjct: 181 EKKISSTKGMEMSKS-SPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASEMHAL 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L
Sbjct: 240 TFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVL 284


>gi|238854636|ref|ZP_04644966.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 269-3]
 gi|260664421|ref|ZP_05865273.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii SJ-7A-US]
 gi|282932973|ref|ZP_06338370.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|313472180|ref|ZP_07812672.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 1153]
 gi|238832426|gb|EEQ24733.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 269-3]
 gi|239529554|gb|EEQ68555.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 1153]
 gi|260561486|gb|EEX27458.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii SJ-7A-US]
 gi|281303008|gb|EFA95213.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
          Length = 320

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 190/321 (59%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK+D+ L LPL +S+S++L    T T + +ID++    ILNGQ+
Sbjct: 2   KNTARAHTNIALIKYWGKKDADLRLPLMSSISMTLDAFYTDTSL-IIDTEDKKFILNGQE 60

Query: 83  ISSQSS--FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++ Q++   F    +   LF       F + + N++PT AGLASS+S FAAL  +  + Y
Sbjct: 61  VTGQAANRVFAYVERLQKLFNVSGN--FHVISDNHVPTAAGLASSSSAFAALAASFVKAY 118

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPDLRIGLL 199
           ++   ++ LS +ARLGSGSA RS Y GF +W  GT  N  +SFA     +   DLR+  +
Sbjct: 119 NLSISTKGLSILARLGSGSATRSVYGGFVKWNKGT--NSSNSFAEVIEEKPQMDLRLLAV 176

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           ++   EKK+ S E M++ +  SPFF  W  +   ++  ++ AI + DF KLG++AE +A 
Sbjct: 177 EVNVAEKKLSSTEGMKLAQT-SPFFKPWIARNDEEIEQMETAIKNNDFTKLGQLAELSAS 235

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IE 315
           +MHA  +AA P   Y+  ET++ ++ + + R   +  Y+T+DAGPN+K+L        I+
Sbjct: 236 EMHAINLAAQPGFTYFANETLEIIKLIQELRNNGLECYYTIDAGPNVKILCQKNSCSDIK 295

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           + +K   P + I++    P +
Sbjct: 296 KYVKNILPNVKIVEAGFGPGI 316


>gi|42519131|ref|NP_965061.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii NCC
           533]
 gi|41583418|gb|AAS09027.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii NCC
           533]
 gi|329667334|gb|AEB93282.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii DPC
           6026]
          Length = 321

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/294 (41%), Positives = 175/294 (59%), Gaps = 11/294 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++   V  +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSVEDS--KRVFNYIHLLQEKFGVNDHFTIRSTNHVPTSAGLASSASAFAALATSFVAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+A P +   PDL + LL
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAAPIDEN-PDLDLSLL 176

Query: 200 --KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
             ++  ++KKI S + M++ +  SPF+  W  +   ++A IKQAI + DF ++GE++E +
Sbjct: 177 AIEVNTKQKKISSTKGMQLAQT-SPFYQPWLARNEEEIAEIKQAIQNNDFTRIGELSELS 235

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           A +MHA  + A  P  Y++ ETI+ ++ V D R+  I  Y+T+DAGPN+K+L T
Sbjct: 236 ANEMHACNLTAKEPFTYFEPETIKIIKLVEDLRKNGIECYYTIDAGPNVKILCT 289


>gi|313621638|gb|EFR92442.1| diphosphomevalonate decarboxylase [Listeria innocua FSL S4-378]
          Length = 242

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 148/239 (61%), Gaps = 8/239 (3%)

Query: 74  DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAA 131
           D  ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAA
Sbjct: 5   DTFILNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAA 59

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
           L LA        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+ 
Sbjct: 60  LALAGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGERADGSDSFAVPFTNKL 119

Query: 192 PD-LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKL 250
            D + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+
Sbjct: 120 CDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKV 179

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           GE+ E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 180 GEITERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 238


>gi|325686246|gb|EGD28289.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 319

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 172/285 (60%), Gaps = 14/285 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK+D+KL LPL +SLS++L    + T I+  DS+     LNGQ +S  ++ 
Sbjct: 9   TNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKIS--DSEQMSFKLNGQAVSGPAAD 66

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F       D F    K    +E+ N +PT AGLASS+S FA++  A    Y +     
Sbjct: 67  RVFAYLRAMQDRFG--VKGNLAVESVNQVPTAAGLASSSSAFASMAAAFADHYQLGVDRR 124

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFNNQWPDLRIGLL--KIIDR 204
            LSR+AR+GSGSA RS + GF  W  G +DQ    S+A P + + PD+ + LL  +I D+
Sbjct: 125 ELSRMARMGSGSASRSIFGGFSVWQKGDSDQT---SYAYPLDEE-PDMDLRLLAVEINDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           EKKI S + ME+++  SPF+  W  +  +++  +++AI   DF KLG +AE NA +MHA 
Sbjct: 181 EKKISSTKGMEMSKS-SPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASEMHAL 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L
Sbjct: 240 TFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVL 284


>gi|302557476|ref|ZP_07309818.1| diphosphomevalonate decarboxylase [Streptomyces griseoflavus
           Tu4000]
 gi|302475094|gb|EFL38187.1| diphosphomevalonate decarboxylase [Streptomyces griseoflavus
           Tu4000]
          Length = 349

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 168/309 (54%), Gaps = 16/309 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSSF 89
           NIAL KYWGKRD +L +P  +SLS++L    T T + +   + AD + L+G    ++   
Sbjct: 28  NIALIKYWGKRDERLMIPYVDSLSMTLDIFPTTTTVRLAPGAPADSLTLDGSP--AEGEV 85

Query: 90  FKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++   F DL R+ S      +++T N++PT AGLASSASGFAAL LA    Y +     
Sbjct: 86  RRRVVGFLDLLRERSGRSEPAVVDTHNSVPTGAGLASSASGFAALALAGAAAYGLDPDRT 145

Query: 148 SLSRVARLGSGSACRSFYRGF--CEWICGTDQNG-MDSFAVPFNNQWPDLRIGL-LKIID 203
           +LSR+AR GS SA RS + GF  C    GT     + S+A P     PD    L + ++D
Sbjct: 146 ALSRLARRGSASASRSIFGGFAVCHAGRGTGAAADLGSYAEPV--PVPDFDPALVIAVVD 203

Query: 204 R-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K + SR AM  T   SP +  W     TDLA ++ A+   D   +GE+AE+NAL MH
Sbjct: 204 AGAKAVSSRAAMRRTVETSPLYRAWATSGKTDLAEMRVALRRGDLDAVGEIAERNALGMH 263

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETI 318
           ATM+ A P + Y    T+  ++ V   R   +P Y T+DAGPN+K+L       ++ E +
Sbjct: 264 ATMLTARPAVRYLSPATVAVLDGVLRLRSDGVPAYATMDAGPNVKVLCHPADADRVAEAV 323

Query: 319 KQFFPEITI 327
           +   P  ++
Sbjct: 324 RGAAPGCSV 332


>gi|256851166|ref|ZP_05556555.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 27-2-CHN]
 gi|260660590|ref|ZP_05861505.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii
           115-3-CHN]
 gi|282934632|ref|ZP_06339875.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|297206031|ref|ZP_06923426.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii JV-V16]
 gi|256616228|gb|EEU21416.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 27-2-CHN]
 gi|260548312|gb|EEX24287.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii
           115-3-CHN]
 gi|281301207|gb|EFA93508.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|297149157|gb|EFH29455.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii JV-V16]
          Length = 320

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 193/324 (59%), Gaps = 19/324 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK+D+ L LPL +S+S++L    T T + +ID++    ILNGQ+
Sbjct: 2   KNTARAHTNIALIKYWGKKDADLRLPLMSSISMTLDAFYTDTSL-LIDTEDKKFILNGQE 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALF 137
           ++  ++      +  D   +  K++     F + + N++PT AGLASS+S FAAL  +  
Sbjct: 61  VTGPAA-----NRVFDYVERLQKLFNVAGNFHVISDNHVPTAAGLASSSSAFAALAASFV 115

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPDLRI 196
           + Y++    + LS +ARLGSGSA RS Y GF +W  GT  N  +SFA   + +   DL++
Sbjct: 116 KAYNLSISPKGLSILARLGSGSATRSIYGGFVKWNKGT--NSANSFAEVIDEKPQMDLKL 173

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             ++I + EKK+ S + M++ +  SPFF  W  +   ++A ++ AI   DF KLG++AE 
Sbjct: 174 LAVEISEAEKKLSSTKGMKLAQT-SPFFKPWIARNDEEIAQMEAAIKSNDFTKLGQLAEL 232

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH---- 312
           +A +MHA  +AA P   Y+  ET++ ++ + + R + +  Y+T+DAGPN+K+L       
Sbjct: 233 SASEMHAINLAAQPGFTYFANETLEIIKLIQELRNKGLECYYTIDAGPNVKILCQKNSCS 292

Query: 313 KIEETIKQFFPEITIIDPLDSPDL 336
            I++ +K   P + I++    P +
Sbjct: 293 NIKKYVKNILPNVKIVEAGFGPGI 316


>gi|116492691|ref|YP_804426.1| diphosphomevalonate decarboxylase [Pediococcus pentosaceus ATCC
           25745]
 gi|116102841|gb|ABJ67984.1| diphosphomevalonate decarboxylase [Pediococcus pentosaceus ATCC
           25745]
          Length = 327

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 169/307 (55%), Gaps = 7/307 (2%)

Query: 20  INEKSS-AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           +NEK   A   +NIAL KYWGK +S L LP N+S+SL+L    T T +T  D   ++   
Sbjct: 1   MNEKHGFARAHTNIALLKYWGKINSDLILPANDSISLTLDKFYTDTEVTFSDEYTSNLFY 60

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-QFSKVYFL-IETSNNIPTKAGLASSASGFAALTLA 135
           LN Q I  +    ++  +  +  + +F    F  IE+ N++PT AGLASSASG AAL  A
Sbjct: 61  LNHQLIDVKK--MQRINRVLEAVKSEFGYQGFAKIESENHVPTAAGLASSASGMAALAGA 118

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
                       +LSR+ARLGSGSA RS + G   W  G D     +  +   +Q  DL 
Sbjct: 119 AVSALGSHTDLTNLSRLARLGSGSASRSVFGGIVHWHRGYDHQSSFAEQIVSEDQI-DLN 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + I  R+KK+ S   M+ T   SPF+  W +  +  +  +  A+ + DF K+GE+AE
Sbjct: 178 MVTIVIDRRQKKVKSTLGMQHTASTSPFYPAWVEATNQAIPEMISAVQNNDFTKIGELAE 237

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
            +A  MHAT +++ P   Y+  ETIQ ++ V   R+  I  Y+T+DAGPN+K+L   K  
Sbjct: 238 HSAAMMHATTLSSKPAFTYFAPETIQAIKLVEQLRESGIECYYTIDAGPNVKVLCQSKNI 297

Query: 316 ETIKQFF 322
             +K+FF
Sbjct: 298 TRVKRFF 304


>gi|116629675|ref|YP_814847.1| mevalonate pyrophosphate decarboxylase [Lactobacillus gasseri ATCC
           33323]
 gi|238854239|ref|ZP_04644583.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 202-4]
 gi|282852205|ref|ZP_06261557.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 224-1]
 gi|311110682|ref|ZP_07712079.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri MV-22]
 gi|116095257|gb|ABJ60409.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri ATCC
           33323]
 gi|238833050|gb|EEQ25343.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 202-4]
 gi|282556624|gb|EFB62234.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 224-1]
 gi|311065836|gb|EFQ46176.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri MV-22]
          Length = 321

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 120/295 (40%), Positives = 181/295 (61%), Gaps = 13/295 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK +  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKANQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQ---FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +   + S  K+   +  L ++   F+  +F+I+++N++PT AGLASSAS FAAL  +   
Sbjct: 62  EQGPEES--KRVFNYIHLLQEKFGFND-HFIIKSTNHVPTSAGLASSASAFAALATSFAA 118

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
            Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+A+P +   PDL + L
Sbjct: 119 SYDLDLSRKDLSRLARLGSGSATRSIYGGFVEWQKGIDD--ASSYAIPIDEN-PDLDLSL 175

Query: 199 L--KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           L  ++  ++KKI S + M++ +  SPF+  W  +   ++A +KQAI ++DF K+G+++E 
Sbjct: 176 LALEVDTKQKKISSTKGMKLAQT-SPFYQPWLARNKQEIAELKQAIKEKDFTKIGKLSEL 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           +A +MHA  + A+ P  Y++ ETI+ ++ V D R+Q I  Y+T+DAGPN+K+L T
Sbjct: 235 SANEMHACNLTANEPFTYFEPETIKAIKLVEDLRKQGIECYYTIDAGPNVKILCT 289


>gi|104773998|ref|YP_618978.1| mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116514014|ref|YP_812920.1| mevalonate pyrophosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|103423079|emb|CAI97800.1| Mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116093329|gb|ABJ58482.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125703|gb|ADY85033.1| Mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 319

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 181/309 (58%), Gaps = 18/309 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK+D+KL LPL +SLS++L    + T I+  DS+     LNGQ +S  ++ 
Sbjct: 9   TNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKIS--DSEQMSFKLNGQAVSGPAAD 66

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F       D F    K    +E+ N +PT AGLASS+S FAA+  A    Y +    +
Sbjct: 67  RVFAYLRAMQDRFG--VKGNLAVESVNQVPTAAGLASSSSAFAAMAAAFADHYQLGVDRQ 124

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFNNQWPDLRIGLL--KIIDR 204
            LSR+AR+GSGSA RS + GF  W  G +DQ    S+A P + + PD+ + LL  +I D+
Sbjct: 125 ELSRMARMGSGSASRSVFGGFSVWQKGDSDQT---SYAYPLDEE-PDMDLRLLAVEINDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           EKKI S + ME+++  SPF+  W  +  +++  +++AI   DF KLG +AE NA +MH  
Sbjct: 181 EKKISSTKGMEMSKS-SPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASEMHTL 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----KQ 320
              A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L   K  + I    + 
Sbjct: 240 TFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVLCQGKNSKDIINCFES 299

Query: 321 FFPEITIID 329
            F  + II+
Sbjct: 300 SFDRVKIIE 308


>gi|227890030|ref|ZP_04007835.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii ATCC
           33200]
 gi|227849474|gb|EEJ59560.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii ATCC
           33200]
          Length = 321

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 176/294 (59%), Gaps = 11/294 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQ-FSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++ F    +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSVEDS--KRVFNYIHLLQEKFGMTDHFTIRSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+AVP +   PDL + LL
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAVPIDEN-PDLDLSLL 176

Query: 200 --KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
             ++  ++KKI S + M++ +  SPF+  W  +   ++A IK+AI + DF ++GE++E +
Sbjct: 177 AIEVNTKQKKISSTKGMQLAQT-SPFYQTWLARNEEEIAEIKKAIQNNDFTRIGELSELS 235

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           A +MHA  + A  P  Y++ ETI+ ++ V D R+  I  Y+T+DAGPN+K++ T
Sbjct: 236 ANEMHACNLTAKEPFTYFEPETIKIIKLVEDLRKNGIECYYTIDAGPNVKIICT 289


>gi|300812419|ref|ZP_07092849.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496586|gb|EFK31678.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 319

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 173/285 (60%), Gaps = 14/285 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK+D+KL LPL +SLS++L    + T I+  DS+     LNGQ +S  ++ 
Sbjct: 9   TNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKIS--DSEQMSFKLNGQAVSGPAAD 66

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F       D F    K    +E+ N +PT AGLASS+S FAA+  A    Y +    +
Sbjct: 67  RVFAYLRAMQDRFG--VKGNLAVESVNQVPTAAGLASSSSAFAAMAAAFADHYQLGVDRQ 124

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFNNQWPDLRIGLL--KIIDR 204
            LSR+AR+GSGSA RS + GF  W  G +DQ    S+A P + + PD+ + LL  +I D+
Sbjct: 125 ELSRMARMGSGSASRSVFGGFSVWQKGDSDQT---SYAYPLDEE-PDMDLRLLAVEINDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           EKKI S + M++++  SPF+  W  +  +++  +++AI   DF KLG +AE NA +MHA 
Sbjct: 181 EKKISSTKGMKMSKS-SPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASEMHAL 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L
Sbjct: 240 TFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVL 284


>gi|297621344|ref|YP_003709481.1| putative diphosphomevalonate decarboxylase [Waddlia chondrophila
           WSU 86-1044]
 gi|297376645|gb|ADI38475.1| putative diphosphomevalonate decarboxylase [Waddlia chondrophila
           WSU 86-1044]
          Length = 311

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 165/297 (55%), Gaps = 22/297 (7%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK--ISSQSS 88
           ++AL KYWGK ++ LNLP  +SL++SL  L T T +++  S+ D I +NG++  I    S
Sbjct: 11  SLALIKYWGKSNTALNLPATSSLAVSLDTLRTKTTVSI--SEDDRIFINGKQAPIERFRS 68

Query: 89  FF---KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           FF   +KTT     F  +S        S N P  AGLASS+SGFAAL L   R+ +    
Sbjct: 69  FFENFRKTTGSDQRFSAYS--------STNFPVAAGLASSSSGFAALALGCARLINPEIP 120

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
            E++S +AR GS SA RS + GF   I   D    +    P N  WP+LR+ +  + +  
Sbjct: 121 LETISSLARFGSASAARSLFGGFT--ILKKDAESSE----PLNIDWPELRVIIGIVTNSS 174

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K+I SREAME  R  SPF+  W ++     +    A+  ++   LG +  ++ L M +TM
Sbjct: 175 KEISSREAMECARETSPFYDSWLKKADEFFSQSVPAVQKRELNTLGPLIRQSYLSMFSTM 234

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQF 321
           + ++P  LYW+ E++  +    + RQ+ I I+ T+DAGP +K++   H ++  +++ 
Sbjct: 235 LTSTPSTLYWKPESVALLHSCEELRQEGISIWETMDAGPQVKMVCLEHDLDSALQRL 291


>gi|255016732|ref|ZP_05288858.1| hypothetical protein LmonF_00676 [Listeria monocytogenes FSL
           F2-515]
          Length = 280

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 146/239 (61%), Gaps = 8/239 (3%)

Query: 74  DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAA 131
           D  ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAA
Sbjct: 11  DTFILNNEQKTDA-----KVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAA 65

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
           L LA        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+ 
Sbjct: 66  LALAGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKL 125

Query: 192 PD-LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKL 250
            D + + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+
Sbjct: 126 CDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKV 185

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           GE+ E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++
Sbjct: 186 GEITERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVI 244


>gi|194468008|ref|ZP_03073994.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri 100-23]
 gi|194452861|gb|EDX41759.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri 100-23]
          Length = 323

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 172/292 (58%), Gaps = 10/292 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D  L +P  +SLSL+L    T T +   +   +D + ++   
Sbjct: 2   ATAKAHTNIALVKYWGKKDQDLIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQHI 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  +K     D+ RQ S  K +  +++ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--QKVVHVLDIVRQLSGIKSFARVDSINHVPTAAGLASSASAFAALAGAASTAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGL 198
            +   S  LSR+AR GSGSA RS Y G  EW  GTD +   SFA P   N  +P   + +
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDDDS--SFAQPVLENVDFPIEMLAV 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L +  ++KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NA
Sbjct: 178 L-VDTKKKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           L+MHA   +A P   Y+  ET+  ++ V D R Q +  Y+T+DAGPN+K+++
Sbjct: 237 LRMHALTFSADPGFTYFNGETLTIIKAVEDLRNQGVNCYYTMDAGPNVKVIY 288


>gi|310823053|ref|YP_003955411.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|309396125|gb|ADO73584.1| Diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 332

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 172/297 (57%), Gaps = 10/297 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIIL 78
           + + K++A    NIAL KYWGKRD  L LP  +SLSL+L  + ++T      + AD + +
Sbjct: 2   RASMKATALAHPNIALVKYWGKRDDALILPHQSSLSLTLSPM-SVTTTVEFGASADQVEI 60

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYF---LIETSNNIPTKAGLASSASGFAALTLA 135
           NG   +++ S   +  +  +  +  +        + +  + P  AGLASSA+GFAAL +A
Sbjct: 61  NGH--AAKGSERDRVLRVLEAVKAEAGGALGPARMVSRGDFPAAAGLASSAAGFAALAVA 118

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPD 193
                 +P   ++ S +ARLGSGSACRS   GFCEW  G   +G DSFAV       WP+
Sbjct: 119 ARAAAGLPADPQAASLLARLGSGSACRSIQGGFCEWRRGERDDGADSFAVQRFAEGHWPE 178

Query: 194 LRIGLLKIIDREKK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           LR+ ++ I++RE+K + SR+ M++T   SP++  W +    ++    + I  +D   LG 
Sbjct: 179 LRM-VVAILNREEKAVKSRDGMKLTVETSPYYAAWAKDAEAEIPRAVELIQRKDLEGLGA 237

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           ++E+NA +MHAT  AA PPL Y    T+  +E + + R++  P++FTLDAGPN  LL
Sbjct: 238 LSERNAWRMHATAFAADPPLSYMHPSTLGLIEHLREQRKKGTPVWFTLDAGPNPVLL 294


>gi|148544143|ref|YP_001271513.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri DSM 20016]
 gi|184153516|ref|YP_001841857.1| mevalonate diphosphate decarboxylase [Lactobacillus reuteri JCM
           1112]
 gi|227364572|ref|ZP_03848633.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM2-3]
 gi|325682313|ref|ZP_08161830.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM4-1A]
 gi|148531177|gb|ABQ83176.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri DSM 20016]
 gi|183224860|dbj|BAG25377.1| mevalonate diphosphate decarboxylase [Lactobacillus reuteri JCM
           1112]
 gi|227070409|gb|EEI08771.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM2-3]
 gi|324978152|gb|EGC15102.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM4-1A]
          Length = 323

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 172/292 (58%), Gaps = 10/292 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D  L +P  +SLSL+L    T T +   +   +D + ++   
Sbjct: 2   ATAKAHTNIALVKYWGKKDQDLIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQHI 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  +K     D+ RQ S  K +  +++ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--QKVAHVLDIVRQLSGIKSFARVDSINHVPTAAGLASSASAFAALAGAASVAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGL 198
            +   S  LSR+AR GSGSA RS Y G  EW  GTD +   SFA P   N  +P   + +
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDDDS--SFAQPVLENVDFPIEMLAV 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L +  ++KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NA
Sbjct: 178 L-VDTKKKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           L+MHA   +A P   Y+  ET+  ++ V D R Q +  Y+T+DAGPN+K+++
Sbjct: 237 LRMHALTFSADPGFTYFNGETLTIIKAVEDLRNQGVNCYYTMDAGPNVKVIY 288


>gi|115377891|ref|ZP_01465077.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|115365106|gb|EAU64155.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 328

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 170/293 (58%), Gaps = 10/293 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A    NIAL KYWGKRD  L LP  +SLSL+L  + ++T      + AD + +NG  
Sbjct: 2   KATALAHPNIALVKYWGKRDDALILPHQSSLSLTLSPM-SVTTTVEFGASADQVEINGH- 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYF---LIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +++ S   +  +  +  +  +        + +  + P  AGLASSA+GFAAL +A    
Sbjct: 60  -AAKGSERDRVLRVLEAVKAEAGGALGPARMVSRGDFPAAAGLASSAAGFAALAVAARAA 118

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPDLRIG 197
             +P   ++ S +ARLGSGSACRS   GFCEW  G   +G DSFAV       WP+LR+ 
Sbjct: 119 AGLPADPQAASLLARLGSGSACRSIQGGFCEWRRGERDDGADSFAVQRFAEGHWPELRM- 177

Query: 198 LLKIIDREKK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           ++ I++RE+K + SR+ M++T   SP++  W +    ++    + I  +D   LG ++E+
Sbjct: 178 VVAILNREEKAVKSRDGMKLTVETSPYYAAWAKDAEAEIPRAVELIQRKDLEGLGALSER 237

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           NA +MHAT  AA PPL Y    T+  +E + + R++  P++FTLDAGPN  LL
Sbjct: 238 NAWRMHATAFAADPPLSYMHPSTLGLIEHLREQRKKGTPVWFTLDAGPNPVLL 290


>gi|258545234|ref|ZP_05705468.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Cardiobacterium hominis ATCC 15826]
 gi|258519522|gb|EEV88381.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Cardiobacterium hominis ATCC 15826]
          Length = 192

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 114/192 (59%), Gaps = 2/192 (1%)

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +PE    LS +ARLGSGSA RS + GF +W  GT  +G DS A P  + W +LRI L++I
Sbjct: 3   LPEGD--LSALARLGSGSAARSLWHGFVKWERGTRDDGRDSIAAPIASDWQELRIALVEI 60

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               KK  S + M  T   SP +  W      DLA I+ AI  +DF  LG VAE NAL M
Sbjct: 61  DSGAKKTASGDGMNHTTATSPLYAAWPATAQADLAAIEAAIHARDFSALGSVAEANALAM 120

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HATM+AA P L Y Q +T+  + R+W AR + + IY T+DAGPN+K+L   + E  ++  
Sbjct: 121 HATMLAARPALCYLQAQTLTTLHRLWQARAEGLEIYATIDAGPNVKILCRARDEAAVRAI 180

Query: 322 FPEITIIDPLDS 333
           FP+   ++P  S
Sbjct: 181 FPQALWVNPFQS 192


>gi|256847333|ref|ZP_05552779.1| diphosphomevalonate decarboxylase [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715997|gb|EEU30972.1| diphosphomevalonate decarboxylase [Lactobacillus coleohominis
           101-4-CHN]
          Length = 322

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 174/301 (57%), Gaps = 10/301 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K+SA   +NIAL KYWGK+D +L +P  +SLSL+L    T T +  I+S   D +I++ Q
Sbjct: 2   KASARAHTNIALVKYWGKKDPQLIIPQTDSLSLTLDKFFTDTTVEFIESLKQDELIIDDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRI 139
            ++ Q     K T      R  S  ++   + + NN+P  AGLASSAS FAAL LA    
Sbjct: 62  PVAPQK--MAKVTAVLSQVRSLSHQHYFAKVISQNNVPMAAGLASSASAFAALALAASTA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +      LSR+AR GSGSA RS + G  EW  G D     S+A P   Q  D  I ++
Sbjct: 120 AGLHLSPRDLSRLARRGSGSATRSIFGGLVEWHAGVDDAS--SYAEPIMEQV-DFGIEMI 176

Query: 200 KII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            I+   ++KK+ SR  M+++   SPF+  W + ++ D+  +K AI  +D  ++G +AE+N
Sbjct: 177 AILIDTKQKKVSSRGGMQLSVTTSPFYPAWRKVVADDMQAMKTAISKRDINQMGHIAEEN 236

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           A++MHA  ++A P   Y++  TI+ +  +   R+Q I  Y+T+DAGPN+K+++ H+  + 
Sbjct: 237 AMRMHALTMSADPAYTYFEGATIKAINLIKGLREQGINCYYTMDAGPNVKVIYNHQDRQR 296

Query: 318 I 318
           I
Sbjct: 297 I 297


>gi|255029406|ref|ZP_05301357.1| hypothetical protein LmonL_10403 [Listeria monocytogenes LO28]
          Length = 254

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 135/212 (63%), Gaps = 1/212 (0%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFC 169
           I + N++PT AGLASSAS FAAL LA        +  E +SR+AR GSGSA RS +  F 
Sbjct: 18  ITSENHVPTAAGLASSASAFAALALAGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFV 77

Query: 170 EWICGTDQNGMDSFAVPFNNQWPD-LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT 228
            W  G   +G DSFAVPF N+  D + + +  + D+EKK+ SR+ M +T   SPFF  W 
Sbjct: 78  IWEKGELADGSDSFAVPFTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWV 137

Query: 229 QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD 288
                DL  +KQAI+D+DFIK+GE+ E+N +KMHAT + A PP  Y+Q ++++ M+ V +
Sbjct: 138 SAAEIDLEEMKQAILDEDFIKVGEITERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRE 197

Query: 289 ARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
            R+  IP YFT+DAGPN+K++     E  + +
Sbjct: 198 LRENGIPAYFTMDAGPNVKVICERANENIVAE 229


>gi|268319452|ref|YP_003293108.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii FI9785]
 gi|262397827|emb|CAX66841.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii FI9785]
          Length = 321

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 175/294 (59%), Gaps = 11/294 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQ-FSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++ F    +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSLEDS--KRVFNYIHLLQEKFGMTDHFTIRSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+AVP +   PD+ + LL
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAVPIDEN-PDIDLSLL 176

Query: 200 --KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
             +I  ++KKI S + M++ +  SPF+  W  +   ++  IKQAI + DF K+GE++E +
Sbjct: 177 AIEINTKQKKISSTKGMQLAQT-SPFYQTWLARNEQEITEIKQAIQNNDFTKIGELSELS 235

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           A +MHA  + A  P  Y++ ETI+ ++ V + R+  I  Y+T+DAGPN+K++ T
Sbjct: 236 ANEMHACNLTAKEPFTYFEPETIKIIKLVEELRKNGIECYYTIDAGPNVKIICT 289


>gi|227513348|ref|ZP_03943397.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri ATCC
           11577]
 gi|227524491|ref|ZP_03954540.1| diphosphomevalonate decarboxylase [Lactobacillus hilgardii ATCC
           8290]
 gi|227083221|gb|EEI18533.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri ATCC
           11577]
 gi|227088361|gb|EEI23673.1| diphosphomevalonate decarboxylase [Lactobacillus hilgardii ATCC
           8290]
          Length = 336

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 173/309 (55%), Gaps = 8/309 (2%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           N   +A   +NIAL KYWGK+D  L +P  +SLSL+L H  T T +   +S   D II++
Sbjct: 14  NNPVTARAHTNIALIKYWGKKDESLIIPYTSSLSLTLDHFYTDTTVRFDESLSTDQIIID 73

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ  S +S   ++   F ++ R  +++     I ++N++PT AGLASSAS FAAL  +  
Sbjct: 74  GQIPSEKSR--QRVRDFLEIVRGKAQIAIPASISSTNHVPTAAGLASSASAFAALAASAS 131

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRI 196
           +   +   +  LS++AR GSGSACRS +  F EW  GT  N  DS+A P  +    D+R+
Sbjct: 132 KAAGLHLDATELSKLARRGSGSACRSVFGHFVEWQRGT--NDADSYAKPLPDTGLNDIRV 189

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             L +   +K + SR+ M ++   SP++  W +    DL  +K AI   DF + G+++E 
Sbjct: 190 VALTVERGQKAVSSRQGMHLSVTTSPYYPAWVKTCQADLLQLKSAIEKGDFTRFGKISEL 249

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA++MHA  ++A P   Y+  +T+  M  V   R Q    Y+T+DAGPN+K+L       
Sbjct: 250 NAMRMHALTLSADPSFTYFNGQTLAIMNLVKQLRHQGTECYYTIDAGPNVKVLCQQSTVA 309

Query: 317 TIKQFFPEI 325
            I   F ++
Sbjct: 310 KISATFAQV 318


>gi|254787175|ref|YP_003074604.1| diphosphomevalonate decarboxylase [Teredinibacter turnerae T7901]
 gi|237684278|gb|ACR11542.1| diphosphomevalonate decarboxylase [Teredinibacter turnerae T7901]
          Length = 335

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 107/316 (33%), Positives = 167/316 (52%), Gaps = 14/316 (4%)

Query: 23  KSSAFLPSNIALCKYWGK-RDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +++A    NIAL KYWGK  ++  N P  +SLS++L  L T T +T   +   D + LNG
Sbjct: 8   QATAIAHPNIALIKYWGKAENTTANEPAVSSLSITLDELATRTTLTFDTAYKTDRLTLNG 67

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFR 138
           +  +++     + +    + RQ + +     I+TSNN PT AGLASSASGFAAL +A  +
Sbjct: 68  KPDTAK---LPRISSALSVMRQLAGITTPCHIDTSNNFPTGAGLASSASGFAALVVAANQ 124

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN------NQWP 192
              +    +  S++AR  SGSA RS + GF +      Q     F   +       + WP
Sbjct: 125 ALDLNLSLQQQSKLARAMSGSAARSLFGGFAKIYLPHAQLEPAPFGANYAEPVAPADHWP 184

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
            L + +  + + EK IGS   ME +R+ SP+++ W      D+ + +  +  +DF KL E
Sbjct: 185 -LEVCVGVVSEEEKAIGSTAGMENSRNTSPYYSAWIAGNDADVINAEALVKARDFDKLAE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           ++E + LKMHA  +A+ P LLYW   T+  M  +   R +  P++FT+DAGP +K +   
Sbjct: 244 LSEFSCLKMHALALASRPALLYWSGATMDAMRAIQRWRAEGTPVFFTVDAGPQIKAICAP 303

Query: 313 KIEETIKQFFPEITII 328
              E + Q   E+  I
Sbjct: 304 GYGELVAQRLSELAGI 319


>gi|227529133|ref|ZP_03959182.1| diphosphomevalonate decarboxylase [Lactobacillus vaginalis ATCC
           49540]
 gi|227350977|gb|EEJ41268.1| diphosphomevalonate decarboxylase [Lactobacillus vaginalis ATCC
           49540]
          Length = 323

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 118/303 (38%), Positives = 178/303 (58%), Gaps = 10/303 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A   +NIAL KYWGK+D KL +P  +SLSL+L      T +   D   AD I ++GQ +
Sbjct: 3   TARAHTNIALVKYWGKKDQKLIIPQTDSLSLTLNEFYADTGVEFRDDLTADDIEIDGQPV 62

Query: 84  SSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +  S+  +K   F D  RQ S    Y  + ++N++P  AGLASSAS FAAL  A  +   
Sbjct: 63  TGHSA--EKVKDFLDHIRQISGNHNYAKVISTNHVPVSAGLASSASAFAALATAASKAAG 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +     SLSR+AR GSGSA RS Y G  EW  GTD     SFA P   +  D  I ++ I
Sbjct: 121 LNLDRRSLSRLARRGSGSATRSIYGGLVEWHRGTDDQS--SFAEPIMEKV-DFGIEMIAI 177

Query: 202 I--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           +    +KKI SR+ M+ +   SP++  W + ++ D+  +K+AI ++D  ++G +AE+NAL
Sbjct: 178 LINTTKKKISSRQGMQSSVESSPYYPTWRKVVAHDMVAMKEAISNKDIDQIGHIAEENAL 237

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  ++A P   Y+  +TI  ++ + D R Q +  Y+T+DAGPN+K+++  K  + I 
Sbjct: 238 RMHALTLSADPGYTYFNGDTIHAIQAINDLRSQGVSCYYTMDAGPNVKVIYDQKDRKKIV 297

Query: 320 QFF 322
           Q+ 
Sbjct: 298 QYL 300


>gi|330916537|ref|XP_003297454.1| hypothetical protein PTT_07872 [Pyrenophora teres f. teres 0-1]
 gi|311329848|gb|EFQ94456.1| hypothetical protein PTT_07872 [Pyrenophora teres f. teres 0-1]
          Length = 398

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 120/336 (35%), Positives = 178/336 (52%), Gaps = 27/336 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIIL 78
           ++S   P NIA+ KYWGKRD KLNLP N+SLS++L      TH T   S      D ++L
Sbjct: 6   RASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSSTYPKEDTLLL 65

Query: 79  NGQK-----ISSQSSF-----FKKTTQFCDL-FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NGQ        +Q+ F      +K  +  D    + S++   I + NN PT AGLASSA+
Sbjct: 66  NGQSQDVSGARTQACFRELRALRKQLEDKDSSLPKLSELPLRIVSENNFPTAAGLASSAA 125

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FAV 185
           GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F V
Sbjct: 126 GFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSASDGSDSVAFQV 185

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIID 244
              + WP++R  +L +   +K + S   M+IT   S  F ++ T+ +   +  +++AI D
Sbjct: 186 APASHWPNMRAVILVVSAAKKGVSSTSGMQITVATSSLFQSRATETVPRRMKEMQKAIQD 245

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF   G+V   ++   HAT +   PP+ Y     + TI+ +E +  A  + I  Y T D
Sbjct: 246 KDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDVSRATIKVVESINAAAGKIIAAY-TFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
           AGPN  + +  + E+ +   F  I     L+  D W
Sbjct: 305 AGPNAVIYYLEENEKEVAGLFKTI-----LNEKDGW 335


>gi|260101295|ref|ZP_05751532.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus DSM
           20075]
 gi|111610214|gb|ABH11599.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus
           CNRZ32]
 gi|260084880|gb|EEW69000.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus DSM
           20075]
 gi|328466025|gb|EGF37202.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus MTCC
           5463]
          Length = 320

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 177/305 (58%), Gaps = 11/305 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK +++L LPL +SLS++L    T T +   + D +   LNGQK  S+ S 
Sbjct: 9   TNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKTN-DENAFYLNGQKQDSKQSQ 67

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F   T+  + F     +  ++++ N++PT AGLASS+S FAAL  A  + Y+I    +
Sbjct: 68  RVFSYLTKLQNKFGYHDNL--IVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQVDKK 125

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   +KK
Sbjct: 126 ELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQM-DLHLLAVELNTNQKK 184

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA  + 
Sbjct: 185 ISSTSGMK-EAQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAINLT 243

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFP 323
           A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L     + +I E  K  F 
Sbjct: 244 AQPEFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLRNSKEIIERFKSVFN 303

Query: 324 EITII 328
            + I+
Sbjct: 304 NVNIV 308


>gi|323466406|gb|ADX70093.1| Mevalonate diphosphate decarboxylase [Lactobacillus helveticus H10]
          Length = 320

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 177/305 (58%), Gaps = 11/305 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK +++L LPL +SLS++L    T T +   + D +   LNGQK  S+ S 
Sbjct: 9   TNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKTN-DENAFYLNGQKQDSKQSQ 67

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F   T+  + F     +  ++++ N++PT AGLASS+S FAAL  A  + Y+I    +
Sbjct: 68  RVFSYLTKLQNKFGYHDNL--IVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQVDKK 125

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   +KK
Sbjct: 126 ELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQM-DLHLLAVELNTNQKK 184

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA  + 
Sbjct: 185 ISSTSGMK-EAQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAINLT 243

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFP 323
           A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L     + +I E  K  F 
Sbjct: 244 AQPEFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLKNSKEIIERFKSVFN 303

Query: 324 EITII 328
            + I+
Sbjct: 304 NVNIV 308


>gi|227510340|ref|ZP_03940389.1| diphosphomevalonate decarboxylase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227189992|gb|EEI70059.1| diphosphomevalonate decarboxylase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 336

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 173/309 (55%), Gaps = 8/309 (2%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           N   +A   +NIAL KYWGK+D  L +P  +SLSL+L H  T T +   +S   D II++
Sbjct: 14  NNPVTARAHTNIALIKYWGKKDESLIIPYTSSLSLTLDHFYTDTTVWFDESLSTDQIIID 73

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ  S +S   ++   F ++ R  +++     I ++N++PT AGLASSAS FAAL  +  
Sbjct: 74  GQIPSEKSR--QRVHDFLEIVRGKAQIAIPASISSTNHVPTAAGLASSASAFAALAASAS 131

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRI 196
               +   +  LS++AR GSGSACRS +  F EW  GT  N  DS+A P  ++   D+R+
Sbjct: 132 EAAGLHLDATELSKLARRGSGSACRSVFGHFVEWQRGT--NDADSYAKPLPDSGLNDIRV 189

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             L +   +K + SR+ M ++   SP++  W +    DL  +K AI   DF + G+++E 
Sbjct: 190 VALTVERGQKAVSSRQGMHLSVTTSPYYPAWVKTCQADLLQLKSAIEKGDFTRFGKISEL 249

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA++MHA  ++A P   Y+  +T+  M  V   R Q    Y+T+DAGPN+K+L       
Sbjct: 250 NAMRMHALTLSADPSFTYFNGQTLAIMNLVKQLRHQGTECYYTIDAGPNVKVLCQQSTVA 309

Query: 317 TIKQFFPEI 325
            I   F ++
Sbjct: 310 KISATFAQV 318


>gi|86475801|dbj|BAE78978.1| mevalonate diphosphate decarboxylase [Streptomyces sp. KO-3988]
          Length = 309

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 164/297 (55%), Gaps = 20/297 (6%)

Query: 47  LPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK 105
           LP  +SLS++L  L T T +    ++  D + L+G+    ++   ++   F DL R+ + 
Sbjct: 2   LPRVDSLSMTLDVLPTTTRVRRAPEAGQDEVTLDGRPAEGEA--LRRVVAFLDLVRERAG 59

Query: 106 VY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRS 163
           +    +++T+N + T AGLASSASGFAAL +A    Y +   + +LSR+AR GSGSA RS
Sbjct: 60  LADRAVVDTANTVATGAGLASSASGFAALAVAAAAAYGLDLDATALSRLARRGSGSASRS 119

Query: 164 FYRGFCEWICG-----TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDR-EKKIGSREAME 215
            + GF  W  G       +  + S+A  VP  +  P L   ++ ++D   K + SR AM 
Sbjct: 120 IFGGFAVWHAGLHSGAAAEADLSSYAEPVPVGDLDPAL---VVAVVDAGPKAVSSRAAMR 176

Query: 216 ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW 275
            T   SP +  W      DL  ++ A++  D   +GE+AE+NAL MHATM+AA P + Y 
Sbjct: 177 RTVDTSPLYEPWAVSSGDDLVDMRAALLAGDIEAVGEIAERNALGMHATMLAARPAVRYL 236

Query: 276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFPEITII 328
              T+  ++ V   R+  +P Y T+DAGPN+K+L       ++ +T++   P+ T++
Sbjct: 237 APATLTVLDSVLGLRRDGVPAYATMDAGPNVKVLCRSADAERVAKTLRVAVPDGTVL 293


>gi|262037204|ref|ZP_06010691.1| diphosphomevalonate decarboxylase [Leptotrichia goodfellowii F0264]
 gi|261748803|gb|EEY36155.1| diphosphomevalonate decarboxylase [Leptotrichia goodfellowii F0264]
          Length = 313

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 173/292 (59%), Gaps = 13/292 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T I+ I+S+ D   LNG  +   S  
Sbjct: 10  ANIAIIKYWGKKDAKNMIPATSSISLTLENMYTDTEISFIESETDVFYLNG--VLQDSKQ 67

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
            +K ++  DLFR+  +   LI++ NN+PT+AGL+SS+SG +AL  A  +++        L
Sbjct: 68  TEKISKVVDLFRENKEQKVLIKSENNMPTEAGLSSSSSGLSALIKACNKLFRKNMTRTEL 127

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK-- 207
           +R+++ GSGS+ RSF+     W    D++  + + +       DL++ ++ ++  E+K  
Sbjct: 128 ARISKYGSGSSARSFFGPIGAW----DKDTGEIYEIK-----TDLKLAMIMLVLNEEKKI 178

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M++    S  F +W +    +   +K+A+ + +F K+GE+ EKNAL MH T + 
Sbjct: 179 ISSREGMKLCGETSTIFDKWIKNSEIEYEEMKKALAENNFEKVGELTEKNALAMHETTLY 238

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           A+PP  Y   ++ + ME V   R+     YFT+DAGPN+K+L   K  E +K
Sbjct: 239 ANPPFSYLTDKSREAMEFVKKLRKSGEKCYFTMDAGPNVKVLCLEKDFEKLK 290


>gi|161507627|ref|YP_001577581.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus DPC
           4571]
 gi|15212071|emb|CAC51371.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus]
 gi|160348616|gb|ABX27290.1| Mevalonate diphosphate decarboxylase [Lactobacillus helveticus DPC
           4571]
          Length = 320

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 177/305 (58%), Gaps = 11/305 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS- 88
           +NIAL KYWGK +++L LPL +SLS++L    T T +   + D +   LNGQK  S+ S 
Sbjct: 9   TNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKTN-DENAFYLNGQKQDSKQSQ 67

Query: 89  -FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
             F   T+  + F     +  ++++ N++PT AGLASS+S FAAL  A  + Y+I    +
Sbjct: 68  RVFSYLTKLQNKFGYHDNL--IVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQVDKK 125

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   +KK
Sbjct: 126 ELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQM-DLHLLAVELNTNQKK 184

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA  + 
Sbjct: 185 ISSTSGMK-EAQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAINLT 243

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFP 323
           A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L     + +I E  K  F 
Sbjct: 244 AQPKFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLRNSKEIIERFKSVFN 303

Query: 324 EITII 328
            + I+
Sbjct: 304 NVNIV 308


>gi|50555265|ref|XP_505041.1| YALI0F05632p [Yarrowia lipolytica]
 gi|49650911|emb|CAG77848.1| YALI0F05632p [Yarrowia lipolytica]
          Length = 387

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 170/322 (52%), Gaps = 33/322 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILN 79
           ++S   P NIA  KYWGKRD  LNLP NNS+S++L    L T+T  +   D   D + LN
Sbjct: 4   QASTTAPVNIATLKYWGKRDPALNLPTNNSISVTLSQDDLRTLTTASCSPDFTQDELWLN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETS-----------------NNIPTKAGL 122
           G+    Q     K    C  FR+   +   +E S                 NN PT AGL
Sbjct: 64  GK----QEDVSGKRLVAC--FRELRALRHKMEDSDSSLPKLADQKLKIVSENNFPTAAGL 117

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+GFAAL  A+  +Y + E  E LS VAR GSGSACRS Y G+  W  GT+ +G DS
Sbjct: 118 ASSAAGFAALIRAVANLYELQETPEQLSIVARQGSGSACRSLYGGYVAWEMGTESDGSDS 177

Query: 183 FAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIK 239
            AV     + WP++R  +L +   +K   S   M++T H SP F +  T  +    A +K
Sbjct: 178 RAVQIATADHWPEMRAAILVVSADKKDTSSTTGMQVTVHTSPLFKERVTTVVPERFAQMK 237

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPI 296
           ++I+D+DF    E+  +++ + HAT + + PP+ Y     + +I+ +E +  A   +I  
Sbjct: 238 KSILDRDFPTFAELTMRDSNQFHATCLDSYPPIFYLNDVSRASIRVVEAINKAAGATIAA 297

Query: 297 YFTLDAGPNLKLLFTHKIEETI 318
           Y T DAGPN  + +  K EE +
Sbjct: 298 Y-TFDAGPNCVIYYEDKNEELV 318


>gi|108762661|ref|YP_633173.1| diphosphomevalonate decarboxylase [Myxococcus xanthus DK 1622]
 gi|108466541|gb|ABF91726.1| diphosphomevalonate decarboxylase [Myxococcus xanthus DK 1622]
          Length = 332

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 171/293 (58%), Gaps = 10/293 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A    NIAL KYWGKRD  L LP + S         ++T      + +D + LNG  
Sbjct: 6   KATALAHPNIALVKYWGKRDDALILP-HQSSLSLTLSPLSVTTTVEFGAASDQVELNGH- 63

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYF---LIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +++ S   +  +  +L R  +K       + +  + P  AGLASSA+GFAAL +A    
Sbjct: 64  -TAKGSERDRVLRLLELVRAQAKADLGPAKVVSRGDFPMAAGLASSAAGFAALAVAGRAA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP-FNN-QWPDLRIG 197
             +P +  + S +AR+GSGSACRS   GFCEW  G   +G DSFAV  F+   WPD+R+ 
Sbjct: 123 AGLPSEPRAASILARMGSGSACRSVQGGFCEWQRGERPDGEDSFAVQRFDAAHWPDVRM- 181

Query: 198 LLKIIDR-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           ++ I+DR EK++ SR+ M++T   SP++  W +    ++  +++ I  +D   LGE+ E+
Sbjct: 182 VVAILDRGEKEVKSRDGMKLTVDTSPYYPAWVKDAEVEVVQVREHIARRDLQALGELCER 241

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           NA +MHAT  AA+PPL Y    T+  +  + + R++ IP++FTLDAGPN  LL
Sbjct: 242 NAWRMHATSFAANPPLSYMSPGTLALILHLKEQRKKGIPVWFTLDAGPNPVLL 294


>gi|189196182|ref|XP_001934429.1| diphosphomevalonate decarboxylase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187980308|gb|EDU46934.1| diphosphomevalonate decarboxylase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 398

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 177/336 (52%), Gaps = 27/336 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIIL 78
           ++S   P NIA+ KYWGKRD KLNLP N+SLS++L      TH T   S      D ++L
Sbjct: 6   RASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSSTYPKEDTLLL 65

Query: 79  NGQK-----ISSQSSF-----FKKTTQFCDL-FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NGQ        +Q+ F      +K  +  D    + S++   I + NN PT AGLASSA+
Sbjct: 66  NGQSQDVSGARTQACFRELRALRKQLEDKDSSLPKLSELPLRIVSENNFPTAAGLASSAA 125

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FAV 185
           GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F V
Sbjct: 126 GFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSASDGSDSVAFQV 185

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIID 244
              + WP++R  +L +   +K + S   M+IT   S  F ++ T+ +   +  +++AI D
Sbjct: 186 APASHWPNMRAVILVVSAAKKGVSSTSGMQITVATSSLFQSRATETVPRRMKEMQKAIQD 245

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF   G+V   ++   HAT +   PP+ Y     +  I+ +E +  A  + I  Y T D
Sbjct: 246 KDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDVSRAAIKVVESINAAAGKIIAAY-TFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
           AGPN  + +  + E+ +   F  I     L+  D W
Sbjct: 305 AGPNAVIYYLEENEKEVAGLFKTI-----LNEKDGW 335


>gi|313222437|emb|CBY39357.1| unnamed protein product [Oikopleura dioica]
          Length = 389

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 171/328 (52%), Gaps = 28/328 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISS 85
           P NIAL KYWGKRDS+L LP N+S+SL+L    LGT T +    S + D ++LNG+    
Sbjct: 13  PVNIALVKYWGKRDSELILPYNDSVSLTLDEEKLGTRTTVRYSASYEEDSLVLNGKPTVI 72

Query: 86  QSSFFKKTTQFCDLFRQ--------------FSKVYFLIETSNNIPTKAGLASSASGFAA 131
            S       +    FR+               S+  F IET+N +PT AGLASSASG A 
Sbjct: 73  SSRLSNVIEEIRRAFRKHAVRIKMNAQDLMSMSRYRFRIETNNKMPTAAGLASSASGMAC 132

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNN 189
           +T AL     I E S  +S++ARLGSGSACRS + G  +W  G +++G DS A  +   +
Sbjct: 133 ITFALCTALGITE-SVDMSQLARLGSGSACRSIHGGLVQWEAGKEEDGSDSLAKQIYPAS 191

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
            WP+L+  +L +   +KK+GS E M+ +   S +     +Q    +  +  A   + F  
Sbjct: 192 TWPELKFIVLVVDGEKKKVGSTEGMQRSMATSEYMLLRPKQCKDRIQEVCWAFQAKLFPA 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNL 306
           L EV  K++  +HA    + PP+ Y  + +   I  + R+ +A    + + +T DAGPN 
Sbjct: 252 LAEVIIKDSNTLHAICRDSYPPVNYLTRTSEALIDFVHRLNEALGD-VCVAYTFDAGPNC 310

Query: 307 KLLFTHKIEETIK----QFFPEITIIDP 330
            ++F  K E  +       F E  +IDP
Sbjct: 311 FVIFEEKHESLLMWLLLHTFIENDVIDP 338


>gi|303316472|ref|XP_003068238.1| diphosphomevalonate decarboxylase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240107919|gb|EER26093.1| diphosphomevalonate decarboxylase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320037997|gb|EFW19933.1| diphosphomevalonate decarboxylase [Coccidioides posadasii str.
           Silveira]
          Length = 403

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 171/330 (51%), Gaps = 31/330 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------DCI 76
           +SS   P NIA+ KYWGKRD+ LNLP N+SLS++L       H T   SD+      D +
Sbjct: 10  RSSTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQANLRAHTTASCSDSYPHAEGDTL 69

Query: 77  ILNGQKISSQSSFFKKTTQFC--DL-------------FRQFSKVYFLIETSNNIPTKAG 121
           +LN +    Q+    K T  C  DL               + S     I + NN PT AG
Sbjct: 70  VLNSKP---QNIHASKRTLACLADLRILRRALEDADPSLPRLSAFPLRIVSENNFPTAAG 126

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  GT ++G D
Sbjct: 127 LASSAAGFAALVRAVADLYDLPQSPSELSRIARQGSGSACRSLMGGYVAWRSGTKEDGSD 186

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHI 238
           S A  V   + WP++R  +L + D +K + S E M+ TR  S  F  + T  +   +A +
Sbjct: 187 SLAEQVAPASHWPEMRALILVVSDAKKDVPSTEGMQATRATSTLFPFRVTSVVPERMAAM 246

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIP 295
           ++A+ ++DF    E+  +++   HAT +   PP+ Y    +   +  V D   A  ++I 
Sbjct: 247 EKAVQNRDFASFAEITMRDSNNFHATCLDTWPPIFYMNDVSRAAVRVVHDVNRAAGETIC 306

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  K  + +   F +I
Sbjct: 307 AY-TFDAGPNAVIYYLEKDSDRVLGTFRKI 335


>gi|313217596|emb|CBY38658.1| unnamed protein product [Oikopleura dioica]
 gi|313231898|emb|CBY09010.1| unnamed protein product [Oikopleura dioica]
          Length = 389

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 170/328 (51%), Gaps = 28/328 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISS 85
           P NIAL KYWGKRDS+L LP N+S+SL+L    LGT T +    S + D ++LNG+    
Sbjct: 13  PVNIALVKYWGKRDSELILPYNDSVSLTLDEEKLGTRTTVRYSASYEEDSLVLNGKPTVI 72

Query: 86  QSSFFKKTTQFCDLFRQ--------------FSKVYFLIETSNNIPTKAGLASSASGFAA 131
            S       +    FR+               S+  F IET+N +PT AGLASSASG A 
Sbjct: 73  SSRLSNVIEEIRRAFRKQAVRIKMNAQDLMSMSRYRFRIETNNKMPTAAGLASSASGMAC 132

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNN 189
           +T AL     I E S  +S +ARLGSGSACRS + G  +W  G +++G DS A  +   +
Sbjct: 133 ITFALCTALGITE-SVDMSELARLGSGSACRSIHGGLVQWEAGKEEDGSDSLAKQIYPAS 191

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
            WP+L+  +L +   +KK+GS E M+ +   S +     +Q    +  +  A   + F  
Sbjct: 192 TWPELKFIVLVVDGEKKKVGSTEGMQRSMATSEYMLLRPKQCKDRIQEVCWAFQAKLFPA 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNL 306
           L EV  K++  +HA    + PP+ Y  + +   I  + R+ +A    + + +T DAGPN 
Sbjct: 252 LAEVIIKDSNTLHAICRDSYPPVNYLTRTSEALIDFVHRLNEALGD-VCVAYTFDAGPNC 310

Query: 307 KLLFTHKIEETIK----QFFPEITIIDP 330
            ++F  K E  +       F E  +IDP
Sbjct: 311 FVIFEEKHESLLMWLLLHTFIENDVIDP 338


>gi|315288058|ref|ZP_07872190.1| diphosphomevalonate decarboxylase [Listeria ivanovii FSL F6-596]
 gi|313630872|gb|EFR98573.1| diphosphomevalonate decarboxylase [Listeria ivanovii FSL F6-596]
          Length = 265

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 144/238 (60%), Gaps = 3/238 (1%)

Query: 92  KTTQFCDLFRQ-FS-KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
           K T+F D  R+ F      LI + N++PT AGLASSAS FAAL LA        +  + +
Sbjct: 9   KVTRFIDKMREEFGLNARALIISENHVPTAAGLASSASAFAALALAGSHAAGRNDTQQYI 68

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGLLKIIDREKKI 208
           S++AR GSGSA RS Y  F  W  G   +G DSFAVPF  +  D + + +  + D++KK+
Sbjct: 69  SKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAVPFTKKLSDKISMVIAVVSDKKKKV 128

Query: 209 GSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
            SR+ M  T   SPFF  W     +DL  +KQAI+ +DFIK+GE+ E+N +KMHAT + A
Sbjct: 129 SSRDGMRSTVETSPFFKNWVAAAESDLEEMKQAILAEDFIKVGEITEQNGMKMHATTLGA 188

Query: 269 SPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
            PP  Y++  +++ M+ V + R   IP YFT+DAGPN+K++   K E  + +   E+T
Sbjct: 189 EPPFTYFKPLSLEIMDAVRELRGNGIPAYFTMDAGPNVKVICERKNERIVAEKLSELT 246


>gi|320593831|gb|EFX06234.1| diphosphomevalonate decarboxylase [Grosmannia clavigera kw1407]
          Length = 927

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 170/332 (51%), Gaps = 36/332 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITV----IDSDADCI 76
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +        D D +
Sbjct: 8   RASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQSDLRTLTTASTSSLFAGQDGDTL 67

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFR-----------------QFSKVYFLIETSNNIPTK 119
           +LNG+    QS      TQ C  FR                 + S     + + NN PT 
Sbjct: 68  LLNGE----QSDVSGARTQAC--FRALRSRRAALEAADPSLPKLSTYPLRVVSENNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G   +G
Sbjct: 122 AGLASSAAGFAALVRAIADLYELPDTPSQLSLIARQGSGSACRSVFGGYVAWRMGEAVDG 181

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V   + WPD+R  +L +   +K + S   M+ T   S  F Q   + +S  +A
Sbjct: 182 SDSLAEQVAPASAWPDMRALILVVSAAKKGVSSSSGMQQTVATSGLFKQRVAEVVSGHMA 241

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQS 293
            ++QAI D+DF    EV  +++   HAT     PP+ Y     +  ++ +E + +A+   
Sbjct: 242 KMEQAIADRDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAVRAVEAI-NAKAGR 300

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
           +   +T DAGPN  + +  +  + +   F  I
Sbjct: 301 VVAAYTFDAGPNAVVYYLEQDADVVLATFAGI 332


>gi|119188217|ref|XP_001244715.1| hypothetical protein CIMG_04156 [Coccidioides immitis RS]
          Length = 621

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/330 (35%), Positives = 170/330 (51%), Gaps = 31/330 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------DCI 76
           +SS   P NIA+ KYWGKRD+ LNLP N+SLS++L       H T   SD+      D +
Sbjct: 228 RSSTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQANLRAHTTASCSDSYPHAEGDTL 287

Query: 77  ILNGQKISSQSSFFKKTTQFC--DL-------------FRQFSKVYFLIETSNNIPTKAG 121
           +LN +    Q+    K T  C  DL               + S     I + NN PT AG
Sbjct: 288 VLNSKP---QNIHASKRTLACLADLRILRRALEDADPSLPRLSAFPLRIVSENNFPTAAG 344

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G D
Sbjct: 345 LASSAAGFAALVRAVADLYDLPQSPSELSRIARQGSGSACRSLMGGYVAWKSGAKEDGSD 404

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHI 238
           S A  V   + WP++R  +L + D +K + S E M+ TR  S  F  + T  +   +A +
Sbjct: 405 SLAEQVAPASHWPEMRALILVVSDAKKDVPSTEGMQATRATSTLFPFRVTSVVPERMAAM 464

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIP 295
           ++AI ++DF    E+  +++   HAT +   PP+ Y    +   +  V D   A  ++I 
Sbjct: 465 EKAIQNRDFASFAEITMRDSNNFHATCLDTWPPIFYMNDVSRAAVRVVHDVNRAAGETIC 524

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  K  + +   F +I
Sbjct: 525 AY-TFDAGPNAVIYYLEKDSDRVLGTFRKI 553


>gi|315225772|ref|ZP_07867560.1| diphosphomevalonate decarboxylase [Parascardovia denticolens DSM
           10105]
 gi|315119904|gb|EFT83036.1| diphosphomevalonate decarboxylase [Parascardovia denticolens DSM
           10105]
          Length = 358

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 116/323 (35%), Positives = 170/323 (52%), Gaps = 24/323 (7%)

Query: 34  LCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKT 93
           L KYWGKRD KL LP++ SLSL+L  L T T +          +L+GQ+   ++   K+ 
Sbjct: 19  LIKYWGKRDEKLILPISPSLSLTLDSLYTDTALMPSSDGRWHFVLDGQEQGGEA--LKRV 76

Query: 94  TQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI- 142
             F  +F             +     I + N++PT AGLASS+S FAAL  AL   + + 
Sbjct: 77  VDFARIFPVSATAPIPSTPAAATPLTIISHNHVPTAAGLASSSSAFAALAWALRDYFGLA 136

Query: 143 -PEKS------ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
            P +       ++LS  AR GSGSA RS + GF EW  G  ++G DSFA P ++   DL 
Sbjct: 137 GPGRDGRSLSDQALSACARQGSGSATRSIFGGFVEWTYGQREDGADSFARPIDDGEWDLG 196

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + +   +KKI SR  M+ T   S F+  W Q    DL  + + I ++D   +G+  E
Sbjct: 197 LIAVALSTGKKKISSRAGMKHTAETSAFYPLWRQASERDLQRVLEGIANRDVDLIGQAME 256

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----T 311
            NA+K HATM +A PPL Y    + + +E VW  RQ+ +  YFT+DAGPN+K+L      
Sbjct: 257 ANAMKFHATMFSADPPLTYLTARSWEVIEFVWAMRQEGVSAYFTMDAGPNVKILCRKSQM 316

Query: 312 HKIEETIKQFFPEITIIDPLDSP 334
            +I   +++ FP+  +      P
Sbjct: 317 EEISRRLRERFPQAALFQSTSGP 339


>gi|294786239|ref|ZP_06751493.1| diphosphomevalonate decarboxylase [Parascardovia denticolens F0305]
 gi|294485072|gb|EFG32706.1| diphosphomevalonate decarboxylase [Parascardovia denticolens F0305]
          Length = 340

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/323 (35%), Positives = 170/323 (52%), Gaps = 24/323 (7%)

Query: 34  LCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKT 93
           + KYWGKRD KL LP++ SLSL+L  L T T +          +L+GQ+   ++   K+ 
Sbjct: 1   MIKYWGKRDEKLILPISPSLSLTLDSLYTDTALMPSSDGRWHFVLDGQEQGGEA--LKRV 58

Query: 94  TQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI- 142
             F  +F             +     I + N++PT AGLASS+S FAAL  AL   + + 
Sbjct: 59  VDFARIFPVSATAPIPSTPAAATPLTIISHNHVPTAAGLASSSSAFAALAWALRDYFGLA 118

Query: 143 -PEKS------ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
            P +       ++LS  AR GSGSA RS + GF EW  G  ++G DSFA P ++   DL 
Sbjct: 119 GPGRDGRSLSDQALSACARQGSGSATRSIFGGFVEWTYGQREDGADSFARPIDDGEWDLG 178

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + +   +KKI SR  M+ T   S F+  W Q    DL  + + I ++D   +G+  E
Sbjct: 179 LIAVALSTGKKKISSRAGMKHTAETSAFYPLWRQASERDLQRVLEGIANRDVDLIGQAME 238

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----T 311
            NA+K HATM +A PPL Y    + + +E VW  RQ+ +  YFT+DAGPN+K+L      
Sbjct: 239 ANAMKFHATMFSADPPLTYLTARSWEVIEFVWAMRQEGVSAYFTMDAGPNVKILCRKSQM 298

Query: 312 HKIEETIKQFFPEITIIDPLDSP 334
            +I   +++ FP+  +      P
Sbjct: 299 EEISRRLRERFPQAALFQSTSGP 321


>gi|328859785|gb|EGG08893.1| hypothetical protein MELLADRAFT_74468 [Melampsora larici-populina
           98AG31]
          Length = 412

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 164/341 (48%), Gaps = 40/341 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDSD-ADCIILNGQKISS 85
           P NIA+ KYWGKRD++L LP N+SLS++L    L + T   +IDS+ AD + LNG ++  
Sbjct: 10  PVNIAVVKYWGKRDNELILPTNSSLSVTLDQDDLRSTTTARLIDSEGADQLWLNGAQV-- 67

Query: 86  QSSFFKKTTQFCDLFRQF-------------------SKVYFLIETSNNIPTKAGLASSA 126
           + +   +  +  D  RQ                    S+   +I + NN PT AGLASSA
Sbjct: 68  EITPGSRLARCLDELRQLRAQSEATSPKDVKDAQLPESRRALVIASENNFPTAAGLASSA 127

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           SGFAAL   + +++ +    E LSR+AR GSGSACRS   GF  W  GT  +G DS A  
Sbjct: 128 SGFAALAFTVAQLFELQMSPERLSRIARQGSGSACRSLLGGFVAWDMGTAADGGDSGARM 187

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
           V     WPDL   +  + D +K   S   M  T   S       +  +   +A +++AI 
Sbjct: 188 VAPQAHWPDLEAMICVVSDSKKGTSSTGGMAATVATSALLQHRIKDVVPARMAAMEEAIA 247

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK------ETIQGMERVWDARQQSIPIY 297
            +DF K   +   ++ + HA  +  +PP+ Y           ++ + R   A  Q     
Sbjct: 248 SRDFEKFSALTIADSNQFHAVCLDTTPPIFYLNDVSRAIIAVVEELNRSSRALGQGTLAT 307

Query: 298 FTLDAGPNLKLLFTHK----IEETIKQFFPEITIIDPLDSP 334
           +T DAGPN  +         I  TI  FFP   + DP + P
Sbjct: 308 YTFDAGPNAVIYAPRANMKTIVSTILNFFP---LADPFNDP 345


>gi|323342435|ref|ZP_08082667.1| diphosphomevalonate decarboxylase [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463547|gb|EFY08741.1| diphosphomevalonate decarboxylase [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 321

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 172/289 (59%), Gaps = 19/289 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIILNGQKISS 85
           +NIAL KYWGK+D++L +P N+SLSL+L    T T +   D D+    D  IL+G  +  
Sbjct: 14  TNIALIKYWGKKDNELKIPHNSSLSLTLDQFYTETSV---DYDSALTEDVFILDGVLVEG 70

Query: 86  QSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +     +   + +  R+   +  +  I ++N +P  AGLASSAS FAAL  A     ++ 
Sbjct: 71  KEK--DRVVWYMNALRECYDIPSFARIHSTNAVPKAAGLASSASAFAALAKAATLHLNLS 128

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWPDLRIGLLKII 202
           +  E +SR ARLGSGSA RS Y GF  W  GT    +DSFA P   N WP+ R+ +  + 
Sbjct: 129 D--EEVSRCARLGSGSASRSIYGGFVRWNRGT--GDLDSFAQPIAMNPWPEFRMIVCILN 184

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D+EK   S +AM  T   S ++  W +Q   D+  ++QA+ D D   +G +A+ NAL+MH
Sbjct: 185 DQEKPFLSSQAMNTTVESSVYYPAWVEQTEKDIVLLEQALKDHDIWTVGAIAQGNALRMH 244

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           A+++A +  + Y++ +T++ M +V    Q+SIP +FT+DAGPN+K++ T
Sbjct: 245 ASLMAVN--MWYFEPQTVEIMNKV-RTLQKSIPAFFTMDAGPNVKIMTT 290


>gi|309805049|ref|ZP_07699105.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           09V1-c]
 gi|308165640|gb|EFO67867.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           09V1-c]
          Length = 290

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 16/257 (6%)

Query: 69  IDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLA 123
           +D   D +I+NG+ ++ Q+S+     +  +  ++   +Y     F I+T N++PT AGLA
Sbjct: 14  VDLANDMVIMNGKAVNDQASY-----RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLA 68

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSASGFAAL  +    Y++    + LSR+AR+GSGSA RS + GF EW  G D     SF
Sbjct: 69  SSASGFAALATSFAASYNLNLNRQELSRIARIGSGSATRSIFGGFVEWQKGYDD--QTSF 126

Query: 184 AVPFNNQWPDLRIGLLKI-ID-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
           A P  N+ P + + +L I +D   K+I S   M+I +  SPF+  W  +   +++ ++ A
Sbjct: 127 AFPI-NEHPQMDLTMLAIELDVSPKEISSTCGMKIAQ-TSPFYQTWLNRNKQEISEMESA 184

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLD 301
           I + +F +LGE++E +A +MH+  + A P   Y+Q  TI  M  V + R+  I  Y+T+D
Sbjct: 185 IKNNNFTRLGELSELSANEMHSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTID 244

Query: 302 AGPNLKLLFTHKIEETI 318
           AGPN+K+L   K  E I
Sbjct: 245 AGPNVKILCQDKNVEDI 261


>gi|39963452|ref|XP_364905.1| hypothetical protein MGG_09750 [Magnaporthe oryzae 70-15]
 gi|145015469|gb|EDK00006.1| hypothetical protein MGG_09750 [Magnaporthe oryzae 70-15]
          Length = 385

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 183/363 (50%), Gaps = 43/363 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADCI 76
           +++   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  T       +  D +
Sbjct: 8   RATTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLAQSDLRTLTTATCSSDRPAAQGDSL 67

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIE-----------------TSNNIPTK 119
           ILNG+    +S      TQ C  FR+      ++E                 T NN PT 
Sbjct: 68  ILNGE----ESDVSGARTQAC--FRELRARRRVLEDADSSLPKLSTFALKIVTENNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+GFAAL  A+  +Y +P+    LS++AR GSGSACRS + G+  W  GT  +G
Sbjct: 122 AGLASSAAGFAALVRAIADLYQLPDSPAELSKIARQGSGSACRSLFGGYVAWREGTAADG 181

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V   + WP++R  +L     +K + S   M+ T   S  F Q   + +  ++ 
Sbjct: 182 SDSLAEQVAPASHWPEMRAIVLVASAMKKGVSSTSGMQQTVATSTLFKQRIAEVVPANMK 241

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQS 293
            +++AI ++DF    EV  +++   HAT     PP+ Y     +  I+ +E +  A  ++
Sbjct: 242 TMEEAIQNRDFASFAEVTMRDSNSFHATCADTYPPIFYMNDTSRAAIRAVEAINAAAGRT 301

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW--STKDSLSQKNSIEL 351
           I  Y T DAGPN  + F  +  + +   F +I     + S D W    KD  +Q   I+ 
Sbjct: 302 IAAY-TFDAGPNAVVYFLEQDAKVVVGSFAKI-----VGSVDGWKEGAKDFAAQGVEIDE 355

Query: 352 GIS 354
            ++
Sbjct: 356 AVA 358


>gi|170033728|ref|XP_001844728.1| diphosphomevalonate decarboxylase [Culex quinquefasciatus]
 gi|167874805|gb|EDS38188.1| diphosphomevalonate decarboxylase [Culex quinquefasciatus]
          Length = 372

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 164/331 (49%), Gaps = 26/331 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLS--LSLGHLGTITHITVIDS-DADCIILNGQ 81
           +   P NIA+ KYWGKRD  L LPLN+S+S  LS  HL T T IT  DS   + I+LNG+
Sbjct: 5   TCIAPVNIAVIKYWGKRDEDLILPLNDSVSATLSTDHLCTKTTITTSDSLTENKIVLNGK 64

Query: 82  K--------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           +        I       KK        +   K    + T NN PT AGLASSASG+A   
Sbjct: 65  EESFENPRLIRCLEEVRKKADAANKCRKDILKWNIKVTTENNFPTAAGLASSASGYACFV 124

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN--NQW 191
             L  +Y I  + + +S +AR GSGSACRS Y GF +W  G   +G DS AV     + W
Sbjct: 125 YTLACLYGI--EDQEISSIARQGSGSACRSLYSGFVQWRKGELPDGSDSIAVQLTPADFW 182

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKL 250
           P++RI +L + D  KK  S   M  +   S       ++ +    A + +A+  +DF   
Sbjct: 183 PEMRIIVLVVNDMRKKTSSTGGMSTSVKTSKLLKHRAERCVPEHTAQLVEALKGKDFETF 242

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPNLKL 308
           G++  +++ + HA  +   PP +Y    +  I  +   ++  ++ I + +T DAGPN  L
Sbjct: 243 GKITMQDSNQFHAVCLDTFPPCVYMNDTSHAIVTLVHRFNDLKKDIRVAYTFDAGPNACL 302

Query: 309 LFTHK----IEETIKQFFPEITIIDPLDSPD 335
               K    +  T+ + FP     D L SP+
Sbjct: 303 YLLEKDVPEVLATVNKVFPN----DALGSPE 329


>gi|241896116|ref|ZP_04783412.1| diphosphomevalonate decarboxylase [Weissella paramesenteroides ATCC
           33313]
 gi|241870630|gb|EER74381.1| diphosphomevalonate decarboxylase [Weissella paramesenteroides ATCC
           33313]
          Length = 326

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 170/289 (58%), Gaps = 19/289 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK D  L  P   S+SL+L    T T +    S  +D +IL+G+ IS  ++
Sbjct: 9   TNIALLKYWGKVDEALITPTTTSISLTLDEFYTDTTVWFDKSLQSDQLILDGETISGSAA 68

Query: 89  FFKKTTQFCDLFRQFS----KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
             +K ++F D+ R+ +    K Y +  ++N++PT AGLASSAS FAAL  A  +   +  
Sbjct: 69  --QKVSRFLDVVREMADINDKAYVV--SNNHVPTAAGLASSASAFAALAGAASKAAGLNL 124

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRIGLLKII 202
               LSR+AR GSGSA RS + GF +W+ G D+    SFA P   +  WP   I LL ++
Sbjct: 125 SVTELSRLARHGSGSATRSIFGGFAKWVPGDDRT---SFATPIFEKVDWP---IQLLTVV 178

Query: 203 --DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
             D+ KKIGSR  M+  ++ +PF+  W +  ++ +  +  AI   D +KLGE+AE NAL+
Sbjct: 179 INDQPKKIGSRLGMQHAKNTAPFYDMWVRLANSQVNDMILAIQQHDIVKLGELAEANALQ 238

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           MHA    + P   Y   ++ Q +    + R+Q IP+Y T+DAGPN+KL+
Sbjct: 239 MHAMNTTSVPSFNYLTDKSWQVIMIAQELREQGIPVYATMDAGPNVKLI 287


>gi|116205702|ref|XP_001228660.1| hypothetical protein CHGG_02144 [Chaetomium globosum CBS 148.51]
 gi|88182741|gb|EAQ90209.1| hypothetical protein CHGG_02144 [Chaetomium globosum CBS 148.51]
          Length = 394

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 168/325 (51%), Gaps = 36/325 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTIT----HITVIDSDADCI 76
           ++S   P NIA+ KYWGKRDSKLNLP N+SLS++L    L T+T      +   S  D +
Sbjct: 7   RASTTAPVNIAVVKYWGKRDSKLNLPTNSSLSVTLSQADLRTLTTASCSASYPASQGDSL 66

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFR-----------------QFSKVYFLIETSNNIPTK 119
           +LNG+     S      TQ C  FR                 Q S +   + + NN PT 
Sbjct: 67  LLNGEP----SDIAGARTQAC--FRELRTRREALEAADPSLPQLSTMPLRLVSENNFPTA 120

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+GFAAL  A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G
Sbjct: 121 AGLASSAAGFAALVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGDAADG 180

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V   + WPD+R  +L +   +K + S   M+ T   S  F +   + +  ++A
Sbjct: 181 SDSMADQVAEASHWPDMRALILVVSAAKKGVSSTSGMQQTVATSGLFQERIAKVVPQNMA 240

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQS 293
            +++AI ++DF    EV  +++   HAT     PP+ Y     +  I+ +E++  A  ++
Sbjct: 241 AMEKAIAERDFASFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEQINAAAGRT 300

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETI 318
           +  Y T DAGPN  + +  K  E +
Sbjct: 301 VAAY-TFDAGPNAVIYYLEKDTEAV 324


>gi|157104385|ref|XP_001648384.1| diphosphomevalonate decarboxylase [Aedes aegypti]
 gi|108880368|gb|EAT44593.1| diphosphomevalonate decarboxylase [Aedes aegypti]
          Length = 372

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 169/326 (51%), Gaps = 22/326 (6%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLS--LSLGHLGTITHITVIDS-DADCIILNGQ 81
           +   P NIA+ KYWGKRD  L LPLN+S+S  LS  HL T T IT  +S   + IILNG+
Sbjct: 5   TCIAPVNIAVIKYWGKRDEDLILPLNDSVSATLSTDHLCTKTTITTCESFTENKIILNGK 64

Query: 82  KISSQSSFF-------KKTTQFCDLFR-QFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           + S  +          KK  +  +  + +  K    ++T NN PT AGLASSASG+A L 
Sbjct: 65  EESFDNPRLLRCLEEIKKRAKASNKCKPEILKWNVHVKTENNFPTAAGLASSASGYACLV 124

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQW 191
             L  +Y I  ++E +S +AR GSGSACRS + GF +W  G   +G DS AV    ++ W
Sbjct: 125 YTLACLYGI--ENEEISSIARQGSGSACRSLHSGFVQWQKGEHPDGSDSVAVQLVPHDFW 182

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKL 250
           P++RI +L + D  KK  S   M  +   S       ++ +      + +A+  +DF   
Sbjct: 183 PEMRIIVLVVNDARKKTSSTGGMSTSVKTSKLLKYRVEECVPKHTKDLVEALNKKDFETF 242

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPNLKL 308
           G++  +++ + HA  +   PP +Y    +  +  M   ++A ++ + + +T DAGPN  L
Sbjct: 243 GKITMQDSNQFHAVCLDTYPPCVYMNDISFAVVNMVHQFNALKKEVKVAYTFDAGPNACL 302

Query: 309 LFTHK----IEETIKQFFPEITIIDP 330
               K    +   + + FP   + DP
Sbjct: 303 YLLEKDVPEVLAVVNKVFPNDKLGDP 328


>gi|15672387|ref|NP_266561.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723279|gb|AAK04503.1|AE006277_3 diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326405981|gb|ADZ63052.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           CV56]
          Length = 318

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 176/305 (57%), Gaps = 18/305 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN +   S    
Sbjct: 11  TNIALIKYWGKADIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSEVADS---- 66

Query: 90  FKKTTQFCDLFR----QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             + +QF ++ R     F KV  +I++ N++PT AGLASSAS FAALT A+F +  + + 
Sbjct: 67  -SRVSQFLEMMRGQYGNFPKV--MIQSENHVPTAAGLASSASSFAALTAAMFGLLDLEKD 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
              +SR+AR GSGSA RS +  F  W  G D     SFA  F N+   L + + +I   +
Sbjct: 124 DSEMSRIARRGSGSASRSIFGNFSVWNKGEDHQS--SFAESFYNEDIGLSMIVAEISAEK 181

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KK+ S + M++ +  +P ++ W ++ +  L  +KQAI++ D  K+G VA+ NAL MH   
Sbjct: 182 KKMSSTKGMQLAQ-TAPTYSAWVEKSAIQLEEMKQAILNADIEKVGLVAQDNALGMHEQN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET----IKQF 321
             ++ P  Y+  ET   ++ V  A Q  +  + T+DAGPN+K++  H  E+     ++  
Sbjct: 241 RLSNQPFDYFTHETRHVIDFVNQAYQSGLLAFVTIDAGPNVKIITDHATEKVLLAKLQAE 300

Query: 322 FPEIT 326
           FPE+T
Sbjct: 301 FPELT 305


>gi|310800466|gb|EFQ35359.1| diphosphomevalonate decarboxylase [Glomerella graminicola M1.001]
          Length = 391

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/324 (34%), Positives = 171/324 (52%), Gaps = 22/324 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  +   S  + D +IL
Sbjct: 8   RASTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLSQADLRTLTTASCSASYSEGDSLIL 67

Query: 79  NGQK-----ISSQSSFFKKTTQFCDL------FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NG+        +Q+ F +  T+   L        + S +   I T NN PT AGLASSA+
Sbjct: 68  NGEASDISGARTQACFRELRTRRAALEEKDSSLPKLSAMPLKIVTENNFPTAAGLASSAA 127

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G   NG DS A  V
Sbjct: 128 GFAALVRAIADLYELPDSPSELSLIARQGSGSACRSLFGGYVAWRMGDKANGTDSKADLV 187

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
              + WP++R  +L +   +K + S   M+ T   S  F Q   + +   +A ++ AI  
Sbjct: 188 AEASHWPNMRALILVVSAAKKGVSSTSGMQQTVATSGLFKQRVAEVVPKHMAEMEDAIAR 247

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF +  EV  K++   H++     PP+ Y     +  I+ +E++  A  +++  Y T D
Sbjct: 248 RDFAQFAEVTMKDSNSFHSSCSDTYPPIFYMNDVSRAAIRAVEQINAAAGKTVAAY-TFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEI 325
           AGPN  + +  +   T+   F  +
Sbjct: 307 AGPNAVIYYLEEDAATVVGAFSPV 330


>gi|330799300|ref|XP_003287684.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
 gi|325082304|gb|EGC35790.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
          Length = 388

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 157/289 (54%), Gaps = 16/289 (5%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILNGQKISS 85
           P NIA+ KYWGKRD KL LPLN+SLS +L      T  T++ S+    D I LNG+K   
Sbjct: 11  PVNIAVIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDAIWLNGKKEDI 70

Query: 86  QSSFFK---KTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            ++ ++   K  +      Q  K    I + NN PT AGLASSASG+  L   L +IY +
Sbjct: 71  NATRYQNVLKAIRSRATKLQDKKHCVHIVSINNFPTAAGLASSASGYCCLVYTLAQIYGV 130

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLK 200
                 +S +AR+GSGSACRS Y GF +W  G  ++G DS AV     + WP++ I +L 
Sbjct: 131 ---DGDISGIARIGSGSACRSMYGGFVKWEMGEKEDGSDSIAVQVQPESHWPEMNIIVLV 187

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQ-WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           + D++K+  S + M+ +   SP   +     + T +  I++AI ++DF   G++  K++ 
Sbjct: 188 VNDKKKETSSTDGMQKSAATSPMMKERCAVTVPTRMRDIEEAIKNKDFQTFGDITMKDSD 247

Query: 260 KMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPN 305
             H  + A + P +Y+  +T   I  +   ++    S+   +T DAGPN
Sbjct: 248 DFHE-VCATTTPAIYYLNDTSRYIMNLIHRYNKLSGSVKCAYTFDAGPN 295


>gi|227431888|ref|ZP_03913911.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|227352355|gb|EEJ42558.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 313

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 169/295 (57%), Gaps = 25/295 (8%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISS 85
           A + +NIAL KYWGK++++LNLP  +SLSL+L    T T  +V  ++ DC ILN Q + +
Sbjct: 3   ATVHTNIALIKYWGKKNTELNLPTTSSLSLTLDKFYTTT--SVEPANHDCFILNDQVVDA 60

Query: 86  QSSFFKKTTQFCDLFRQ----FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
                 +  +F D+ RQ    F+ +  + E  N++PT AGLASSAS FAALT A+     
Sbjct: 61  -----TRVHRFLDILRQQLGDFTPLQVISE--NHVPTSAGLASSASAFAALTGAVTHELG 113

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL-- 199
           +    E LSR+AR GSGSA RSF+  F  W  G D     SFA   N   P+L I L+  
Sbjct: 114 MDLPKEELSRLARRGSGSASRSFFGNFAMWHKGIDD--ASSFAESLN--APELPIALVVA 169

Query: 200 KIIDREKKIGSREAME--ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           ++ D  KKI S E M+  IT   SP + +W  + +     ++ AI+DQD  K+G +AE N
Sbjct: 170 EVCDAPKKITSTEGMKRAIT---SPNYDRWLSKSANQFIDMQHAILDQDIDKIGALAEDN 226

Query: 258 ALKMHA-TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           AL MHA  + A   P  Y+  +T   +  + D R Q I  Y T+DAGPN+K++ T
Sbjct: 227 ALGMHALNLTATRSPFTYFTDKTQLILSLIQDMRHQGILAYATIDAGPNVKIITT 281


>gi|281490947|ref|YP_003352927.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           KF147]
 gi|281374705|gb|ADA64225.1| Diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           KF147]
          Length = 318

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/305 (36%), Positives = 177/305 (58%), Gaps = 18/305 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN +  +S    
Sbjct: 11  TNIALIKYWGKADIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSEVANS---- 66

Query: 90  FKKTTQFCDLFR----QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             + +QF ++ R     F KV  +I++ N++PT AGLASSAS FAALT A+F +  + + 
Sbjct: 67  -SRVSQFLEMMRGQYGNFPKV--MIQSENHVPTAAGLASSASSFAALTAAMFGLLDLEKD 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
              +SR+AR GSGSA RS +  F  W  G D     SFA  F N+   L + + +I   +
Sbjct: 124 DSEMSRIARRGSGSASRSIFGNFSVWNKGEDHQS--SFAESFYNEDIGLSMIVAEISAEK 181

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KK+ S + M++ +  +P ++ W ++ +  L  +KQAI++ D  K+G +A+ NAL MH   
Sbjct: 182 KKMSSTKGMQLAQ-TAPTYSAWVEKSAIQLEEMKQAILNADIEKVGLIAQDNALGMHEQN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----TIKQF 321
             ++ P  Y+  ET   ++ V  A Q  +  + T+DAGPN+K++  H  E+     ++  
Sbjct: 241 RLSNQPFDYFTHETRHVIDFVNQAYQSGLLAFVTIDAGPNVKIITDHATEKILLAKLQAE 300

Query: 322 FPEIT 326
           FPE+T
Sbjct: 301 FPELT 305


>gi|227892524|ref|ZP_04010329.1| possible diphosphomevalonate decarboxylase [Lactobacillus
           ultunensis DSM 16047]
 gi|227865645|gb|EEJ73066.1| possible diphosphomevalonate decarboxylase [Lactobacillus
           ultunensis DSM 16047]
          Length = 320

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 178/313 (56%), Gaps = 11/313 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+D KL LPL +SLS++L    T T I   + + +   LN +K    +S 
Sbjct: 9   TNIALIKYWGKKDPKLRLPLMSSLSMTLDAFYTDTSIEKTNGE-NQFYLNNKKQDETNS- 66

Query: 90  FKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            K+   + DL ++    +   +I+++N++PT AGLASS+S FAAL  A  + Y+I     
Sbjct: 67  -KRVFSYLDLLKRKFDCHDNLIIKSTNHVPTSAGLASSSSAFAALAAAFCKYYNISVDKT 125

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR+GSGSACRS + GF  W  G       ++A+    +  DL +  +++  ++KK
Sbjct: 126 ELSRLARMGSGSACRSIFGGFAIWQKGESDESSYAYALVEEPKM-DLHLLAIELNTKQKK 184

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S   M+     SPFF  W ++   ++  +  AI   DF  LG++AE NA +MHA  + 
Sbjct: 185 ISSTRGMK-DAQSSPFFEPWIKRNDLEMKQMIAAIKKNDFTALGKLAELNANEMHAINLT 243

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFP 323
           A P   Y++  T++ ++ +   R + I  Y+T+DAGPN+K+L     + +I+E  ++ F 
Sbjct: 244 AQPEFTYFEPNTLRAIKLIEQLRNEGIECYYTIDAGPNIKVLCQLRNSKEIKERFERIFN 303

Query: 324 EITIIDPLDSPDL 336
            + I+D    P +
Sbjct: 304 SVNIVDASFGPGI 316


>gi|121706710|ref|XP_001271604.1| diphosphomevalonate decarboxylase [Aspergillus clavatus NRRL 1]
 gi|119399752|gb|EAW10178.1| diphosphomevalonate decarboxylase [Aspergillus clavatus NRRL 1]
          Length = 403

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/319 (35%), Positives = 168/319 (52%), Gaps = 25/319 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTIT--HITVIDSDADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T    + I   AD +IL
Sbjct: 10  RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSAIYPTADELIL 69

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 70  NGKPQDIQSS--KRTLACLSSLRSLRQALESTDSSLPKLSTLPLRIVSENNFPTAAGLAS 127

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS A
Sbjct: 128 SAAGFAALVRAVANLYQLPQSPRELSRIARQGSGSACRSLMGGYVAWRAGELEDGSDSLA 187

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F T+ T  +   +A I+ A
Sbjct: 188 EEVAPASHWPEMRAIVLVVSAEKKDVPSTEGMQTTVATSSLFATRATSVVPERMAAIETA 247

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFT 299
           I+++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +        +T
Sbjct: 248 ILNKDFPAFAELTMRDSNGFHATCLDSWPPIFYMNDVSRAAVRIVHDINRAIGRTVCAYT 307

Query: 300 LDAGPNLKLLFTHKIEETI 318
            DAGPN  + +  K  E +
Sbjct: 308 FDAGPNAVIYYLEKDSELV 326


>gi|15899699|ref|NP_344304.1| diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus P2]
 gi|284175801|ref|ZP_06389770.1| diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus 98/2]
 gi|13816375|gb|AAK43094.1| Diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus P2]
 gi|261601434|gb|ACX91037.1| diphosphomevalonate decarboxylase [Sulfolobus solfataricus 98/2]
          Length = 325

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 169/306 (55%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  +D + +I+N  +I S+
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--NDKNIVIVN-DRILSE 66

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  D F++    + +  +E+ +  P  AGLASSA+G AAL  +L  +  +  
Sbjct: 67  DEMKEYAGRVLDTFKKIVGKEFHVKVESKSKFPINAGLASSAAGIAALAFSLNELLELNL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           KSE LS++ARLGSGSACRS + GF  W  G  ++G DS+      ++ W +L + ++ I+
Sbjct: 127 KSEELSKIARLGSGSACRSMFGGFVVWNKGEREDGEDSYCYQIFRHDYWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + I      + +AI ++D  K   +  +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKYIEKTFNEVIEAIRNRDEKKFYYLMMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME + D  +      +T DAGPN  +  T +    I +F
Sbjct: 246 HAVILDSWPSFFYLNDTSIRIMEWIHDYGKAG----YTFDAGPNPHIFTTERNIGDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|58337453|ref|YP_194038.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           NCFM]
 gi|227904089|ref|ZP_04021894.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           ATCC 4796]
 gi|58254770|gb|AAV43007.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           NCFM]
 gi|227868108|gb|EEJ75529.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           ATCC 4796]
          Length = 320

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 178/307 (57%), Gaps = 11/307 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK D  L LPL +SLS++L    T T I   D+  +   LNG++
Sbjct: 2   KNTARAHTNIALIKYWGKSDPILRLPLMSSLSMTLDAFYTDTLIEKTDAKNE-FYLNGKR 60

Query: 83  ISSQSSFFKKTTQFCDLFRQ-FSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            + Q+   K+   + D  ++ F      +++++N++PT AGLASS+S FAAL  +  ++Y
Sbjct: 61  QNRQAK--KRVFSYLDTLKEKFGYTDNLIVKSTNHVPTSAGLASSSSAFAALAASFCKLY 118

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGL 198
           ++      LSR+ARLGSGSA RS + GF  W  G       ++A+   ++ P  DL++  
Sbjct: 119 NLDVDKTELSRLARLGSGSASRSIFGGFAIWQKGNSNQSSYAYAL---DEKPKMDLQLLA 175

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           +++   +KKI S + M+     SPFF+ WT +   +L  + +AI   DF  LG +AE NA
Sbjct: 176 VELNTEQKKISSTKGMK-DAQSSPFFSTWTNRNQLELDEMIKAIKQNDFTALGSLAELNA 234

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            +MHA  + A P   Y+  ETI+ ++ V D R + I  Y+T+DAGPN+K+L   K  + I
Sbjct: 235 NEMHAINLTAQPEFTYFMPETIRAIKLVEDLRTKGIECYYTIDAGPNIKVLCQLKNRKEI 294

Query: 319 KQFFPEI 325
            + F  +
Sbjct: 295 IEHFESV 301


>gi|322700394|gb|EFY92149.1| diphosphomevalonate decarboxylase [Metarhizium acridum CQMa 102]
          Length = 391

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 180/356 (50%), Gaps = 40/356 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  D D ++L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASYSDGDSLML 67

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSN-----------------NIPTKAG 121
           NG+     S      TQ C  FR+       +E SN                 N PT AG
Sbjct: 68  NGEP----SDISGARTQAC--FRELRARRAALEASNPSLPKLSTLPLKIVSENNFPTAAG 121

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G  ++G D
Sbjct: 122 LASSAAGFAALVQAIANLYELPDSPSELSLIARQGSGSACRSLFGGYVAWRMGDKEDGSD 181

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHI 238
           S A  V   + WP++R  +L +   +K + S   M+ T   S  F Q   Q +  ++  +
Sbjct: 182 SMADLVAPASHWPNMRALILVVSAAKKGVSSTSGMQQTVATSGLFQQRIAQVVPANMDLM 241

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIP 295
           +QAI  +DF K  EV  +++   HA      PP+ Y     +  I+ +E +     ++I 
Sbjct: 242 EQAIKAKDFAKFAEVTMRDSNSFHACCADTYPPIFYMNDVSRAAIRAVESINAKAGRTIA 301

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
            Y T DAGPN  + +  +   T+   F  +     L+    W  +DS+S ++  +L
Sbjct: 302 AY-TFDAGPNCVVYYLEEDAPTVLGAFAGV-----LNGVSGWK-EDSVSAQSGAKL 350


>gi|164660688|ref|XP_001731467.1| hypothetical protein MGL_1650 [Malassezia globosa CBS 7966]
 gi|159105367|gb|EDP44253.1| hypothetical protein MGL_1650 [Malassezia globosa CBS 7966]
          Length = 430

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 171/347 (49%), Gaps = 39/347 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITV--------IDSD 72
           +++   P NIA+ KYWGKRD+KL LP N+SLS++L   HL T+T              + 
Sbjct: 5   QATCTAPVNIAVIKYWGKRDTKLVLPTNDSLSVTLDQDHLRTVTTARADASFGTDEAGTR 64

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFR-------------QFSKVYFLIETSNNIPTK 119
            D + LNG + S +    +     C++ +               SK    + + NN PT 
Sbjct: 65  QDKLWLNGAEESIKPGG-RLDACLCEMRKLRAELEAKDRSLPPLSKWGLRLCSENNFPTA 123

Query: 120 AGLASSASGFAALTLALFRIYSIPE--KSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           AGLASSASGFAAL +++  +Y +     S  LS +AR GSGSACRS   GF  W  GT  
Sbjct: 124 AGLASSASGFAALAVSVAELYGLRAVMTSSQLSIIARRGSGSACRSVLGGFVAWQMGTAD 183

Query: 178 NGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD- 234
           +G DSFA+P      WPDL + +  + D +K   S   M+ T   SP      + +  + 
Sbjct: 184 DGSDSFAIPIAEREHWPDLHVLICVVNDAKKGTSSTVGMQNTVETSPLLQHRIKHVVPER 243

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQ 291
           +  + +AI  +DF    ++   ++   HA  +  +PP+ Y     +  +  +E +  AR 
Sbjct: 244 MQQMNEAIQKRDFAAFTQLTTADSNNFHACCLDTTPPIFYMNDTSRAIVHVVEELNRARA 303

Query: 292 QS--IPI-YFTLDAGPNLKLLFTHK----IEETIKQFFPEITIIDPL 331
           ++   PI  +T DAGPN  L    K    + + ++ +FP  T+ D L
Sbjct: 304 EAGEDPIAAYTFDAGPNAVLYVREKDMSCVRQVVQHYFPGATMDDRL 350


>gi|70607014|ref|YP_255884.1| diphosphomevalonate decarboxylase [Sulfolobus acidocaldarius DSM
           639]
 gi|68567662|gb|AAY80591.1| diphosphomevalonate decarboxylase [Sulfolobus acidocaldarius DSM
           639]
          Length = 325

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 162/313 (51%), Gaps = 12/313 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQ 81
           +  A  PSNIA+ KYWGKRD KLNLPLN+SLS+SL  L   T +TV  D   D I +N Q
Sbjct: 4   EGEAIAPSNIAIVKYWGKRDDKLNLPLNSSLSISLEKLEVRTKVTVSADLQKDEIYINQQ 63

Query: 82  KISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K+  +  F +   +  ++FR+    K    +E+  N P   GLASSA+G AAL  AL   
Sbjct: 64  KLREEE-FEEYGGRVINIFRELYGKKFSVKVESYMNFPKSVGLASSAAGIAALVYALNDA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIG 197
             +      LS++AR+GSGSACRS   GF  W  G+ ++G DS+       + W DL I 
Sbjct: 123 LGLGLSQRELSKIARIGSGSACRSTIGGFVIWEKGSQEDGEDSYCYQIFPEDHWEDL-ID 181

Query: 198 LLKIID-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           ++ +I  +EKK+ SR+ M+ T   S       + I   L  +  +I  +D  +      +
Sbjct: 182 IIPLIQLKEKKVSSRKGMKNTALSSSLMECRLKFIEDTLPLVIDSIKKKDEKEFYYWTMR 241

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           ++  MHA ++ + P   Y    + + ME +    Q+     +T DAGPN  +  T K  +
Sbjct: 242 HSNSMHAVILDSWPSFFYLNDTSFKIMEWI----QEFGNAAYTFDAGPNPHIFTTKKHLD 297

Query: 317 TIKQFFPEITIID 329
            I Q+   I I D
Sbjct: 298 EITQYLNSIGIKD 310


>gi|6625790|gb|AAF19399.1|AF203779_1 diphosphomevalonate decarboxylase MVD1 [Candida albicans]
          Length = 362

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 112/315 (35%), Positives = 165/315 (52%), Gaps = 24/315 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +  +S + D + LNG
Sbjct: 4   ASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASESFEKDQLWLNG 63

Query: 81  QKISSQSSFFKKTTQFC--DLFR------------QFSKVYFLIETSNNIPTKAGLASSA 126
           +      S     TQ C  DL +            + S++   I + NN PT AGLASSA
Sbjct: 64  K----LESLDTPRTQACLADLRKLRASIEQSPDTPKLSQMKLHIVSENNFPTAAGLASSA 119

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV 
Sbjct: 120 AGFAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTLPDGQDSKAVE 179

Query: 187 FN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
                 WP LR  +L + D +K   S   M+ T   S  F     ++       +K+AI+
Sbjct: 180 IAPLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDLFAHRIAEVVPQRFEAMKKAIL 239

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAG 303
           D+DF K  E+  K++   HA  + + PP+ Y    + + ++ V    QQ +   +T DAG
Sbjct: 240 DKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKMVETINQQEVVAAYTFDAG 299

Query: 304 PNLKLLFTHKIEETI 318
           PN  + +    ++ +
Sbjct: 300 PNAVIYYDEANQDKV 314


>gi|238879484|gb|EEQ43122.1| diphosphomevalonate decarboxylase [Candida albicans WO-1]
          Length = 362

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 112/315 (35%), Positives = 165/315 (52%), Gaps = 24/315 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +  +S + D + LNG
Sbjct: 4   ASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASESFEKDQLWLNG 63

Query: 81  QKISSQSSFFKKTTQFC--DLFR------------QFSKVYFLIETSNNIPTKAGLASSA 126
           +      S     TQ C  DL +            + S++   I + NN PT AGLASSA
Sbjct: 64  K----LESLDTPRTQACLADLRKLRASIEQSPDTPKLSQMKLHIVSENNFPTAAGLASSA 119

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV 
Sbjct: 120 AGFAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTLPDGQDSKAVE 179

Query: 187 FN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
                 WP LR  +L + D +K   S   M+ T   S  F     ++       +K+AI+
Sbjct: 180 IAPLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDLFAHRIAEVVPQRFEAMKKAIL 239

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAG 303
           D+DF K  E+  K++   HA  + + PP+ Y    + + ++ V    QQ +   +T DAG
Sbjct: 240 DKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKMVETINQQEVVAAYTFDAG 299

Query: 304 PNLKLLFTHKIEETI 318
           PN  + +    ++ +
Sbjct: 300 PNAVIYYDEANQDKV 314


>gi|294654829|ref|XP_456912.2| DEHA2A13398p [Debaryomyces hansenii CBS767]
 gi|218512031|sp|Q6BY07|ERG19_DEBHA RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
 gi|199429182|emb|CAG84889.2| DEHA2A13398p [Debaryomyces hansenii]
          Length = 388

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 181/343 (52%), Gaps = 27/343 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNG 80
           SSA  P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +    D   D + LNG
Sbjct: 6   SSATAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQNDLRTLTSVAASEDFKEDKLWLNG 65

Query: 81  QKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGF 129
           +  S +S   K         R+            S+    I + NN PT AGLASSA+GF
Sbjct: 66  KLESLESERTKACLADLRTLRKELESNDSSIPKLSQFGVHIVSENNFPTAAGLASSAAGF 125

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           AAL +++ ++Y +P+    +S++AR GSGSACRS + G+  W  G + NG DS AV    
Sbjct: 126 AALVVSIAKLYELPQNMSEISKIARKGSGSACRSLFGGYVAWEMGQETNGEDSKAVEVAP 185

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW--TQQISTDLAHIKQAIIDQ 245
            + WP+++  +L + D +K   S   M+ T   S  F QW   + +      +K +I+ +
Sbjct: 186 LSHWPNMKAAILVVSDDKKDTPSTSGMQTTVATSDLF-QWRIKEVVPKRFDDMKDSILRK 244

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDA 302
           DF   G++  K++   HA  + ++PP+ Y     K+ I+ +  + + R+  I   +T DA
Sbjct: 245 DFATFGDLTMKDSNSFHAVCLDSTPPIFYLNDTSKKIIKLIHEL-NKREGKIIAAYTFDA 303

Query: 303 GPNLKLLFTH----KIEETIKQFFPEITIIDPLDSPDLWSTKD 341
           GPN  + +      K+   I ++F +++  + LD+  L +T D
Sbjct: 304 GPNAVIYYEQENESKVLGVIYKYFSKVSGWEKLDTKTLDTTSD 346


>gi|302417826|ref|XP_003006744.1| diphosphomevalonate decarboxylase [Verticillium albo-atrum
           VaMs.102]
 gi|261354346|gb|EEY16774.1| diphosphomevalonate decarboxylase [Verticillium albo-atrum
           VaMs.102]
          Length = 412

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 166/326 (50%), Gaps = 34/326 (10%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIILNGQK 82
           F P      +YWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D +ILNG+ 
Sbjct: 33  FSPRTCYQIRYWGKRDAKLNLPTNSSLSVTLAQSDLRTLTTASTSASYPEGDSLILNGEP 92

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETS-----------------NNIPTKAGLASS 125
               S      TQ C  FR+       +E S                 NN PT AGLASS
Sbjct: 93  ----SDITGARTQAC--FRELRARRAALEASDSSLPKLAALPLRVVSENNFPTAAGLASS 146

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+GFAAL  A+  +Y +P+  + LS VAR GSGSACRS + G+  W  G+  +G DS A 
Sbjct: 147 AAGFAALVRAIADLYQLPDTPDQLSLVARQGSGSACRSLFGGYVAWRMGSAADGSDSKAD 206

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
            V   + WPD+R  +L +   +K + S   M+ T   S  F Q  Q  +  ++  ++QAI
Sbjct: 207 LVAEASHWPDMRALILVVSAAKKGVSSSSGMQQTVATSGLFQQRIQTVVPANMDLMEQAI 266

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFT 299
            D+DF K  EV  +++   H+T     PP+ Y     +  I+ +E +  A  +++  Y T
Sbjct: 267 RDRDFAKFAEVTMRDSNSFHSTCADTYPPIFYMNDVSRAAIRAVEAINAAAGRTVAAY-T 325

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEI 325
            DAGPN  + +    E T+   F  +
Sbjct: 326 FDAGPNAVIYYQEADEATVVGAFTAV 351


>gi|295424860|ref|ZP_06817575.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065426|gb|EFG56319.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
          Length = 320

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 175/304 (57%), Gaps = 11/304 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K +A   +NIAL KYWGK++++L LPL +SLS++L    + T +       +   LN QK
Sbjct: 2   KKTARAHTNIALIKYWGKKNAELRLPLMSSLSMTLDAFYSETSLET--GQQNEFYLNNQK 59

Query: 83  ISSQSSFFKKTTQFC-DLFRQFSKVYFLIETS--NNIPTKAGLASSASGFAALTLALFRI 139
            S QS+  ++  Q+   L   F   Y  ++ S  N++PT AGLASS+S FAAL  +    
Sbjct: 60  QSDQSA--QRVFQYLHKLQDSFGLPYDALKVSSINHVPTAAGLASSSSAFAALAASFCAY 117

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP-DLRIGL 198
           Y +    + LSR+AR+GSGSA RS Y GF  W  G D     S+A P + +   DL +  
Sbjct: 118 YDLDVDRKMLSRLARIGSGSASRSIYGGFAIWQKGHDDKS--SYAYPLDEKPAMDLHLLA 175

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           +++  + KK+ S + M+  ++ SPFF  W  +   +L  +  AI + DF KLG +AE NA
Sbjct: 176 VELDQKPKKLSSTKGMQAAQN-SPFFQPWLARNDAELNDMIAAIKNNDFTKLGSLAELNA 234

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            +MHA  + A P   Y++  TI+ ++ V + RQQ I  Y+T+DAGPN+K+L   K  + I
Sbjct: 235 NEMHAINLTAQPEFTYFEPNTIKAIKLVEELRQQGIECYYTIDAGPNVKILTPLKNIKEI 294

Query: 319 KQFF 322
           K+ F
Sbjct: 295 KKLF 298


>gi|255513677|gb|EET89942.1| diphosphomevalonate decarboxylase [Candidatus Micrarchaeum
           acidiphilum ARMAN-2]
          Length = 353

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 164/317 (51%), Gaps = 17/317 (5%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG-HLGTITHITVIDS-DADCIILNGQK 82
           +A   SNIA  KYWGKRD K+NLP N+S+S++L  ++GT T +       +D + +NG++
Sbjct: 7   TAIGSSNIAFIKYWGKRDGKINLPNNSSISMTLDRNVGTKTSVLFSSKLKSDRLFINGKE 66

Query: 83  ------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
                  + +S F  +   +C      +    LI + NN P+ +GLASSASG A L   L
Sbjct: 67  ENIKEGANEKSRFISEMLAYCKKAAGIN-TNALIVSENNFPSDSGLASSASGGATLAFLL 125

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDL 194
                +   S  +S +AR  SGSACRS Y G  +W  G+ Q+G DSFA  V  +  WPDL
Sbjct: 126 SNALDLKMDSREISIMARKISGSACRSVYGGIVKWDAGSKQDGSDSFAEQVVDHRYWPDL 185

Query: 195 RIGLLKIID-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
            + ++ I+D  +KK+ S     IT   S  +    Q     +  +  A+ ++DF  L E 
Sbjct: 186 -MDIIAIVDPSKKKVSSSAGHAITVKTSSLYRVRPQVAEEGVKKVVNAVTNKDFQVLAET 244

Query: 254 AEKNALKMHATMIAASPPLLYW---QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
             +++  MHATM+ + PP++Y     +  I  M  + ++  + +  Y T DAGPN  ++ 
Sbjct: 245 VMRDSNNMHATMMDSWPPIMYLSDASRSIIYAMHELNESEGKYVAAY-TFDAGPNAHIIT 303

Query: 311 THKIEETIKQFFPEITI 327
           T      + +   EI +
Sbjct: 304 TSSNRSKVIKMLEEIGV 320


>gi|119501112|ref|XP_001267313.1| diphosphomevalonate decarboxylase [Neosartorya fischeri NRRL 181]
 gi|119415478|gb|EAW25416.1| diphosphomevalonate decarboxylase [Neosartorya fischeri NRRL 181]
          Length = 404

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 115/320 (35%), Positives = 169/320 (52%), Gaps = 27/320 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTIT--HITVIDSDADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T    + I   AD +IL
Sbjct: 11  RATTTAPVNIAVIKYWGKRDASLNLPTNSSLSVTLSQRSLRTLTTASCSAIYPAADELIL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 71  NGKPQDIQSS--KRTLACLSNLRSLRQALENADPSLPKLSALPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS A
Sbjct: 129 SAAGFAALVRAIADLYQLPQSPLELSRIARQGSGSACRSLMGGYVAWRAGEREDGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F T+    +   +A I+ A
Sbjct: 189 EEVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSSLFATRAASVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 249 IQNKDFATFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAVGRTVCAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETI 318
           T DAGPN  + +  K  E +
Sbjct: 308 TFDAGPNAVIYYLEKDSEVV 327


>gi|270290281|ref|ZP_06196506.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici 7_4]
 gi|304384905|ref|ZP_07367251.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici DSM
           20284]
 gi|270281062|gb|EFA26895.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici 7_4]
 gi|304329099|gb|EFL96319.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici DSM
           20284]
          Length = 331

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 109/313 (34%), Positives = 168/313 (53%), Gaps = 23/313 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIAL KYWGK DS+L +P N+S+SL+L    T T +    D   +   LNG  +  +  
Sbjct: 15  TNIALIKYWGKVDSELIIPANDSVSLTLDEFYTDTVVNFSEDYKVNEFWLNGNLMPYKH- 73

Query: 89  FFKKTTQFCDLFRQ------FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +  +  D  ++      F+K    I + N++PT AGLASSASG AAL  A       
Sbjct: 74  -MARINRVIDAVKEEYDYPGFAK----IRSFNHVPTSAGLASSASGMAALAGAAADALGD 128

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                ++SR+ARLGSGSA RS + G   W  G+D     SF     N+  D+ + ++ ++
Sbjct: 129 EHDLTNISRIARLGSGSASRSVFGGIVHWHRGSDHES--SFVEQVVNE-KDIDLNMVTVV 185

Query: 203 --DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
               +K I S   M+ T   SPF+  W  + +  +  +  A+   DF K+GE+AE +A+ 
Sbjct: 186 VNSHQKSIKSTNGMQRTVETSPFYPTWVSESNRMVPEMLAAVKKNDFTKIGELAEHSAMM 245

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHK----IE 315
           MHAT +AA P   Y+Q +T++ +  V   R++  I  Y+T+DAGPN+K+L  +K    I 
Sbjct: 246 MHATTLAAIPAFTYFQPDTLKVIRLVTQLRKEHGIECYYTIDAGPNVKVLCQNKDILAIR 305

Query: 316 ETIKQFFPEITII 328
             +K +F E  ++
Sbjct: 306 NFLKNYFEERQLV 318


>gi|315056619|ref|XP_003177684.1| diphosphomevalonate decarboxylase [Arthroderma gypseum CBS 118893]
 gi|311339530|gb|EFQ98732.1| diphosphomevalonate decarboxylase [Arthroderma gypseum CBS 118893]
          Length = 402

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 113/337 (33%), Positives = 172/337 (51%), Gaps = 25/337 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS- 71
           +   N +I  ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T   S 
Sbjct: 1   MAAANDQIVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSA 60

Query: 72  -----DADCIILNGQKISSQSS-----------FFKKTTQFCD-LFRQFSKVYFLIETSN 114
                D D + LN +  S Q S             +K  +  D    + S     I + N
Sbjct: 61  KYPAADGDTLTLNNKPHSVQGSPRTLACLADLRSLRKQVESSDPSLPKLSAYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVANLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS 232
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F +  Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPRRAQSIV 240

Query: 233 TD-LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD--- 288
            + +  I+++I ++DF    E+  +++   HAT +   PP  Y    +   +  V D   
Sbjct: 241 PERMTAIERSIQERDFEAFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINR 300

Query: 289 ARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
           A  +S+  Y T DAGPN  + +  K  + +   F  I
Sbjct: 301 AAGRSVCAY-TFDAGPNAVIYYLEKDTDCVLGTFKSI 336


>gi|169603648|ref|XP_001795245.1| hypothetical protein SNOG_04832 [Phaeosphaeria nodorum SN15]
 gi|111066103|gb|EAT87223.1| hypothetical protein SNOG_04832 [Phaeosphaeria nodorum SN15]
          Length = 398

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 174/336 (51%), Gaps = 27/336 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIIL 78
           ++S   P NIA+ KYWGKRD KLNLP N+SLS++L      TH T   S      D + L
Sbjct: 6   RASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLSQADLRTHTTASCSSTYPSQDALFL 65

Query: 79  NGQK-----ISSQSSF-----FKKTTQFCDL-FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NGQ        +Q+ F      +K  +  D    + + +   I + NN PT AGLASSA+
Sbjct: 66  NGQSQDVSGARTQACFRELRALRKQLEEKDSSLPKLADLPLRIVSENNFPTAAGLASSAA 125

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FAV 185
           GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F V
Sbjct: 126 GFAALVRAIANLYVLPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSATDGSDSVAFQV 185

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIID 244
              + WP++R  +L +   +K + S   M+ T   S  F ++  + +   +  +++AI +
Sbjct: 186 APASHWPNMRAVILVVSAAKKGVSSTTGMQTTVATSTLFQSRAAETVPRRMKEMQEAIQN 245

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF   G++A  ++   HAT +   PP+ Y     +  I+ +E +  A  + I  Y T D
Sbjct: 246 KDFEAFGKLAMMDSNSFHATCLDTFPPIFYLNDISRAAIKVVEAINAAAGKIIAAY-TFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
           AGPN  + +  + E+ +   F  I     L+  D W
Sbjct: 305 AGPNAVVYYEEENEKEVAGLFKTI-----LNEKDGW 335


>gi|281200311|gb|EFA74532.1| diphosphomevalonate decarboxylase [Polysphondylium pallidum PN500]
          Length = 399

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 154/289 (53%), Gaps = 16/289 (5%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILNGQKISS 85
           P NIA  KYWGKRD KL LPLN+SLS +L      T  T + S+    D I LNG+K   
Sbjct: 10  PVNIATIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTAVASENFTEDAIWLNGKKEDI 69

Query: 86  QSSFFKKTTQF--CDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            ++ ++   +       +   K +F+ I + NN PT AGLASSASG+A L   L ++Y +
Sbjct: 70  NTTRYQNVLRMIRSRATKLMDKKHFVHICSINNFPTAAGLASSASGYACLVYVLAQLYGV 129

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLK 200
              S  +S +AR+GSGSACRS Y GF +W  G + +G DS AV       WP++ I +L 
Sbjct: 130 ---SGDISAIARIGSGSACRSVYGGFVKWEMGAESDGSDSIAVQVAPETHWPEMNIIVLV 186

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEKNAL 259
           + D++K+  S + M+ +   SP   +    I    +  I+ AI  +DF   G++  K++ 
Sbjct: 187 VNDKKKETSSTDGMQRSAATSPMMKERCATIVPQRMRDIEAAIQARDFQTFGDITMKDSD 246

Query: 260 KMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPN 305
             H  + A + P +Y+  +T   I  +   ++     I   +T DAGPN
Sbjct: 247 DFHE-VCATTDPAIYYLNDTSRYIMNLVHKYNKMSGKIKCAYTFDAGPN 294


>gi|170099423|ref|XP_001880930.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644455|gb|EDR08705.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 396

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 162/331 (48%), Gaps = 29/331 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILN 79
           +++A  P NIA+ KYWGKRD+KL LP N+SLS++L   HL + T      S   D + LN
Sbjct: 6   QATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFVKDTLWLN 65

Query: 80  GQKISSQSSFFKKTTQF-CDLFRQ------------FSKVYFLIETSNNIPTKAGLASSA 126
           G++   +      T  F     RQ             S     I + NN PT AGLASSA
Sbjct: 66  GKEDEIKPGGRLATCIFELKRLRQATVENEDPTAPKLSTYKVHIASYNNFPTAAGLASSA 125

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           SGFAAL  +L ++Y++P    +LS +AR GSGSACRS Y GF  W  G   +G DS A+ 
Sbjct: 126 SGFAALVASLAQLYALPVSPSTLSIIARQGSGSACRSLYGGFVAWQEGVHPDGSDSLAIQ 185

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
              Q  WP++   +  + D +K   S   M++T   SP      + +    +  I +AI+
Sbjct: 186 VAPQSHWPEIHALICVVSDDKKGTSSTSGMQLTVETSPLLQHRIKAVVPQRMKDISKAIL 245

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK------ETIQGMERVWDARQQSIPIY 297
           ++DF     +   ++ + HA  +   PP+ Y           I    R+  A  Q     
Sbjct: 246 EKDFDTFARITMADSNQFHAVALDTEPPIFYLNDVSRAIIAVIVEYNRLSLANGQGYKAA 305

Query: 298 FTLDAGPNLKLLFTHK-IEETIK---QFFPE 324
           +T DAGPN  +    K I+E I+    FFP+
Sbjct: 306 YTYDAGPNAVIYTEEKNIKEIIQLIVSFFPQ 336


>gi|171678217|ref|XP_001904058.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937178|emb|CAP61835.1| unnamed protein product [Podospora anserina S mat+]
          Length = 395

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 178/360 (49%), Gaps = 43/360 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTIT----HITVIDSDADCI 76
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T      +   S+ D +
Sbjct: 7   RASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASFPASEGDAL 66

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETS-----------------NNIPTK 119
           +LNG+     S      TQ C   R+       +E +                 NN PT 
Sbjct: 67  LLNGEP----SDISGARTQAC--LRELRSRRAALEAADPSLPKLSTYPLRLVSENNFPTA 120

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+GFAAL  A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G
Sbjct: 121 AGLASSAAGFAALVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGDKADG 180

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V   + WPD+R  +L +   +K + S   M+ T   S  F +     +  ++A
Sbjct: 181 TDSMADQVAEASHWPDMRALVLVVSAAKKGVSSSSGMQQTVATSGLFRERIATVVPENMA 240

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQS 293
            +++AI ++DF K  EV  +++   HAT     PP+ Y     +  I+ +E + +   ++
Sbjct: 241 IMEKAIAEKDFEKFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINEKAGRT 300

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL--WSTKDSLSQKNSIEL 351
           +  Y T DAGPN  + +  K  E +   F  +     L   D+  W + D    K +I L
Sbjct: 301 VAAY-TFDAGPNAVIYYQEKDTEAVVGTFYHV-----LQGADIGGWKSADIKGLKPTISL 354


>gi|322707809|gb|EFY99387.1| diphosphomevalonate decarboxylase [Metarhizium anisopliae ARSEF 23]
          Length = 391

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 167/330 (50%), Gaps = 34/330 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  D D ++L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASFSDGDSLML 67

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSN-----------------NIPTKAG 121
           NG+     S      TQ C  FR+       +E SN                 N PT AG
Sbjct: 68  NGE----LSDISGARTQAC--FRELRARRAALEASNASLPKLSTLPLKIVSENNFPTAAG 121

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +PE    LS +AR GSGSACRS + G+  W  G  ++G D
Sbjct: 122 LASSAAGFAALVQAIANLYELPESPSELSLIARQGSGSACRSLFGGYVAWRMGDKEDGSD 181

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHI 238
           S A  V   + WP +R  +L +   +K + S   M+ T   S  F Q   Q +  ++  +
Sbjct: 182 SMADLVAPASHWPSMRALILVVSAAKKGVSSTSGMQQTVATSGLFQQRIAQVVPANMDLM 241

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIP 295
           ++AI  +DF K  EV  +++   HA      PP+ Y     +  I+ +E +     ++I 
Sbjct: 242 EKAIKAKDFAKFAEVTMRDSNSFHACCADTYPPIFYMNDVSRAAIRAVESINAKAGKTIA 301

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  +   T+   F  +
Sbjct: 302 AY-TFDAGPNCVVYYLEEDAPTVLGAFAGV 330


>gi|156059890|ref|XP_001595868.1| hypothetical protein SS1G_03958 [Sclerotinia sclerotiorum 1980]
 gi|154701744|gb|EDO01483.1| hypothetical protein SS1G_03958 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 382

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 178/351 (50%), Gaps = 42/351 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILN 79
           ++S   P NIA+ KYWGKRD+KLNLP N+S+S++L      TH T   S     D ++LN
Sbjct: 8   QASTTAPVNIAVVKYWGKRDAKLNLPTNSSISVTLSQNDLRTHTTASCSSTFTEDTLLLN 67

Query: 80  G--QKISSQSSFFKKTTQFCDLFRQFSKVYFLIE-----------------TSNNIPTKA 120
           G  Q IS+        TQ C  FR+   +   +E                 + NN PT A
Sbjct: 68  GSPQDISNAR------TQAC--FRELRSLRSALEEADSSLPKLASYPLKIISENNFPTAA 119

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSA+GFAAL  A+  +Y +      LSR+AR GSGSACRS + G+  W  G  ++G 
Sbjct: 120 GLASSAAGFAALVRAIANLYELKSNPTELSRIARQGSGSACRSLFGGYVAWEMGQKEDGS 179

Query: 181 DSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAH 237
           DS AV     + WP +R  +L +   +K + S   M+IT   S  F Q  + +  + +  
Sbjct: 180 DSVAVEVAPASHWPTMRALILVVSAEKKGVSSTSGMQITVATSKLFKQRAENVVPEHMKE 239

Query: 238 IKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSI 294
           +++AI ++DF    +V   ++   HAT +   PP+ Y     +  I+ +E +  A  +++
Sbjct: 240 MERAIKEKDFEGFAKVTMMDSNSFHATCLDTFPPIFYLNDVSRAAIRAVEDINKAAGKTV 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
             Y T DAGPN  + F    EE I      +  +  L+  D W+ K+  S+
Sbjct: 300 AAY-TFDAGPNAVIYFE---EENIDLVAGALKSV--LEGVDGWNGKEVESK 344


>gi|328876171|gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
          Length = 415

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 150/288 (52%), Gaps = 14/288 (4%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNGQKISS 85
           P NIA  KYWGKRD  L LPLN+SLS +L      T  T + S++   D + LNG+K   
Sbjct: 33  PVNIATIKYWGKRDENLILPLNSSLSGTLHQDDLKTTTTAVASESFEEDALWLNGKKEDV 92

Query: 86  QSSFFKKT--TQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            S  ++    T      +   K +F+ I + NN PT AGLASSASG+A L   L ++Y +
Sbjct: 93  NSVRYQNVLKTIRSRATKLMDKKHFVHICSINNFPTAAGLASSASGYACLVYVLAQLYGV 152

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLK 200
                 +S +ARLGSGSACRS + GF +W  GT  +G DS AV     + WPD+ I +L 
Sbjct: 153 ---EGDVSSIARLGSGSACRSMFGGFVKWEMGTKADGSDSIAVQVAPESHWPDMNIIVLV 209

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQ-WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           + D++K+  S + M+ +   S    +     +   +  I++AI + DF   G++  K++ 
Sbjct: 210 VNDKKKETSSTDGMQRSAQTSAMMKERCATTVPERMVTIERAIQEHDFQTFGDITMKDSD 269

Query: 260 KMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
             H       PP+ Y    +  I  +   ++    S+   +T DAGPN
Sbjct: 270 DFHEVCATTDPPIYYLNDTSRYIMNLIHRYNKLAGSVRCAYTFDAGPN 317


>gi|70994672|ref|XP_752113.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus Af293]
 gi|66849747|gb|EAL90075.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus Af293]
 gi|159124973|gb|EDP50090.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus A1163]
          Length = 404

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 169/320 (52%), Gaps = 27/320 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTIT--HITVIDSDADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T    + I   AD +IL
Sbjct: 11  RATTTAPVNIAVIKYWGKRDASLNLPTNSSLSVTLSQRSLRTLTTASCSAIYPAADELIL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    Q+S  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 71  NGKPQDIQTS--KRTLACLSNLRSLRQALENADPSLPKLSTLPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS A
Sbjct: 129 SAAGFAALVRAVADLYQLPQSPLELSRIARQGSGSACRSLMGGYVAWRAGEREDGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F T+    +   +A I+ A
Sbjct: 189 EEVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSSLFATRAASVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 249 IQNKDFATFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAVGRTVCAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETI 318
           T DAGPN  + +  K  E +
Sbjct: 308 TFDAGPNAVIYYLEKDSEVV 327


>gi|183983206|ref|YP_001851497.1| diphosphomevalonate decarboxylase [Mycobacterium marinum M]
 gi|183176532|gb|ACC41642.1| diphosphomevalonate decarboxylase [Mycobacterium marinum M]
          Length = 336

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/307 (36%), Positives = 158/307 (51%), Gaps = 12/307 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI----TVIDSDADCIILNGQKISSQ 86
           NIAL KYWGKRD +  LP+ +SLS++L    T T +    T      D +++ G+   + 
Sbjct: 13  NIALIKYWGKRDEEFMLPMTSSLSMTLDIFPTTTTVEVGPTGGGVGPDIVMMAGKP--AP 70

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
            +F  + T+F DL R    S+   +++T N  PT AGLASSASGFAAL  A    Y +  
Sbjct: 71  EAFSTRVTEFLDLLRVRVKSRAPAIVDTHNAGPTGAGLASSASGFAALAAAACAAYGLDT 130

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
            +  LSR+AR GSGSA RS + GF  W  G    G D  A  +           L ++  
Sbjct: 131 DARELSRLARRGSGSASRSVFGGFSVWHAGA-AIGADGDAQSYAEPIDVALDLALVVVVV 189

Query: 205 E---KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           E   K+I SR AM  T   SP +  W      DL  ++ A+   D    G +AE NA+ M
Sbjct: 190 EAGAKQISSRAAMSQTVKTSPLYRAWADASGDDLHAMQAALAAGDLHGAGAIAEANAMGM 249

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HATM+AA P + Y    ++Q ++RV   R   I  Y T+DAGPN+K+L +      I   
Sbjct: 250 HATMLAARPAVRYINAASLQVIDRVVAMRGDGIAAYLTMDAGPNVKVLCSRDDAALIAAS 309

Query: 322 FPEITII 328
             E++ +
Sbjct: 310 LKELSQV 316


>gi|46137817|ref|XP_390600.1| hypothetical protein FG10424.1 [Gibberella zeae PH-1]
          Length = 382

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 168/327 (51%), Gaps = 34/327 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   +  D D + L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQDDLRTLTTASCSSTFTDGDSLTL 67

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQF-----------------SKVYFLIETSNNIPTKAG 121
           NG+     S      TQ C  FR+                  S     I + NN PT AG
Sbjct: 68  NGE----SSDISGARTQAC--FRELRSRRAALEQADSSLPKLSSYPLKIVSENNFPTAAG 121

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G  ++G D
Sbjct: 122 LASSAAGFAALVQAIAFLYELPDSPSDLSLIARQGSGSACRSLFGGYVAWRMGEKEDGSD 181

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHI 238
           S A  V   + WP++R  +L     +K + S   M+ T   S  F +  T  +  ++A +
Sbjct: 182 SKADLVAPASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFKERITNVVPANMALM 241

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIP 295
           ++AI D+DF K  EV  + +   HAT     PP+ Y     +  I+ +E + +   +++ 
Sbjct: 242 EEAIKDKDFPKFAEVTMRESNSFHATCADTYPPIFYMNDISRAAIRAVECINEKVGRTVA 301

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFF 322
            Y T DAGPN  + +  K  + I   F
Sbjct: 302 AY-TFDAGPNCVIYYEEKDADIIVGAF 327


>gi|299783377|gb|ADJ41375.1| Mevalonate diphosphate decarboxylase [Lactobacillus fermentum CECT
           5716]
          Length = 289

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 159/278 (57%), Gaps = 10/278 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+ 
Sbjct: 3   TTARAHTNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGEL 62

Query: 83  ISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S+  +  +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  +  
Sbjct: 63  VSANKA--QKVVKFMDLVRQLSGRTEYAQITSVNNVPMAAGLASSASAFAALAGAAAKDA 120

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +    + LSR+AR GSGSA RS Y G  EW  G D     SFA P   + PD  I +L 
Sbjct: 121 GLDLSLKDLSRLARRGSGSATRSVYGGLVEWHRGVDD--ATSFAEPVQ-EVPDFDIAMLA 177

Query: 201 II--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           I+    +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NA
Sbjct: 178 ILVDTSQKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENA 237

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPI 296
           L+MHA  +AA P   Y+  +TI  M+ +   R++ + +
Sbjct: 238 LRMHALNLAADPGFTYFDGQTILAMQTIDRLREEGLKL 275


>gi|154292222|ref|XP_001546687.1| hypothetical protein BC1G_14194 [Botryotinia fuckeliana B05.10]
 gi|150846214|gb|EDN21407.1| hypothetical protein BC1G_14194 [Botryotinia fuckeliana B05.10]
          Length = 382

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 173/349 (49%), Gaps = 38/349 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILN 79
           ++S   P NIA+ KYWGKRD+KLNLP N+S+S++L      TH T   S     D ++LN
Sbjct: 8   QASTTAPVNIAVVKYWGKRDAKLNLPTNSSISVTLSQDDLRTHTTATCSSTFTEDSLLLN 67

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETS-----------------NNIPTKAGL 122
           G    S        TQ C  FR    +   +E S                 NN PT AGL
Sbjct: 68  G----SSQDISNARTQAC--FRDLRSLRSALEDSDSSLPKLSSYPLRIISENNFPTAAGL 121

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+GFAAL  A+  +Y +      LS++AR GSGSACRS + G+  W  G  ++G DS
Sbjct: 122 ASSAAGFAALVRAIANLYELQSNPTELSKIARQGSGSACRSLFGGYVAWEMGQKEDGSDS 181

Query: 183 FAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIK 239
            AV     + WP +R  +L +   +K + S   M+IT   S  F Q  + +  + +  ++
Sbjct: 182 VAVEVAPASHWPTMRALILVVSAEKKGVSSTSGMQITVATSKLFKQRAENVVPEHMKEME 241

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPI 296
           +AI ++DF    +V    +   HAT +   PP+ Y     +  I+ +E + +A  +++  
Sbjct: 242 RAIKEKDFEGFAKVTMMESNSFHATCLDTFPPIFYLNDVSRAAIRAVEDINNAAGKTVAA 301

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           Y T DAGPN  + F    EE +      +  +  L   D W+ KD  S+
Sbjct: 302 Y-TFDAGPNAVIYFE---EENLGLVAGALKSV--LGGVDGWNGKDVESK 344


>gi|321256436|ref|XP_003193399.1| diphosphomevalonate decarboxylase [Cryptococcus gattii WM276]
 gi|317459869|gb|ADV21612.1| diphosphomevalonate decarboxylase, putative [Cryptococcus gattii
           WM276]
          Length = 395

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 161/326 (49%), Gaps = 26/326 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCIIL 78
           +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + L
Sbjct: 4   EATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFETGDRLWL 63

Query: 79  NGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           NG++            I     + K+         + S+    I + NN PT AGLASSA
Sbjct: 64  NGKEEAIKEGGRLAVCIKELREWRKEMEDKQKDLPKLSEWPLRIASYNNFPTAAGLASSA 123

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           SG AAL  +L  +YS+P+ +  LS VAR GSGSACRS + GF  W  GTD  G DS A  
Sbjct: 124 SGLAALVASLASLYSLPQSASQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAEE 183

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           V     WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI  
Sbjct: 184 VAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRVVPKRMDAISQAIKA 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF +  ++   ++   HA  +  +PP+ Y     +  I  +E +  A  + I  Y T D
Sbjct: 244 RDFSEFAKLTMVDSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAY-TFD 302

Query: 302 AGPNLKLLFTHK----IEETIKQFFP 323
           AGPN  +    K    +   IK+FFP
Sbjct: 303 AGPNAVIYTLEKNMPFVLGAIKRFFP 328


>gi|322411585|gb|EFY02493.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 314

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 171/313 (54%), Gaps = 18/313 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +   A  D   +NG       
Sbjct: 12  ANIAIIKYWGKEDQTKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYING--CLQDD 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  KEHAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGSA RSF+     W    D+N  D + V       DL++ ++ ++  D +
Sbjct: 130 ALAQKAKFASGSASRSFFGPVAAW----DKNSGDIYKVD-----TDLKMAMIMLVLNDAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MHAT 
Sbjct: 181 KPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE- 324
             A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F + 
Sbjct: 241 KTANPSFSYLADESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARFEKD 300

Query: 325 --ITIIDPLDSPD 335
             I +    D PD
Sbjct: 301 YRIVVSKTKDLPD 313


>gi|58261674|ref|XP_568247.1| diphosphomevalonate decarboxylase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57230329|gb|AAW46730.1| diphosphomevalonate decarboxylase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 395

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 160/326 (49%), Gaps = 26/326 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCIIL 78
           +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + L
Sbjct: 4   EATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFEAGDKLWL 63

Query: 79  NGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           NG++            I     + K+         + S+    I + NN PT AGLASSA
Sbjct: 64  NGKEEVIKEGGRLAVCIKELRGWRKEMESKDKDLPKLSEWPLRIASYNNFPTAAGLASSA 123

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           SG AAL  +L  +YS+P+    LS VAR GSGSACRS + GF  W  GTD  G DS A  
Sbjct: 124 SGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAEE 183

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           V     WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI  
Sbjct: 184 VAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRIVPKRMDAISQAIKA 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF +  ++   ++   HA  +  +PP+ Y     +  I  +E +  A  + I  Y T D
Sbjct: 244 RDFSEFAKLTMADSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAY-TFD 302

Query: 302 AGPNLKLLFTHK----IEETIKQFFP 323
           AGPN  +    K    +   IK+FFP
Sbjct: 303 AGPNAVIYTLEKNMPVVLGAIKRFFP 328


>gi|240280082|gb|EER43586.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus H143]
 gi|325088803|gb|EGC42113.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus H88]
          Length = 406

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 113/326 (34%), Positives = 164/326 (50%), Gaps = 23/326 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDA-DCI 76
           ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T        +DA D +
Sbjct: 9   RASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPTYPTDAGDSL 68

Query: 77  ILNGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            LN Q             +S   S  ++         + S     I + NN PT AGLAS
Sbjct: 69  TLNSQPQNIKDSKRTLACLSDLRSLRRELENANSSLPKLSGFPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSFA
Sbjct: 129 SAAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRMGVLEDGSDSFA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L + D +K + S + M+ T   S  F T+    +   +A I+ A
Sbjct: 189 EEVAPASHWPEMRALILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIESA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFT 299
           I ++DF    E+  K++   HAT +   PP  Y    +   +  V D  + +  I   +T
Sbjct: 249 IKNRDFASFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGEIICAYT 308

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEI 325
            DAGPN  + +  K  E +   F  I
Sbjct: 309 FDAGPNAVIYYLGKDSEHVIGTFKSI 334


>gi|118763544|gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
          Length = 421

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 173/317 (54%), Gaps = 23/317 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T ++V  S   DC+ LNG+
Sbjct: 13  TAQTPTNIAVIKYWGKRDESLILPINSSISVTLDPSHLCTTTTVSVSPSFKQDCMWLNGK 72

Query: 82  KISSQSSFFKKT-----TQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS     F++      ++ CD+           + + K++  I + NN PT AGLASSA
Sbjct: 73  EISLSGGRFQRCLREIRSRACDVEDEKKGFKIAKKDWEKLHVHIASYNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G + +G DS A+P
Sbjct: 133 AGFACLVFSLAKLMNLKEDHGQLSAIARQGSGSACRSLFGGFVKWDMGKESDGSDSIAIP 192

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W +L I +  +   +K+  S   M  T   SP      ++ +   +  +++AI 
Sbjct: 193 LVDEKHWDELVIVIAVVSAHQKETSSTSGMRDTVETSPLIQHRAKEVVPKRIVQMEEAIS 252

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF     ++  ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T D
Sbjct: 253 NRDFSTFAHLSCSDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFD 312

Query: 302 AGPNLKLLFTHKIEETI 318
           AGPN  ++  ++   T+
Sbjct: 313 AGPNAAMIARNRKVATL 329


>gi|238491808|ref|XP_002377141.1| diphosphomevalonate decarboxylase [Aspergillus flavus NRRL3357]
 gi|220697554|gb|EED53895.1| diphosphomevalonate decarboxylase [Aspergillus flavus NRRL3357]
          Length = 404

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 166/320 (51%), Gaps = 27/320 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS----DADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L      T  T   S     AD +IL
Sbjct: 11  RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSAKYPTADELIL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 71  NGKPQDIQSS--KRTLACLSNLRSLRQELEAADSSLPRLSTLPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  GT  +G DS A
Sbjct: 129 SAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGTLADGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F    + +  + +A I+ A
Sbjct: 189 EEVAPESHWPEMRALILVVSAEKKDVPSTEGMQTTVATSNLFATRAESVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 249 IQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAVGRTVCAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETI 318
           T DAGPN  + +  K  E +
Sbjct: 308 TFDAGPNAVIYYLEKDSELV 327


>gi|170084655|ref|XP_001873551.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651103|gb|EDR15343.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 396

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 163/331 (49%), Gaps = 29/331 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILN 79
           +++A  P NIA+ KYWGKRD+KL LP N+SLS++L   HL + T      S   D + LN
Sbjct: 6   QATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFVKDTLWLN 65

Query: 80  GQK------------ISSQSSFFKKTTQFCDLFR-QFSKVYFLIETSNNIPTKAGLASSA 126
           G++            IS      + T +  D    + S     I + NN PT AGLASSA
Sbjct: 66  GKEDEIKPGGRLATCISELKRLRQATVENEDPSAPKLSTYKVHIASYNNFPTAAGLASSA 125

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           SGFAAL  +L ++Y++P    +LS +AR GSGSACRS Y GF  W  G   +G DS AV 
Sbjct: 126 SGFAALVASLAQLYALPVSPSTLSIIARQGSGSACRSLYGGFVAWQEGVLPDGSDSLAVQ 185

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
              Q  WP++   +  + D +K   S   M++T   S       + +    +  I +AI+
Sbjct: 186 VAPQSHWPEIHALICVVSDDKKGTSSTSGMQLTVETSTLLQHRIKAVVPQRMKDISKAIL 245

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK------ETIQGMERVWDARQQSIPIY 297
           ++DF     +   ++ + HA  +   PP+ Y           I    R+  A  Q     
Sbjct: 246 EKDFDTFARITMADSNQFHAVALDTEPPIFYMNDVSRAIIAVIVEYNRLSLANGQGYKAA 305

Query: 298 FTLDAGPNLKLLFTHK-IEETIK---QFFPE 324
           +T DAGPN  +    K I+E I+    FFP+
Sbjct: 306 YTYDAGPNAVIYAEEKNIKEIIQLIVSFFPQ 336


>gi|332797171|ref|YP_004458671.1| diphosphomevalonate decarboxylase [Acidianus hospitalis W1]
 gi|332694906|gb|AEE94373.1| diphosphomevalonate decarboxylase [Acidianus hospitalis W1]
          Length = 324

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 165/317 (52%), Gaps = 10/317 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +  A  PSNIA+ KYWGKR+++LNLPLN+S+S+SL +L   T +   +    D +I+NG+
Sbjct: 4   EGEAIAPSNIAIVKYWGKRNAELNLPLNSSISISLDNLYARTKVIFSEEFSKDEVIINGK 63

Query: 82  KISSQSSFFKKTTQFCDLFRQ-FSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRI 139
           K+S + +      +  ++FR+ + K  F  + ++ N P  +GLASSA+G AAL  A    
Sbjct: 64  KLSEKETL-NYAGRVLNIFRKIYGKSLFAKVISTTNFPPSSGLASSAAGIAALVYASNEA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIG 197
             +    + LS++AR+GSGSACRS   GF  W  G  ++G DSF       N W DL   
Sbjct: 123 LGLGLTQKELSKIARIGSGSACRSTEGGFVVWEKGEREDGEDSFCYQIFPPNYWEDLVDI 182

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +  + D +K++ SRE ME++   S         I      + ++I  +D  K  E+  ++
Sbjct: 183 IAIVSDEKKEVSSREGMEVSTRSSYLMKCRLDFIKETFNDVIESIRKKDEEKFFELTMRH 242

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           +  MHA ++ + P   Y    + + +  V D         +T DAGPN  +  T K  + 
Sbjct: 243 SNSMHAVILDSWPSFFYLNDMSFKIIRWVQDFGHAG----YTFDAGPNPHIFTTKKHMKE 298

Query: 318 IKQFFPEITIIDPLDSP 334
           +  F  ++ +   + SP
Sbjct: 299 VINFLQDLNLKYIITSP 315


>gi|296415239|ref|XP_002837299.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633160|emb|CAZ81490.1| unnamed protein product [Tuber melanosporum]
          Length = 390

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 168/327 (51%), Gaps = 26/327 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNG 80
           +S   P NIA+ KYWGKR  KLNLP N+SLS++L      TH T   S     + + LNG
Sbjct: 9   ASTTAPVNIAVVKYWGKRSVKLNLPTNSSLSVTLSQADLKTHTTAACSSTFTENSLWLNG 68

Query: 81  --QKISS--QSSFF-------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGF 129
             Q +S   Q++ F       KK         + S+ Y  + + NN PT AGLASSA+GF
Sbjct: 69  EAQDVSGARQTACFRELKALRKKLEDANPSLPKMSEYYVHVVSENNFPTAAGLASSAAGF 128

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-- 187
           AAL  A+  +Y +PE    LS++AR GSGSACRS + G+  W  G   +G DS+AV    
Sbjct: 129 AALVRAIADLYELPESPTELSKIARQGSGSACRSLFGGYVAWEMGQAVDGSDSYAVEVAP 188

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQD 246
            + WP+++  +L +   +K + S   M+ T + S  FT      +   +  +K AI ++D
Sbjct: 189 ASHWPEMKAAILVVSAAKKSVSSTAGMQATVNTSALFTHRACDVVPKRMEAMKAAIENRD 248

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAG 303
           F +       ++ + HA  +  +PP+ Y     +  I+ +E + +  +  +   +T DAG
Sbjct: 249 FEQFAAHTMADSNQFHAVCLDTTPPIFYMNDVSRAAIRAVEAL-NTHEGRVVGAYTFDAG 307

Query: 304 PNLKLLFTHKIEETIKQFF-----PEI 325
           PN  + +  K EE I  F      PE+
Sbjct: 308 PNAVIYYQEKDEEKILGFLGTLLAPEV 334


>gi|134115721|ref|XP_773574.1| hypothetical protein CNBI1880 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256200|gb|EAL18927.1| hypothetical protein CNBI1880 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 395

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 160/326 (49%), Gaps = 26/326 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCIIL 78
           +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + L
Sbjct: 4   EATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFEAGDKLWL 63

Query: 79  NGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           NG++            I     + K+         + S+    I + NN PT AGLASSA
Sbjct: 64  NGKEEVIKEGGRLAVCIKELRRWRKEMESKDKDLPKLSEWPLRIASYNNFPTAAGLASSA 123

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           SG AAL  +L  +YS+P+    LS VAR GSGSACRS + GF  W  GTD  G DS A  
Sbjct: 124 SGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAEE 183

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           V     WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI  
Sbjct: 184 VAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRIVPKRMDAISQAIKA 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF +  ++   ++   HA  +  +PP+ Y     +  I  +E +  A  + I  Y T D
Sbjct: 244 RDFSEFAKLTMADSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAY-TFD 302

Query: 302 AGPNLKLLFTHK----IEETIKQFFP 323
           AGPN  +    K    +   IK+FFP
Sbjct: 303 AGPNAVIYTLEKNMPVVLGAIKRFFP 328


>gi|283782813|ref|YP_003373567.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis 409-05]
 gi|283441019|gb|ADB13485.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis 409-05]
          Length = 365

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 170/310 (54%), Gaps = 17/310 (5%)

Query: 15  ECNPKIN-----EKSSAFLPSN--IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT 67
           E  PKI        +SAF  +N  IAL KYWGKRD KL LP  +SLSL+L  L T T ++
Sbjct: 5   EIQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVS 64

Query: 68  VIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLAS 124
            +++ + D   L+ +KISS +  F++     DL R+ +++     + + N +PT AGLAS
Sbjct: 65  FVNNLEQDTFTLDNEKISSSAKTFRRVVAMLDLVREIARISTKASVISHNIVPTAAGLAS 124

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SASGFAAL  A      +      LSR+AR GSGSACRS + G   W  G D     S+A
Sbjct: 125 SASGFAALASAASYAAGLNLTPRELSRLARRGSGSACRSIFGGLSIWHAGCDDET--SYA 182

Query: 185 VPFNNQWPDLR-IGLLKII----DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIK 239
            P  N    L+ + L  I+    D +K I SREAM  T   SP + QW +Q   DL   K
Sbjct: 183 EPIENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQSKDDLEIAK 242

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT 299
            AI   D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R+    ++ T
Sbjct: 243 NAIKRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMRKDGWLVWST 302

Query: 300 LDAGPNLKLL 309
           +DAGPN+K+L
Sbjct: 303 MDAGPNVKVL 312


>gi|225560523|gb|EEH08804.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus G186AR]
          Length = 406

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 167/327 (51%), Gaps = 25/327 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHIT---VIDSDA-DCI 76
           ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L  G L   T  +      +DA D +
Sbjct: 9   RASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQGSLRAYTTASCSPTYPTDAGDSL 68

Query: 77  ILNGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            LN Q             +S   S  ++         + S     I + NN PT AGLAS
Sbjct: 69  TLNSQPQNIKDSKRTLACLSDLRSLRRELENANPSLPKLSGFPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSFA
Sbjct: 129 SAAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRMGVLEDGSDSFA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L + D +K + S + M+ T   S  F T+    +   +A I+ A
Sbjct: 189 EEVAPASHWPEMRALILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIESA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  K++   HAT +   PP  Y    +   +  V D   A  ++I  Y 
Sbjct: 249 IKNRDFASFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEI 325
           T DAGPN  + +  K  E +   F  I
Sbjct: 308 TFDAGPNAVIYYLDKDSEHVIGTFKSI 334


>gi|315038486|ref|YP_004032054.1| mevalonate pyrophosphate decarboxylase [Lactobacillus amylovorus
           GRL 1112]
 gi|312276619|gb|ADQ59259.1| mevalonate pyrophosphate decarboxylase [Lactobacillus amylovorus
           GRL 1112]
          Length = 321

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 174/301 (57%), Gaps = 13/301 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S  +S 
Sbjct: 9   TNIALIKYWGKKDATLRIPLMSSLSMTLDAFYTDTSIEK-GTDTNEFYLNDKKQSLANS- 66

Query: 90  FKKTTQFCDLFRQ---FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
            ++   + +  +Q     K   +I+++N++PT AGLASS+S FAAL  A    Y I    
Sbjct: 67  -QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYHIDADK 125

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIIDR 204
             LSR+AR+GSGSA RS + GF  W  G       ++A+   ++ P  DL +  +++  +
Sbjct: 126 TLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYAL---DEHPKIDLHLLAIELNTK 182

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+  +  SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +MHA 
Sbjct: 183 QKKISSTRGMKDAQS-SPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEMHAI 241

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFP 323
            + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L     I+E I+ F  
Sbjct: 242 NLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIENFES 301

Query: 324 E 324
           E
Sbjct: 302 E 302


>gi|116618481|ref|YP_818852.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116097328|gb|ABJ62479.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 313

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 166/291 (57%), Gaps = 25/291 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK++++LNLP  +SLSL+L    T T  +V  ++ D  ILN Q + +    
Sbjct: 7   TNIALIKYWGKKNTELNLPTTSSLSLTLDKFYTTT--SVEPANHDRFILNDQVVDA---- 60

Query: 90  FKKTTQFCDLFRQ----FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             +  +F D+ RQ    F+ +  + E  N++PT AGLASSAS FAALT A+     +   
Sbjct: 61  -TRVHRFLDILRQQLGDFTPLQVISE--NHVPTSAGLASSASAFAALTGAVTHELGMDLP 117

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL--KIID 203
            E LSR+AR GSGSA RSF+  F  W  G D     SFA   N   P+L I L+  ++ D
Sbjct: 118 KEELSRLARRGSGSASRSFFGNFAMWHKGIDD--ASSFAESLN--APELPIALVVAEVCD 173

Query: 204 REKKIGSREAME--ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             KKI S E M+  IT   SP + +W  + +     ++ AI+DQD  K+G +AE NAL M
Sbjct: 174 APKKITSTEGMKRAIT---SPNYDRWLSKSANQFIDMQHAILDQDIDKIGALAEDNALGM 230

Query: 262 HA-TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           HA  + A   P  Y+  +T   +  + D R Q I  Y T+DAGPN+K++ T
Sbjct: 231 HALNLTATRSPFTYFTDKTQLILSLIQDMRHQGILAYATIDAGPNVKIITT 281


>gi|66816267|ref|XP_642143.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
 gi|74856777|sp|Q54YQ9|ERG19_DICDI RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|60470496|gb|EAL68476.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
          Length = 391

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 151/290 (52%), Gaps = 18/290 (6%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILNGQK--- 82
           P NIA+ KYWGKRD  + LPLN+SLS +L      T  T++ S+    D + LNG+K   
Sbjct: 11  PVNIAVIKYWGKRDENIILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDELYLNGKKEDI 70

Query: 83  --ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
             +  Q+      ++   L  +   V+  I + NN PT AGLASSASG+  L   L ++Y
Sbjct: 71  NAVRYQNVLKMIRSRATKLMDKKHCVH--IASINNFPTAAGLASSASGYCCLVFTLAQMY 128

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGL 198
            +      +S +ARLGSGSACRS Y GF +W  GT  +G DS AV     + WPD+ I +
Sbjct: 129 GV---DGDISGIARLGSGSACRSMYGGFVKWEMGTKDDGSDSIAVQVQPESHWPDMNIIV 185

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQ-WTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           L + D++K+  S + M+ +   S    +     +   +  I++AI  +DF   G++  K+
Sbjct: 186 LVVNDKKKETSSTDGMQKSAATSVMMKERCAVTVPNRMRDIEEAINKKDFQTFGDITMKD 245

Query: 258 ALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
           +   H      +PP+ Y    +  I  +   ++    SI   +T DAGPN
Sbjct: 246 SDDFHEVCATTTPPIYYLNDTSRYIMNLIHRYNKLSGSIKCAYTFDAGPN 295


>gi|317495993|ref|ZP_07954355.1| diphosphomevalonate decarboxylase [Gemella moribillum M424]
 gi|316913897|gb|EFV35381.1| diphosphomevalonate decarboxylase [Gemella moribillum M424]
          Length = 303

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 158/291 (54%), Gaps = 15/291 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+     LP N ++SL L +L + T I    +D D   +N +K S +   
Sbjct: 9   ANIALVKYWGKKSKDPVLPFNPNISLRLDNLLSKTKIEPSLTDEDEFYINDEKQSQEE-- 66

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
            +K T+F   F    +    I + N +PT AGL+SS+SG  AL LA  + + + + +E L
Sbjct: 67  VEKITKFIAKFTPIEREKICIRSYNTVPTAAGLSSSSSGTMALVLACNKYFKLNKTTEEL 126

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE--KK 207
             +++ GSGS+CRSFYR    W+   +   ++  +        DL  G++ ++  E  KK
Sbjct: 127 VEISKEGSGSSCRSFYR-LAAWL---EDGSVEELSC-------DLDFGMMVLVVNEDRKK 175

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SR AME     S  F  W ++   D   +K A+ + DF K+G + E NAL MHAT   
Sbjct: 176 ISSRIAMERCVQTSTTFDAWVEKAKEDFVDMKIALKNADFEKIGAITEANALAMHATTTT 235

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++P   +   E+ + ME V   +++    YFT+DAGPN+K+L+  + +E I
Sbjct: 236 STPSFTFLTDESYRAMEIVKTLQEKGYRCYFTMDAGPNVKVLYLKEDQEKI 286


>gi|295659468|ref|XP_002790292.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb01]
 gi|226281744|gb|EEH37310.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb01]
          Length = 405

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 169/330 (51%), Gaps = 31/330 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDA-DCI 76
           ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T        SDA D +
Sbjct: 9   RASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPSDAGDTL 68

Query: 77  ILNGQKISSQSSFFKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAG 121
            LN +  S Q S   K T  C  DL   RQ            S     I + NN PT AG
Sbjct: 69  TLNSEPHSIQDS---KRTLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAG 125

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+D
Sbjct: 126 LASSAAGFAALVCAIANLYELPQSPRDLSRIARQGSGSACRSMMGGYVAWRAGVLEDGID 185

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHI 238
           S A  V   + WPD+R  +L + D +K++ S + M+ T   S  F T+    +   +  I
Sbjct: 186 SLAEEVAPASHWPDMRALILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARMTAI 245

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSIP 295
           + AI +++F    E+  +++   HAT +   PP  Y    +   +  V D  +   ++I 
Sbjct: 246 EAAIQNRNFPSFAEITMRDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETIC 305

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  K  E +   F  I
Sbjct: 306 AY-TFDAGPNAVIYYLEKESERVIGTFKSI 334


>gi|327183681|gb|AEA32128.1| diphosphomevalonate decarboxylase [Lactobacillus amylovorus GRL
           1118]
          Length = 321

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 173/301 (57%), Gaps = 13/301 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S  +S 
Sbjct: 9   TNIALIKYWGKKDAILRIPLMSSLSMTLDAFYTDTSIEK-GTDTNEFYLNDKKQSLANS- 66

Query: 90  FKKTTQFCDLFRQ---FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
            ++   + +  +Q     K   +I+++N++PT AGLASS+S FAAL  A    Y I    
Sbjct: 67  -QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYHIDADK 125

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIIDR 204
             LSR+AR+GSGSA RS + GF  W  G       ++A+   ++ P  DL +  +++  +
Sbjct: 126 TLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYAL---DEHPKIDLHLLAIELNTK 182

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+     SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +MHA 
Sbjct: 183 QKKISSTRGMK-DAQSSPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEMHAI 241

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFP 323
            + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L     I+E I+ F  
Sbjct: 242 NLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIENFES 301

Query: 324 E 324
           E
Sbjct: 302 E 302


>gi|227878668|ref|ZP_03996583.1| possible diphosphomevalonate decarboxylase [Lactobacillus crispatus
           JV-V01]
 gi|256850379|ref|ZP_05555807.1| mevalonate diphosphate decarboxylase [Lactobacillus crispatus
           MV-1A-US]
 gi|262046473|ref|ZP_06019435.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           MV-3A-US]
 gi|293380928|ref|ZP_06626962.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus 214-1]
 gi|312978155|ref|ZP_07789899.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus CTV-05]
 gi|227861732|gb|EEJ69336.1| possible diphosphomevalonate decarboxylase [Lactobacillus crispatus
           JV-V01]
 gi|256712776|gb|EEU27769.1| mevalonate diphosphate decarboxylase [Lactobacillus crispatus
           MV-1A-US]
 gi|260573344|gb|EEX29902.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           MV-3A-US]
 gi|290922503|gb|EFD99471.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus 214-1]
 gi|310894873|gb|EFQ43943.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus CTV-05]
          Length = 320

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 169/299 (56%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS-- 87
           +NIAL KYWGK D KL LPL +SLS++L    T T +   D +    + N Q+ ++ S  
Sbjct: 9   TNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGENQFFLNNQQQTAAASQR 68

Query: 88  --SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             ++ KK        R       ++++ N++PT AGLASS+S FAAL  A  + Y I   
Sbjct: 69  VFAYLKKLQA-----RFHVTGNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQCYDINID 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIID 203
            E LSR+AR+GSGSA RS Y GF  W  G       ++A+   ++ P  DL +  +++  
Sbjct: 124 LEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYAL---DETPTMDLHLLAVELNT 180

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++KKI S   M+     SPFF  W ++ +++L  + +AI   DF  LG++AE NA +MHA
Sbjct: 181 KQKKISSTYGMK-DAQSSPFFRPWLERNNSELNEMIKAIKSNDFTALGQLAELNANEMHA 239

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 240 INLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298


>gi|312212165|emb|CBX92249.1| hypothetical protein [Leptosphaeria maculans]
          Length = 919

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 168/322 (52%), Gaps = 22/322 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L      TH T   S +    D ++
Sbjct: 55  HRASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSPSYPAEDTLL 114

Query: 78  LNGQK-----ISSQSSFFKKTTQFCDLFRQFSKVYFL------IETSNNIPTKAGLASSA 126
           LNGQ        +Q+ F +  T    L  Q S +  L      I + NN PT AGLASSA
Sbjct: 115 LNGQPQDVSGARTQACFRELRTLRRKLEEQDSSLPKLADQPLRIVSENNFPTAAGLASSA 174

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FA 184
           +GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F 
Sbjct: 175 AGFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSAADGSDSVAFQ 234

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+ T   S  F ++  + +   +  +++AI 
Sbjct: 235 VAPASHWPNMRAVILVVSAAKKGVSSTTGMQTTVATSSLFQSRAKETVPRRMKEMQEAIK 294

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTL 300
           ++DF   G+V   ++   HAT +   PP+ Y     +  I  +  +  A  + I  Y T 
Sbjct: 295 NKDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDISRAAIMVVNAINAAAGKIIAAY-TF 353

Query: 301 DAGPNLKLLFTHKIEETIKQFF 322
           DAGPN  + +  + E+ +   F
Sbjct: 354 DAGPNAVVYYLEENEKDVAGLF 375


>gi|331224857|ref|XP_003325100.1| diphosphomevalonate decarboxylase MVD1 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309304090|gb|EFP80681.1| diphosphomevalonate decarboxylase MVD1 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 427

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 157/349 (44%), Gaps = 41/349 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT------------VIDSDADCI 76
           P NIA+ KYWGKRD KL LP N+SLS++L      +  T            V + + D +
Sbjct: 10  PVNIAVIKYWGKRDKKLILPTNSSLSVTLDQHDLRSTTTARLLEPSHKNGQVGEEEEDQL 69

Query: 77  ILNG--QKISSQSSFFKKTTQFCDLFRQF-------------SKVYFLIETSNNIPTKAG 121
            LNG  Q I   S       +   L   F             S+   LI + NN PT AG
Sbjct: 70  WLNGARQPIEKDSRLSNCLKELRKLKAHFELQQPKTEASLPESRRALLIASENNFPTAAG 129

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSASGFAAL   + ++Y +P +   LS++AR GSGSACRS + GF  W  G   +G D
Sbjct: 130 LASSASGFAALVYTISKLYELPIEMTELSKIARQGSGSACRSIFGGFVSWEMGAASDGSD 189

Query: 182 SFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHI 238
           S AV     + WPDL   +  + DR+K   S   M+ +   S       +++  + +  +
Sbjct: 190 SMAVSVAERSDWPDLEALICVVSDRKKGTSSTSGMDGSVQTSELLQHRIEKVVPERMKRM 249

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK------ETIQGMERVWDARQQ 292
           K AI  +DF     +   ++ + HA  +   PP+ Y           I+ + R   A   
Sbjct: 250 KSAIKQKDFDSFAALTMADSNQFHAVCLDTQPPIFYLNDVSRSIIAVIEELNRASKAEGD 309

Query: 293 SIPIYFTLDAGPNLKLLF----THKIEETIKQFFPEITIIDPLDSPDLW 337
                +T DAGPN  +        K+   I  +FP +   DP   P  +
Sbjct: 310 GCLAAYTFDAGPNAVIYAPKRNMRKLLNLILHYFP-LPDSDPFTDPKAY 357


>gi|212528468|ref|XP_002144391.1| diphosphomevalonate decarboxylase [Penicillium marneffei ATCC
           18224]
 gi|210073789|gb|EEA27876.1| diphosphomevalonate decarboxylase [Penicillium marneffei ATCC
           18224]
          Length = 402

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/326 (31%), Positives = 166/326 (50%), Gaps = 23/326 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADCI 76
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +       ++ D +
Sbjct: 8   RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTVTTASCSPNYPAAEGDTL 67

Query: 77  ILNGQK------------ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            LNG+             +SS  +  K+         + S     + + NN PT AGLAS
Sbjct: 68  TLNGKPENINASKRTRACLSSLRALRKELEDADSSLPKLSSYPLRVVSENNFPTAAGLAS 127

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LS++AR GSGSACRS   G+  W  GT ++G DS A
Sbjct: 128 SAAGFAALVRAIADLYELPQSPTDLSKIARQGSGSACRSLQGGYVAWRAGTKEDGSDSVA 187

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQA 241
             +   + WP++R  +L +   +K + S   M+ T H SP F    + I    +  +++A
Sbjct: 188 EEIAPASHWPEMRALILVVSAEKKDVPSTTGMQTTVHTSPLFATRAEHIVPKRMIGMEEA 247

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFT 299
           I  +DF    ++  +++   HA  + + PP+ Y    +   +  V D  + +  +   +T
Sbjct: 248 ITKRDFAAFADLTMRDSNNFHACCLDSEPPIFYLNDVSRAAIRLVNDINRVAGKVVAAYT 307

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEI 325
            DAGPN  + +  +  E +   F  I
Sbjct: 308 FDAGPNAVIYYLDEASELVGGTFKAI 333


>gi|241947931|ref|XP_002416688.1| diphosphomevalonate decarboxylase, putative; mevalonate
           pyrophosphate decarboxylase, putative;
           mevalonate-5-diphosphate decarboxylase, putative
           [Candida dubliniensis CD36]
 gi|223640026|emb|CAX44270.1| diphosphomevalonate decarboxylase, putative [Candida dubliniensis
           CD36]
          Length = 367

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/314 (34%), Positives = 163/314 (51%), Gaps = 23/314 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +   S + D + LNG
Sbjct: 4   ASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASPSFEKDQLWLNG 63

Query: 81  QKISSQSSFFKKTTQFC--DLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           +      S     TQ C  DL             + S++   I + NN PT AGLASSA+
Sbjct: 64  K----LESLDTPRTQACLADLRNLRASIETPDSPKLSQMKLHIVSENNFPTAAGLASSAA 119

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV  
Sbjct: 120 GFAALVTAIAKLYQLPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTSNDGEDSKAVEI 179

Query: 188 N--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIID 244
              + WP L+  +L + D +K   S   M+ T   S  F  + +Q +      +K AI+ 
Sbjct: 180 APLDHWPTLKAVILVVSDDKKDTPSTTGMQATVESSDLFAHRISQVVPRRFDQMKSAILA 239

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF K  E+  K++   HA  + + PP+ Y    + Q ++   +  +  +   +T DAGP
Sbjct: 240 KDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKQIIKLAEEINRDGVICAYTFDAGP 299

Query: 305 NLKLLFTHKIEETI 318
           N  + +    ++ +
Sbjct: 300 NAVIYYDESNQDKV 313


>gi|325956902|ref|YP_004292314.1| diphosphomevalonate decarboxylase [Lactobacillus acidophilus 30SC]
 gi|325333467|gb|ADZ07375.1| diphosphomevalonate decarboxylase [Lactobacillus acidophilus 30SC]
          Length = 321

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 173/301 (57%), Gaps = 13/301 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S  +S 
Sbjct: 9   TNIALIKYWGKKDAILRIPLMSSLSMTLDAFYTDTSIEK-GTDTNEFYLNDKKQSLANS- 66

Query: 90  FKKTTQFCDLFRQ---FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
            ++   + +  +Q     K   +I+++N++PT AGLASS+S FAAL  A    Y I    
Sbjct: 67  -QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYHIDTDK 125

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIIDR 204
             LSR+AR+GSGSA RS + GF  W  G       ++A+   ++ P  DL +  +++  +
Sbjct: 126 TLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYAL---DEHPKIDLHLLAIELNTK 182

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+     SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +MHA 
Sbjct: 183 QKKISSTRGMK-DAQSSPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEMHAI 241

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT-HKIEETIKQFFP 323
            + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L     I+E I+ F  
Sbjct: 242 NLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIENFES 301

Query: 324 E 324
           E
Sbjct: 302 E 302


>gi|295693038|ref|YP_003601648.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus ST1]
 gi|295031144|emb|CBL50623.1| Diphosphomevalonate decarboxylase [Lactobacillus crispatus ST1]
          Length = 320

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 168/299 (56%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS-- 87
           +NIAL KYWGK D KL LPL +SLS++L    T T +   D +    + N Q+ ++ S  
Sbjct: 9   TNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGENQFFLNNQQQTAAASQR 68

Query: 88  --SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             ++ KK        R       ++++ N++PT AGLASS+S FAAL  A  + Y I   
Sbjct: 69  VFAYLKKLQA-----RFHVTGNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQCYDINID 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIID 203
            E LSR+AR+GSGSA RS Y GF  W  G       ++A+   ++ P  DL +  +++  
Sbjct: 124 LEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYAL---DETPTMDLHLLAVELNT 180

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++KKI S   M+     SPFF  W ++  ++L  + +AI   DF  LG++AE NA +MHA
Sbjct: 181 KQKKISSTYGMK-DAQSSPFFRPWLERNDSELNEMIKAIKSNDFTALGQLAELNANEMHA 239

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 240 INLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298


>gi|169773789|ref|XP_001821363.1| diphosphomevalonate decarboxylase [Aspergillus oryzae RIB40]
 gi|83769224|dbj|BAE59361.1| unnamed protein product [Aspergillus oryzae]
          Length = 404

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/320 (35%), Positives = 165/320 (51%), Gaps = 27/320 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS----DADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L      T  T   S     AD +IL
Sbjct: 11  RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSAKYPTADELIL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 71  NGKPQDIQSS--KRTLACLSNLRSLRQELEAADSSLPRLSTLPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G   +G DS A
Sbjct: 129 SAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGNLADGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F    + +  + +A I+ A
Sbjct: 189 EEVAPESHWPEMRALILVVSAEKKDVPSTEGMQTTVATSNLFATRAESVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 249 IQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAVGRTVCAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETI 318
           T DAGPN  + +  K  E +
Sbjct: 308 TFDAGPNAVIYYLEKDSELV 327


>gi|115398169|ref|XP_001214676.1| hypothetical protein ATEG_05498 [Aspergillus terreus NIH2624]
 gi|114192867|gb|EAU34567.1| hypothetical protein ATEG_05498 [Aspergillus terreus NIH2624]
          Length = 401

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 165/315 (52%), Gaps = 27/315 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           +++   P NIA+ KYWGKRD  LNLP N+SLS++L    L T+T  +        D +IL
Sbjct: 8   RATTTAPVNIAVIKYWGKRDPSLNLPTNSSLSVTLSQRSLRTLTTASCAAQYPSQDELIL 67

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 68  NGKPQEIQSS--KRTLACLSNLRALRKALEDANPSLPKLSTLPLRIVSENNFPTAAGLAS 125

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+  +G DS A
Sbjct: 126 SAAGFAALVRAVADLYQLPDSPRDLSRIARQGSGSACRSLMGGYVAWRAGSLDDGSDSLA 185

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F T+ T  +   +A I+ A
Sbjct: 186 EEVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSNLFATRATSVVPERMAAIETA 245

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 246 IQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAAGRTVAAY- 304

Query: 299 TLDAGPNLKLLFTHK 313
           T DAGPN  + +  K
Sbjct: 305 TFDAGPNAVIYYLEK 319


>gi|323127095|gb|ADX24392.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 314

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 171/313 (54%), Gaps = 18/313 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +   A  D   +NG       
Sbjct: 12  ANIAIIKYWGKEDQSKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYING--CLQDD 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  KEHAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGSA RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ALAQKAKFASGSASRSFFGPVAAW----DKDSGDIYKVD-----TDLKMAMIMLVLNDAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MHAT 
Sbjct: 181 KPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE- 324
             A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F + 
Sbjct: 241 KTANPSFSYLTDESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARFEKD 300

Query: 325 --ITIIDPLDSPD 335
             I +    D PD
Sbjct: 301 YRIIVSKTKDLPD 313


>gi|312865317|ref|ZP_07725545.1| diphosphomevalonate decarboxylase [Streptococcus downei F0415]
 gi|311099428|gb|EFQ57644.1| diphosphomevalonate decarboxylase [Streptococcus downei F0415]
          Length = 314

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 164/293 (55%), Gaps = 11/293 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ +  +A  D   ++G   S Q 
Sbjct: 12  ANIAIVKYWGKADAKKMIPATSSISLTLENMYTKTDLSFLPEEARGDEFYIDGVLQSPQE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K T   D FR+  + +  IETSNN+PT AGL+SS+SG +AL  A  +++      +
Sbjct: 72  HV--KMTTIIDFFRKEGQPFVKIETSNNMPTAAGLSSSSSGLSALVKACNQLFDFGLNQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L++ A+  SGS+ RSF+     W    D++  + + V  +    DL + +L + D+ K 
Sbjct: 130 ELTQYAKFASGSSARSFFGPLSAW----DKDSGEIYQVKTD---LDLAMIMLVLNDQPKT 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M+     S  F  W +Q   D   +   +   DF K+G++AE+NAL+MHAT  +
Sbjct: 183 ISSREGMKRCAETSSDFQDWVEQSVFDYKAMLGYLAANDFAKVGQLAEENALRMHATTRS 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           A PP  Y  +E+ Q M+ V    +Q    YFT+DAGPN+K+L   K  E + Q
Sbjct: 243 AHPPFSYLTEESYQAMDFVRSLHEQGYDCYFTMDAGPNVKVLCQTKDLEKLAQ 295


>gi|50311049|ref|XP_455548.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644684|emb|CAG98256.1| KLLA0F10285p [Kluyveromyces lactis]
          Length = 397

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/324 (34%), Positives = 171/324 (52%), Gaps = 31/324 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  T   D   D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDKVLNLPTNSSISVTLSQEDLRTLTTATTSPDFAKDQLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQ--------------FSKVYFLIETSNNIPTKAGLAS 124
           +    + S   + TQ C  DL RQ              FS+    I + NN PT AGLAS
Sbjct: 66  K----EESLASERTQHCLQDL-RQLRRELEEKDSSLPTFSQWKLHIASENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALIKAIAKLYELPQSESELSKIARKGSGSACRSLFGGYVAWEMGKLEDGSDSKA 180

Query: 185 VPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQA 241
           V     N WP+++  +L +   +K   S   M++T   S  F +     +      +K++
Sbjct: 181 VEIGSLNHWPEMKAAILVVSADKKDTPSTSGMQLTVKTSDLFQERINNVVPKRFEQMKKS 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    E+  K++   HAT + + PP+ Y     K+ I+    + +   +++ + +
Sbjct: 241 ILEKDFPTFAELTMKDSNSFHATCLDSYPPIFYLNDTSKKVIKLCHAINEFYNETV-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQFF 322
           T DAGPN  L +  + E+ +  F 
Sbjct: 300 TFDAGPNAVLYYLEQSEDKLFAFL 323


>gi|50285813|ref|XP_445335.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524639|emb|CAG58241.1| unnamed protein product [Candida glabrata]
          Length = 396

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 173/322 (53%), Gaps = 29/322 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  +   D + LNG
Sbjct: 5   ASTTAPVNIATLKYWGKRDAKLNLPTNSSISVTLAQEDLRTLTSAATSSEFKEDKLWLNG 64

Query: 81  QKISSQSSFFKKTTQFC-----DLFRQF----------SKVYFLIETSNNIPTKAGLASS 125
           +    + S   + TQ C      L RQ           S+    I + NN PT AGLASS
Sbjct: 65  K----EESLSSERTQNCLADLRALRRQLEEKDSSLPPMSQWKLHIVSENNFPTAAGLASS 120

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL +A+ ++Y +P+ +  +S++AR GSGSACRS + G+  W  G   +G DS AV
Sbjct: 121 AAGFAALVMAIAKLYELPQSASDISKIARKGSGSACRSLFGGYVAWEMGEKADGSDSKAV 180

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAI 242
                  WP+++  +L +   +K   S   M++T + S  F +  T  +      +K+AI
Sbjct: 181 EVAPLEHWPNMKAAVLVVSADKKDTPSTSGMQLTVNTSDLFKERITNVVPKRFEAMKKAI 240

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFT 299
           +D+DF    E+  K++   HAT + + PP+ Y     K+ I+    + +   ++I + +T
Sbjct: 241 LDKDFPTFAELTMKDSNSFHATCLDSFPPIFYINDTSKKIIKLCHLINEFYGETI-VAYT 299

Query: 300 LDAGPNLKLLFTHKIEETIKQF 321
            DAGPN  L +  + EE +  F
Sbjct: 300 YDAGPNSVLYYLEENEEKLFAF 321


>gi|225868463|ref|YP_002744411.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701739|emb|CAW99107.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 314

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 163/304 (53%), Gaps = 16/304 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ + + A  D   +NG  +   +
Sbjct: 12  ANIAIVKYWGKKDEAKMIPSTSSISLTLEGMYTTTSLSFLPASAKGDQFYING--VLQDA 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +++      E
Sbjct: 70  KEHAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQLFQAKLSQE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGSA RSF+     W    D++    + V       DL++ ++ ++  D  
Sbjct: 130 ELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVK-----TDLKLAMIMLVLNDAR 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NAL MHAT 
Sbjct: 181 KPISSREGMKRCSTTSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQFFPE 324
             ASP   Y  + + Q M RV + RQ+  P YFT+DAGPN+K+L     +E   + F  E
Sbjct: 241 KTASPSFSYLTEASYQAMLRVKELRQKGYPCYFTMDAGPNVKVLCLEEDLERLSRLFEKE 300

Query: 325 ITII 328
             II
Sbjct: 301 YRII 304


>gi|311115036|ref|YP_003986257.1| putative diphosphomevalonate decarboxylase [Gardnerella vaginalis
           ATCC 14019]
 gi|310946530|gb|ADP39234.1| possible diphosphomevalonate decarboxylase [Gardnerella vaginalis
           ATCC 14019]
          Length = 379

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 155/287 (54%), Gaps = 12/287 (4%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISS---QS 87
           IAL KYWGKRD  L LP  +SLSL+L    T T +   D  +AD I LNG   +    QS
Sbjct: 38  IALIKYWGKRDETLILPYTSSLSLTLDGFSTTTKVRFDDCLEADSICLNGVNFTGDLLQS 97

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           S   +  +  D+ R+ +  K    + + N +PT AGLASSASGFAAL  A      +   
Sbjct: 98  SERARIVKMLDIVRKIAGIKSKAQVVSVNTVPTAAGLASSASGFAALASAASYAAGLNLS 157

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--D 203
             +LS +AR GSGSACRS Y G   W  GT      S+A P      +L++ ++ +I   
Sbjct: 158 PRNLSILARKGSGSACRSIYGGLVLWNAGTSDE--TSYAEPIETP-EELQLAMVTVILNS 214

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
            +KKI SREAM  T   SP +  W +    DL     AI + D   LGEV+E+NAL MH 
Sbjct: 215 SKKKISSREAMRRTVETSPIYADWIKNCKKDLNTALSAIKNCDIQALGEVSERNALGMHD 274

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLL 309
            M AA+  + Y   ET   +  V   R +S  P++ T+DAGPN+K+L
Sbjct: 275 AMRAAAESVNYLTDETHVVLNVVRKMRDESGFPVWATMDAGPNVKVL 321


>gi|328790375|ref|XP_001121619.2| PREDICTED: diphosphomevalonate decarboxylase-like [Apis mellifera]
          Length = 386

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 164/314 (52%), Gaps = 26/314 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +   P NIA+ KYWGKRD  L LP N+S+S +L   HL   T + +  +   D I LNG+
Sbjct: 5   TCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLNGR 64

Query: 82  -------KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
                  ++ +  +  KK     +   Q+ K++  I + NN PT AGLASSA+G+A L +
Sbjct: 65  EEDIMNIRLQNCLTEIKKRAGDSNHMDQW-KIH--ICSENNFPTSAGLASSAAGYACLVI 121

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA---VPFNNQW 191
           AL ++Y   E    ++ +AR+GSGSACRS   GF  W  G+  +G DS A   VP  + W
Sbjct: 122 ALAKLY---EVKGDITAIARVGSGSACRSILGGFVRWYMGSQTDGTDSIAKQIVP-ASYW 177

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKL 250
           P++RI +L + + +K + S   M+     S F     + I  D +  I+QAI+ +DF   
Sbjct: 178 PEMRILILVVNEAKKNVSSAIGMKRGMETSDFLNFRVKHIVPDRVKSIEQAILQKDFKTF 237

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKL 308
            E   K++ +MHA  +   PP +Y       I  +   ++   + + + +T DAGPN  L
Sbjct: 238 AEHTMKDSNQMHAACLDTYPPCVYMNDISHAIVDLIHAYNETVKEVKVAYTFDAGPNATL 297

Query: 309 LFTHKIEETIKQFF 322
                +EE + +F 
Sbjct: 298 YL---LEENVTEFL 308


>gi|255710979|ref|XP_002551773.1| KLTH0A07238p [Lachancea thermotolerans]
 gi|238933150|emb|CAR21331.1| KLTH0A07238p [Lachancea thermotolerans]
          Length = 397

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 166/321 (51%), Gaps = 27/321 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +   +S   D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDLRTLTSVATSESFTEDQLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DL-------------FRQFSKVYFLIETSNNIPTKAGLASS 125
           Q  S Q     + TQ C  DL               + S+    I + NN PT AGLASS
Sbjct: 66  QPESLQG----ERTQHCLQDLRNLRSRIEAQDSSLPRMSQWKLHIVSENNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G++ +G DS AV
Sbjct: 122 AAGFAALVMAIAKLYQLPDSHSEISKIARKGSGSACRSLFGGYVAWEMGSEPDGSDSKAV 181

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
               Q  WP+++  +L +    K   S   M+ T   S  F +  +  +      +KQAI
Sbjct: 182 EVAPQSHWPEMKAAILVVSADRKDTPSTSGMQHTVATSDLFQERIRNVVPKRFEEMKQAI 241

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
            D+DF +  E+  +++   HAT + + PP+ Y    +  I  +    +A      + +T 
Sbjct: 242 QDRDFTRFAELTMRDSNSFHATCLDSFPPIFYMNDTSRKIVKLCHQINAFYDETIVAYTF 301

Query: 301 DAGPNLKLLFTHKIEETIKQF 321
           DAGPN  L +  + E  +  F
Sbjct: 302 DAGPNAVLYYLQENEAKLMAF 322


>gi|308235868|ref|ZP_07666605.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis ATCC
           14018]
          Length = 379

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 155/287 (54%), Gaps = 12/287 (4%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISS---QS 87
           IAL KYWGKRD  L LP  +SLSL+L    T T +   D  +AD I LNG   +    QS
Sbjct: 38  IALIKYWGKRDETLILPYTSSLSLTLDGFSTTTKVRFDDCLEADSICLNGVNFTGDLLQS 97

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           S   +  +  D+ R+ +  K    + + N +PT AGLASSASGFAAL  A      +   
Sbjct: 98  SERARIVKMLDIVRKIAGIKSKAQVVSVNTVPTAAGLASSASGFAALASAASYAAGLNLS 157

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--D 203
             +LS +AR GSGSACRS Y G   W  GT      S+A P      +L++ ++ +I   
Sbjct: 158 PRNLSILARKGSGSACRSIYGGLVLWNAGTSDE--TSYAEPIETP-EELQLAMVTVILNS 214

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
            +KKI SREAM  T   SP +  W +    DL     AI + D   LGEV+E+NAL MH 
Sbjct: 215 SKKKISSREAMRRTVETSPIYADWIKNCKKDLNTALSAIKNCDIQALGEVSERNALGMHD 274

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLL 309
            M AA+  + Y   ET   +  V   R +S  P++ T+DAGPN+K+L
Sbjct: 275 AMRAAAESVNYLTDETHVVLNVVRKMRDESGFPVWSTMDAGPNVKVL 321


>gi|321472661|gb|EFX83630.1| hypothetical protein DAPPUDRAFT_301631 [Daphnia pulex]
          Length = 378

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 157/308 (50%), Gaps = 20/308 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITV-IDSDADCIILNG 80
           S+   P NIA+ KYWGK D +  +PLN+S+S++L   ++ T T  T+  +   D I+LN 
Sbjct: 8   STCIAPINIAVIKYWGKSDEEQIIPLNDSISITLDTDYMFTKTTATIGPEFTQDSIVLNN 67

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVYFLIETS---------NNIPTKAGLASSASGFAA 131
           ++ S     F+            SK    +E S         NN PTKAGLASSASG+A 
Sbjct: 68  EQGSGDGVRFQNCLSEIRKLAASSKHSSTVEKSTWKVAIVSENNFPTKAGLASSASGYAC 127

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
           L   L ++Y +      LS +AR GSGSACRS + GF  W    D     +  +     W
Sbjct: 128 LVFTLAQLYELESHQSELSALARRGSGSACRSLFGGFVRWF--HDSQPCIARPIAEAEHW 185

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKL 250
           P+LR  +  + +  K +GS E M  +   S       + +  D +  +K AI++++F+K 
Sbjct: 186 PELRCLVAVVSNTSKSVGSTEGMRRSAETSKLLEHRVKHVVRDRIEDMKMAILEKNFVKF 245

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNLK 307
            E+  +++ + HA  +   PPL Y    +   IQ + R ++  ++SI + +T DAGPN  
Sbjct: 246 AEITMRDSNQFHAICLDTYPPLFYMNSTSQAIIQLVHR-YNQIRRSIKVAYTFDAGPN-A 303

Query: 308 LLFTHKIE 315
           +LF  + E
Sbjct: 304 VLFLEQAE 311


>gi|329116900|ref|ZP_08245617.1| diphosphomevalonate decarboxylase [Streptococcus parauberis NCFD
           2020]
 gi|326907305|gb|EGE54219.1| diphosphomevalonate decarboxylase [Streptococcus parauberis NCFD
           2020]
          Length = 311

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 172/307 (56%), Gaps = 19/307 (6%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCII 77
           +N KS A    NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++   +++ AD   
Sbjct: 6   VNVKSYA----NIAIIKYWGKDDAQKMIPTTSSISLTLENMYTETSLSFLPVEAQADQFY 61

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
           ++GQ + +Q+    K T   D FRQ ++ Y  ++T NN+PT AGL+SS+SG +AL  A  
Sbjct: 62  IDGQ-LQNQAEH-AKVTAIIDQFRQENQPYVKVDTENNMPTAAGLSSSSSGLSALVKACN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
            ++      + L+  A+  SGSA RSF+     W    D+   + + V       DL++G
Sbjct: 120 ELFETDLSQKELALKAKFASGSASRSFFGPLAAW----DRESGEIYPVE-----TDLKLG 170

Query: 198 LLKII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           ++ ++  D  K + SRE M++ R  S  F +W  + + D   +   +   DF K+G++ E
Sbjct: 171 MIMLVINDARKPVSSREGMKLCRETSTTFDKWRTESAQDYKDMLAYLKANDFEKVGQLTE 230

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           KNAL MHAT  +++P   Y  + + + M++V + RQ     YFT+DAGPN+K+L   K  
Sbjct: 231 KNALAMHATTKSSTPSFSYLIEGSYKAMDKVKELRQAGFQCYFTMDAGPNVKVLCLEKDL 290

Query: 316 ETIKQFF 322
           E +   F
Sbjct: 291 EQLASIF 297


>gi|225680212|gb|EEH18496.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb03]
          Length = 405

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/330 (35%), Positives = 168/330 (50%), Gaps = 31/330 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDA-DCI 76
           ++S   P NIA+ KYWGKRD+ LNLP N+SLS++L       + T        +DA D +
Sbjct: 9   RASVTAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPTDAGDTL 68

Query: 77  ILNGQKISSQSSFFKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAG 121
            LN +  S Q S   K T  C  DL   RQ            S     I + NN PT AG
Sbjct: 69  TLNSEPHSIQDS---KRTLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAG 125

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+D
Sbjct: 126 LASSAAGFAALVCAIANLYKLPQSPRELSRIARQGSGSACRSMMGGYVAWRAGVLEDGID 185

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHI 238
           S A  V   + WPD+R  +L + D +K++ S + M+ T   S  F T+    +   +  I
Sbjct: 186 SLAEEVAPASHWPDMRALILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARITAI 245

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSIP 295
           + AI ++DF    E+  +++   HAT +   PP  Y    +   +  V D  +   ++I 
Sbjct: 246 EAAIQNRDFPSFAEITMRDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETIC 305

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  K  E +   F  I
Sbjct: 306 AY-TFDAGPNAVIYYLKKESERVIGTFKSI 334


>gi|255730117|ref|XP_002549983.1| diphosphomevalonate decarboxylase [Candida tropicalis MYA-3404]
 gi|240131940|gb|EER31498.1| diphosphomevalonate decarboxylase [Candida tropicalis MYA-3404]
          Length = 370

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 166/316 (52%), Gaps = 25/316 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T     ++ + D + LNG
Sbjct: 4   ASVTAPVNIATLKYWGKRDKNLNLPTNSSISVTLSQDDLRTLTTAAADETFEKDQLWLNG 63

Query: 81  QKISSQSSFFKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           +      S     TQ C  DL   RQ            S++   I + NN PT AGLASS
Sbjct: 64  K----LESLDTPRTQACLADLRQLRQNVESTNSSLPKLSQMKLHIVSENNFPTAAGLASS 119

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL  A+ +++ +P+    LS++AR GSGSACRS + GF  W  G   +G DS AV
Sbjct: 120 AAGFAALITAIAKLFELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGQAADGEDSKAV 179

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAI 242
                + WP +R  +L + D +K   S   M+ T   S  F  + T+ +      +K++I
Sbjct: 180 EVAPLDHWPSMRAVILVVSDDKKDTPSTTGMQATVQTSDLFAHRITEVVPKRFEEMKKSI 239

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA 302
           +++DF K  E+  K++   HA  + + PP+ Y    + + ++ V    ++S    +T DA
Sbjct: 240 VEKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKRIIKLVEGINKESTIAAYTFDA 299

Query: 303 GPNLKLLFTHKIEETI 318
           GPN  + +    E+ +
Sbjct: 300 GPNAVIYYDAANEDKV 315


>gi|332638892|ref|ZP_08417755.1| diphosphomevalonate decarboxylase [Weissella cibaria KACC 11862]
          Length = 328

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 115/312 (36%), Positives = 169/312 (54%), Gaps = 24/312 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI----TVIDSDADCIILNGQKISS 85
           +NIAL KYWGK D+ L LP   S+SL+L    T T +     +I   AD + L+ + ++ 
Sbjct: 10  TNIALLKYWGKADTTLMLPTTTSISLTLDEFYTDTTVWFDAALI---ADDVTLDDEVMTG 66

Query: 86  QSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +   + K T+F DL R+ +    Y  + ++N++PT AGLASSAS FAAL  A  R   + 
Sbjct: 67  KG--YDKVTRFLDLVREMAGETRYAHVHSANHVPTAAGLASSASAFAALAGAASRAAGLA 124

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKI 201
                LSR+AR GSGSA RS + GF +W  G D   + S A P      WP   I LL +
Sbjct: 125 LSPAELSRLARRGSGSASRSIFGGFAQWDRGHDD--LTSVAKPLVETIDWP---IQLLTV 179

Query: 202 I--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           I  D+ KKI SR  M+  +  SPF+  W  + +  +  ++ A+ + D  ++G++AE NAL
Sbjct: 180 IINDQPKKIDSRGGMQHAKATSPFYDDWVNRSNALVPVMQTAVANHDIDQIGQLAEANAL 239

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIE 315
           +MHAT   A P   Y    + Q +      R+Q I +Y T+DAGPN+KL+     T  I 
Sbjct: 240 QMHATNATAQPAFNYLTDSSWQVINLATTLREQGISVYATMDAGPNVKLISRPADTEVIT 299

Query: 316 ETIKQFFPEITI 327
             + +  P + +
Sbjct: 300 AALAEAIPGVVV 311


>gi|256843264|ref|ZP_05548752.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           125-2-CHN]
 gi|256614684|gb|EEU19885.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           125-2-CHN]
          Length = 320

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 113/299 (37%), Positives = 170/299 (56%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS-- 87
           +NIAL KYWGK D KL LPL +SLS++L    T T +   D +    + N Q+ ++ S  
Sbjct: 9   TNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGENQFFLNNQQQTAAASQR 68

Query: 88  --SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             ++ KK        R       ++++ N++PT AGLASS+S FAALT A  + Y I   
Sbjct: 69  VFAYLKKLQA-----RFHVTGNLIVKSVNHVPTSAGLASSSSAFAALTAAFCQCYDINID 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP--DLRIGLLKIID 203
            E LSR+AR+GSGSA RS Y GF  W  G       ++A+   ++ P  DL +  +++  
Sbjct: 124 LEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYAL---DETPTMDLHLLAVELNT 180

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++KKI S   M+     SPFF  W ++ +++L  + +AI   DF  LG++AE NA +MHA
Sbjct: 181 KQKKISSTYGMK-DAQSSPFFRPWLERNNSELNEMIKAIKSNDFTALGQLAELNANEMHA 239

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 240 INLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298


>gi|157150129|ref|YP_001449559.1| diphosphomevalonate decarboxylase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157074923|gb|ABV09606.1| diphosphomevalonate decarboxylase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 315

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    ++E
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|332364384|gb|EGJ42158.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK355]
          Length = 315

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    ++E
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|242766378|ref|XP_002341158.1| diphosphomevalonate decarboxylase [Talaromyces stipitatus ATCC
           10500]
 gi|218724354|gb|EED23771.1| diphosphomevalonate decarboxylase [Talaromyces stipitatus ATCC
           10500]
          Length = 404

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 168/327 (51%), Gaps = 25/327 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADCI 76
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +       ++ D +
Sbjct: 8   RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTVTTASCSPNYPATEGDTL 67

Query: 77  ILNGQKISSQSS-----------FFKKTTQFCD-LFRQFSKVYFLIETSNNIPTKAGLAS 124
            LNG+  + Q+S             +K  +  D    + S     + + NN PT AGLAS
Sbjct: 68  TLNGKPENIQASKRTLACLSSLRALRKELESADPSLPKLSSYPLRVVSENNFPTAAGLAS 127

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS A
Sbjct: 128 SAAGFAALVRAIADLYELPQSPTELSRIARQGSGSACRSLQGGYVAWRAGVKEDGSDSLA 187

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQA 241
             +   + WP++R  +L +   +K + S   M+ T   SP F    + I    +  +++A
Sbjct: 188 EEIAPASHWPEMRALILVVSAEKKDVPSTTGMQTTVSTSPLFATRAEHIVPRRMTGMEEA 247

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSIPIYF 298
           I  +DF    ++  +++   HA  + + PP+ Y    +   +  V D  +   +++  Y 
Sbjct: 248 ITKRDFAAFADLTMRDSNNFHAVCLDSEPPIFYLNDVSRAAIRLVNDINRLAGKTVAAY- 306

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEI 325
           T DAGPN  + +  ++ E +   F  I
Sbjct: 307 TFDAGPNAVIYYLDEVSELVGGTFKTI 333


>gi|251782245|ref|YP_002996547.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242390874|dbj|BAH81333.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
          Length = 314

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 170/313 (54%), Gaps = 18/313 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +   A  D   +NG       
Sbjct: 12  ANIAIIKYWGKEDQSKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYING--CLQDD 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  KEHAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGSA RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ALAQKAKFASGSASRSFFGPVAAW----DKDSGDIYKVD-----TDLKMAMIMLVLNDAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MH T 
Sbjct: 181 KPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMHTTT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE- 324
             A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F + 
Sbjct: 241 KTANPSFSYLTDESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARFEKD 300

Query: 325 --ITIIDPLDSPD 335
             I +    D PD
Sbjct: 301 YRIIVSKTKDLPD 313


>gi|125623293|ref|YP_001031776.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124492101|emb|CAL97030.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300070044|gb|ADJ59444.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 318

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 173/305 (56%), Gaps = 18/305 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN     S    
Sbjct: 11  TNIALIKYWGKTDIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSAMEDSS--- 67

Query: 90  FKKTTQFCDLFR----QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             + ++F ++ R     F KV  +I++ N++PT AGLASSAS FAALT A+F +  + + 
Sbjct: 68  --RVSKFLEMMRGQYGNFPKV--MIQSENHVPTAAGLASSASSFAALTAAMFGLLDLEKD 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
              +SR+AR GSGSA RS +  F  W  G  +N   SFA  F N+   L + + +I   +
Sbjct: 124 DSEMSRIARRGSGSASRSIFGNFAVWNKG--ENHQSSFAESFYNKDIGLSMIVAEISSEK 181

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KK+ S + M++ +  +P +  W ++ +  LA +KQAI+  D  K+G +A+ NAL MH   
Sbjct: 182 KKMSSTKGMQLAQ-TAPTYGAWVEKSAIQLAEMKQAILQADIEKVGLIAQDNALGMHEQN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----TIKQF 321
                P  Y+  ET + ++   +  +  +  + T+DAGPN+K++  H  E+     +K  
Sbjct: 241 RLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNVKIITDHATEKILLTKLKAE 300

Query: 322 FPEIT 326
           FPE+T
Sbjct: 301 FPELT 305


>gi|116511265|ref|YP_808481.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116106919|gb|ABJ72059.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 318

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 173/305 (56%), Gaps = 18/305 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN     S    
Sbjct: 11  TNIALIKYWGKTDIALNIPATSSLSMTLEPFYTTTSVEFTDNESDSLILNSAMEDSS--- 67

Query: 90  FKKTTQFCDLFR----QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             + ++F ++ R     F KV  +I++ N++PT AGLASSAS FAALT A+F +  + + 
Sbjct: 68  --RVSKFLEMMRGQYGNFPKV--MIQSENHVPTAAGLASSASSFAALTAAMFGLLDLEKD 123

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
              +SR+AR GSGSA RS +  F  W  G  +N   SFA  F N+   L + + +I   +
Sbjct: 124 DSEMSRIARRGSGSASRSIFGNFAVWNKG--ENHQSSFAESFYNKDIGLSMIVAEISSEK 181

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KK+ S + M++ +  +P +  W ++ +  LA +KQAI+  D  K+G +A+ NAL MH   
Sbjct: 182 KKMSSTKGMQLAQ-TAPTYGAWVEKSAIQLAEMKQAILQADIEKVGLIAQDNALGMHEQN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----TIKQF 321
                P  Y+  ET + ++   +  +  +  + T+DAGPN+K++  H  E+     +K  
Sbjct: 241 RLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNVKIITDHATEKILLTKLKAE 300

Query: 322 FPEIT 326
           FPE+T
Sbjct: 301 FPELT 305


>gi|302680056|ref|XP_003029710.1| hypothetical protein SCHCODRAFT_69496 [Schizophyllum commune H4-8]
 gi|300103400|gb|EFI94807.1| hypothetical protein SCHCODRAFT_69496 [Schizophyllum commune H4-8]
          Length = 404

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 155/331 (46%), Gaps = 29/331 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILN 79
           +++A  P NIA  KYWGKRD+KL LP N+SLS++L       T T       + D + LN
Sbjct: 5   QATASAPVNIACIKYWGKRDTKLILPTNSSLSVTLDQDYLKSTTTSRADPSFEKDQLWLN 64

Query: 80  G--QKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           G   +I   S       +   L +           + S  +  I + NN PT AGLASSA
Sbjct: 65  GTEDEIKPGSRLETCIKEMKRLRKVEVEDKDPSAPKLSTYHVRIASYNNFPTAAGLASSA 124

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           SGFAAL  +L  +Y +P    +LS +AR GSGSACRS Y GF  W  GT  +G DS A+ 
Sbjct: 125 SGFAALVSSLAALYKLPVSPSTLSLIARQGSGSACRSLYGGFVAWEQGTKADGSDSLAIQ 184

Query: 187 F--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
               + WP L   +  + D +K   S   M+ T   SP      + +    +A I  AI 
Sbjct: 185 IAPESHWPTLHAVVCVVNDAKKGTSSTAGMQRTVETSPLLQHRIKHVVPQRMAEISDAIR 244

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET------IQGMERVWDARQQSIPIY 297
            +DF     +  +++ + HA  +   PP+ Y    +      I    RV   +       
Sbjct: 245 ARDFDAFARITMQDSNQFHAVALDTDPPIFYMNDVSKAIVALIVEYNRVAIEKTGKRKAA 304

Query: 298 FTLDAGPNLKLLFTH----KIEETIKQFFPE 324
           +T DAGPN  +        +I + I Q+FP+
Sbjct: 305 YTYDAGPNAVIYVEQENVKEIVDLILQYFPD 335


>gi|325688647|gb|EGD30664.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK72]
          Length = 315

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAKKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLLLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|51598941|ref|YP_073129.1| mevalonate pyrophosphate decarboxylase [Borrelia garinii PBi]
 gi|51573512|gb|AAU07537.1| mevalonate pyrophosphate decarboxylase [Borrelia garinii PBi]
          Length = 312

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 169/314 (53%), Gaps = 32/314 (10%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS 87
           + +++AL KYWGK+D+ LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+
Sbjct: 7   VNASLALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELEL--SDQDEIILNSKPVVFQN 64

Query: 88  SFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALT---LALFRIYS 141
               +   F D  RQ      V F I++ NN PT AGLASS+SGFA++    L  F  YS
Sbjct: 65  ----REKVFFDYARQILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFNKYS 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                 S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I
Sbjct: 121 F----NSASNLARVGSASAARAVYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAII 172

Query: 202 IDREKKIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
              EK++ SR AM I +HH  ++  W   +++I  D  +     + +DFI+ G    K+ 
Sbjct: 173 DSNEKELSSRVAMNICKHHEFYYDAWIASSKKIFKDALYF---FLKKDFIRFGATVVKSY 229

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----I 314
             M A M A+S  + Y++  TI  ++   + R + I ++ T+DAGP +K L   +    I
Sbjct: 230 QNMFALMFASS--IFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFLCLEENLNTI 287

Query: 315 EETIKQFFPEITII 328
            + +KQ F +I  I
Sbjct: 288 LKRLKQNFTDINFI 301


>gi|324992168|gb|EGC24090.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK405]
 gi|327459484|gb|EGF05830.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1]
 gi|327472892|gb|EGF18319.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK408]
 gi|327490683|gb|EGF22464.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1058]
          Length = 315

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 160/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTKTQLSPLPDTATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    ++E
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWITQSALDYQAMLGYLRDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y   E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTDESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|126139005|ref|XP_001386025.1| hypothetical protein PICST_90752 [Scheffersomyces stipitis CBS
           6054]
 gi|126093307|gb|ABN67996.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 387

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 115/311 (36%), Positives = 164/311 (52%), Gaps = 29/311 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNG 80
           +S+  P NIA  KYWGKRD+ LNLP N+S+S++L      T  T   S+A   D + LNG
Sbjct: 6   ASSTAPVNIATLKYWGKRDTLLNLPTNSSISVTLSQNDLRTLTTAAASEAFEKDQLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFR-------------QFSKVYFLIETSNNIPTKAGLASS 125
            K+ S  S     TQ C  DL R             + S+    I + NN PT AGLASS
Sbjct: 66  -KLESLDSV---RTQACLADLRRLRAEVETSDASLPKLSQFKLHIVSENNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  G  +NG DS AV
Sbjct: 122 AAGFAALVSAIAKLYKLPQNMSELSKIARKGSGSACRSLFGGFVAWEMGELENGEDSKAV 181

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAI 242
                + WP ++  +L + D +K   S   M+ T   S  F  + T+ +      +K+AI
Sbjct: 182 EVAPLSHWPTMKAAILVVSDDKKDTPSTSGMQQTVATSDLFQHRITEVVPKRFEEMKRAI 241

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFT 299
              DF   GE+  K++   HA  + + PP+ Y     K+ I+ + R+ +   + I  Y T
Sbjct: 242 AANDFETFGELTMKDSNSFHAVCLDSYPPIFYLNDTSKQIIKLVHRLNEQEGKIIAAY-T 300

Query: 300 LDAGPNLKLLF 310
            DAGPN  + +
Sbjct: 301 FDAGPNAVIYY 311


>gi|327468608|gb|EGF14087.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK330]
          Length = 315

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 162/284 (57%), Gaps = 15/284 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L+++A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++  D +
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW----DKDSGVIYPVK-----TDLKLAMIMLVLHDEK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ ME+    S  F  W  Q + D   +   + D DF+K+G++ E+NAL+MHAT 
Sbjct: 181 KPISSRDGMELCAKTSTIFPDWITQSALDYQAMLGYLRDNDFVKVGQLTEENALRMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
             A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 241 EKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|255949940|ref|XP_002565737.1| Pc22g18320 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592754|emb|CAP99120.1| Pc22g18320 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 404

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 163/319 (51%), Gaps = 25/319 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   +   AD + L
Sbjct: 11  RATTTAPVNIAVIKYWGKRDTTLNLPTNSSLSVTLSQRSLRTLTTASCSAAYPPADTLNL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           NG     QSS  K+T       R   K                  I + NN PT AGLAS
Sbjct: 71  NGSPQDIQSS--KRTMACISNLRALRKALEDADSSLPKLSAHPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+  + LSR+AR GSGSACRS   G+  W  G   +G DS A
Sbjct: 129 SAAGFAALVRAVADLYELPQSPKELSRIARQGSGSACRSLMGGYVAWRTGELADGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F +  Q +  + +A I+ A
Sbjct: 189 EEVAPASHWPEMRALVLVVSAEKKDVPSTEGMQTTVATSALFAERAQNVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFT 299
           I +++F    E+  +++   HAT + + PP+ Y    +   +  V D  +        +T
Sbjct: 249 IKNRNFHDFAEITMRDSNTFHATCLDSWPPIFYMNDVSRAAVRLVHDINRVVGRTVCAYT 308

Query: 300 LDAGPNLKLLFTHKIEETI 318
            DAGPN  + +  K  E +
Sbjct: 309 FDAGPNAVIYYEDKDSEIV 327


>gi|326479090|gb|EGE03100.1| diphosphomevalonate decarboxylase [Trichophyton equinum CBS 127.97]
          Length = 402

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 167/328 (50%), Gaps = 27/328 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS------DADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T   S      D D +
Sbjct: 11  RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSAKYPPADGDSL 70

Query: 77  ILNGQKISSQSSFFKKTTQFCDL--FRQF-----------SKVYFLIETSNNIPTKAGLA 123
            LN +  S Q S  +      DL   RQ            S     I + NN PT AGLA
Sbjct: 71  TLNNKPHSIQGSP-RTLACLADLRSLRQLIESSDPSLPKLSTYPLRIVSENNFPTAAGLA 129

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 130 SSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKEDGSDSI 189

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQ 240
           A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I  + +  I++
Sbjct: 190 AEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERMTAIEK 249

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIY 297
           +I +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+  Y
Sbjct: 250 SIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDLNRAAGRSVCAY 309

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            T DAGPN  + +  K  + +   F  I
Sbjct: 310 -TFDAGPNAVIYYLEKDADCVLGAFKSI 336


>gi|269123884|ref|YP_003306461.1| diphosphomevalonate decarboxylase [Streptobacillus moniliformis DSM
           12112]
 gi|268315210|gb|ACZ01584.1| diphosphomevalonate decarboxylase [Streptobacillus moniliformis DSM
           12112]
          Length = 295

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 165/291 (56%), Gaps = 20/291 (6%)

Query: 31  NIALCKYWGKRDSKLNL-PLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           NIA+ KYWGK++    L P+  S+S+    L T T+I+  +SD D  ILNG+      + 
Sbjct: 7   NIAIVKYWGKKEFNPYLVPIQGSISIRSKRLYTETNIS--ESDKDIFILNGEIQGENET- 63

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
            KK   F D   +  K    I++ N +PT AGLASSAS +  LT AL   + +   +E +
Sbjct: 64  -KKIFSFVDKVIKKRKC-ICIDSKNFVPTAAGLASSASAYCTLTKALNDFFKLNLNTEEM 121

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKK 207
           ++++ +GSGSA RSFY      I   D+NG             +L + +L I+  D++K+
Sbjct: 122 AKISTMGSGSAGRSFYN-----IAAFDKNG------KIYELKTELNLSMLAIVLNDKKKE 170

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SR AMEI+++ SP +  W ++ + D   +K A+++ DFIK+G + EKN + MH T   
Sbjct: 171 ISSRNAMEISKN-SPIYPMWVKRANEDFEKMKSALLENDFIKIGNIMEKNTIIMHNTTFR 229

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++P   +  KET   ++ V   R + I I+ T+DAGPN+K+L+  + EE +
Sbjct: 230 SNPSFSFLTKETYFVIKIVKRLRMKGINIFTTMDAGPNVKILYLKEDEEKV 280


>gi|195978204|ref|YP_002123448.1| diphosphomevalonate decarboxylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195974909|gb|ACG62435.1| diphosphomevalonate decarboxylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 314

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ +   A  D   +NG  +   +
Sbjct: 12  ANIAIVKYWGKKDEVKMIPSTSSISLTLEGMYTTTSLSFLPPSAKGDQFYING--VLQDA 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +++      E
Sbjct: 70  KEHAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQLFQAKLSQE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGSA RSF+     W    D++    + V       DL++ ++ ++  D  
Sbjct: 130 ELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVK-----TDLKLAMIMLVLNDAR 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NAL MHAT 
Sbjct: 181 KPISSREGMKRCSTTSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y  + + Q M RV + RQ+  P YFT+DAGPN+K+L   +  E + + F
Sbjct: 241 KTASPSFSYLTEASYQAMLRVKELRQKGYPCYFTMDAGPNVKVLCLEEDLERLSRLF 297


>gi|325693780|gb|EGD35699.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK150]
          Length = 315

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSTLDYQAMLGYLQDNDFTKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|296827024|ref|XP_002851094.1| diphosphomevalonate decarboxylase [Arthroderma otae CBS 113480]
 gi|238838648|gb|EEQ28310.1| diphosphomevalonate decarboxylase [Arthroderma otae CBS 113480]
          Length = 399

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 167/330 (50%), Gaps = 31/330 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI------DSDADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T         +D D +
Sbjct: 8   RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSARYPSADGDTL 67

Query: 77  ILNGQKISSQSSFFKKTTQFC-----DLFRQ----------FSKVYFLIETSNNIPTKAG 121
            LN +  S Q S     T  C      L RQ           S     I + NN PT AG
Sbjct: 68  TLNNKPHSIQGS---PRTLACLADLRSLRRQMESSNQSLPKLSAYPLRIVSENNFPTAAG 124

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++G D
Sbjct: 125 LASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKEDGSD 184

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHI 238
           S A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I  + +  I
Sbjct: 185 SIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERMTAI 244

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIP 295
           +++I +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+ 
Sbjct: 245 EKSIQERNFESFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINRAAGRSVC 304

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            Y T DAGPN  + +  K  + +   F  I
Sbjct: 305 AY-TFDAGPNAVIYYLEKDTDCVLGTFKSI 333


>gi|219685538|ref|ZP_03540355.1| diphosphomevalonate decarboxylase [Borrelia garinii Far04]
 gi|219672937|gb|EED29959.1| diphosphomevalonate decarboxylase [Borrelia garinii Far04]
          Length = 312

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 109/314 (34%), Positives = 169/314 (53%), Gaps = 32/314 (10%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS 87
           + +++AL KYWGK+D+ LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+
Sbjct: 7   VNASLALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELEL--SDQDEIILNSKPVVFQN 64

Query: 88  SFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALT---LALFRIYS 141
               +   F D  R+      V F I++ NN PT AGLASS+SGFA++    L  F  YS
Sbjct: 65  ----REKVFFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFNKYS 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                 S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I
Sbjct: 121 F----NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAII 172

Query: 202 IDREKKIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
              EK++ SR AM I +HH  ++  W   +++I  D  +     + +DFI+ G    K+ 
Sbjct: 173 DSNEKELSSRVAMNICKHHEFYYDAWITSSKKIFKDALYF---FLKKDFIRFGANVVKSY 229

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----I 314
             M A M A+S  + Y++  TI  ++   + R + I I+ T+DAGP +K L   K    I
Sbjct: 230 QNMFALMFASS--IFYFKSSTIDLIKYAANLRNEGIFIFETMDAGPQVKFLCLEKNLNTI 287

Query: 315 EETIKQFFPEITII 328
            + +KQ F +I  I
Sbjct: 288 LKRLKQNFTDINFI 301


>gi|302500200|ref|XP_003012094.1| hypothetical protein ARB_01602 [Arthroderma benhamiae CBS 112371]
 gi|291175650|gb|EFE31454.1| hypothetical protein ARB_01602 [Arthroderma benhamiae CBS 112371]
          Length = 402

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 111/328 (33%), Positives = 167/328 (50%), Gaps = 27/328 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI------DSDADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T         +D D +
Sbjct: 11  RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSSKYPTADGDSL 70

Query: 77  ILNGQKISSQSSFFKKTTQFCDL--FRQ-----------FSKVYFLIETSNNIPTKAGLA 123
            LN +  S Q S  +      DL   RQ            S     I + NN PT AGLA
Sbjct: 71  TLNNKPHSIQGSP-RTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSENNFPTAAGLA 129

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 130 SSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKEDGSDSI 189

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQ 240
           A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I  + +  I++
Sbjct: 190 AEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERMTAIEK 249

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIY 297
           +I +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+  Y
Sbjct: 250 SIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINRAAGRSVCAY 309

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            T DAGPN  + +  K  + +   F  I
Sbjct: 310 -TFDAGPNAVIYYLEKDADCVLGTFKSI 336


>gi|327294609|ref|XP_003232000.1| diphosphomevalonate decarboxylase [Trichophyton rubrum CBS 118892]
 gi|326465945|gb|EGD91398.1| diphosphomevalonate decarboxylase [Trichophyton rubrum CBS 118892]
          Length = 402

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 111/328 (33%), Positives = 167/328 (50%), Gaps = 27/328 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI------DSDADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T         +D D +
Sbjct: 11  RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSSKYPTADGDSL 70

Query: 77  ILNGQKISSQSSFFKKTTQFCDL--FRQ-----------FSKVYFLIETSNNIPTKAGLA 123
            LN +  S Q S  +      DL   RQ            S     I + NN PT AGLA
Sbjct: 71  TLNNKPHSIQGSP-RTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSENNFPTAAGLA 129

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 130 SSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKEDGSDSI 189

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQ 240
           A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I  + +  I++
Sbjct: 190 AEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERMTAIEK 249

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIY 297
           +I +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+  Y
Sbjct: 250 SIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINRAAGRSVCAY 309

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            T DAGPN  + +  K  + +   F  I
Sbjct: 310 -TFDAGPNAVIYYLEKDADCVLGTFKSI 336


>gi|324994264|gb|EGC26178.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK678]
 gi|325697895|gb|EGD39779.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK160]
          Length = 315

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATEDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFTKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|168042855|ref|XP_001773902.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674746|gb|EDQ61250.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 423

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 107/329 (32%), Positives = 172/329 (52%), Gaps = 30/329 (9%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  PSNIA+ KYWGKRD KL LP+N+S+S++L   HL   T +    + + D + LNG+
Sbjct: 13  TARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFEKDRLWLNGK 72

Query: 82  KISSQSSFFKKT-----TQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S +   +K        +  D+             ++ ++  I + NN PT AGLASSA
Sbjct: 73  EVSVEGVRYKNCLREMRARATDVVIESSGKVIRKEDWNSLHIHIASENNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  AL ++  + EK E  L+ +ARLGSGSACRS Y GF EW  G + +G DS AV
Sbjct: 133 AGFACLVYALAQLMGVQEKYEGELTAIARLGSGSACRSLYGGFVEWKMGQEIDGTDSIAV 192

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
                + W DL I +  +  R+K+  S   M+ +   SP      ++ +   +  +++AI
Sbjct: 193 QLAEESHWKDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEVVPKRIVQMEKAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
              +F +  ++   ++ + HAT +  SPP+ Y    +  + G+   W+       + +T 
Sbjct: 253 KSMNFTEFAKITCADSNQFHATCLDTSPPIFYLNDTSRKLIGLVERWNRHAGEPQVAYTF 312

Query: 301 DAGPNLKLLFTHK------IEETIKQFFP 323
           DAGPN  +   +K      ++  + QF P
Sbjct: 313 DAGPNAVMFAKNKEVAAQLLQRLLYQFPP 341


>gi|302661342|ref|XP_003022340.1| hypothetical protein TRV_03551 [Trichophyton verrucosum HKI 0517]
 gi|291186280|gb|EFE41722.1| hypothetical protein TRV_03551 [Trichophyton verrucosum HKI 0517]
          Length = 402

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 111/328 (33%), Positives = 167/328 (50%), Gaps = 27/328 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI------DSDADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T         +D D +
Sbjct: 11  RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSSKYPTADGDSL 70

Query: 77  ILNGQKISSQSSFFKKTTQFCDL--FRQ-----------FSKVYFLIETSNNIPTKAGLA 123
            LN +  S Q S  +      DL   RQ            S     I + NN PT AGLA
Sbjct: 71  TLNNKPHSIQGSP-RTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSENNFPTAAGLA 129

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 130 SSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKEDGSDSI 189

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQ 240
           A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I  + +  I++
Sbjct: 190 AEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERMTAIEK 249

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIY 297
           +I +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+  Y
Sbjct: 250 SIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINRAAGRSVCAY 309

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            T DAGPN  + +  K  + +   F  I
Sbjct: 310 -TFDAGPNAVIYYLEKDADCVLGTFKSI 336


>gi|326771745|ref|ZP_08231030.1| diphosphomevalonate decarboxylase [Actinomyces viscosus C505]
 gi|326637878|gb|EGE38779.1| diphosphomevalonate decarboxylase [Actinomyces viscosus C505]
          Length = 343

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 155/282 (54%), Gaps = 9/282 (3%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQSSF 89
           IAL KYWGK D    +P  +SLSL+LG   T T ++    D  AD + +NG   S+    
Sbjct: 28  IALIKYWGKVDEAQAIPATSSLSLTLGGTRTTTTVSFDGGDGAADSVTINGTSPSAVE-- 85

Query: 90  FKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++ T+F DL R  S V     I +  ++P  AGLASSA+GFAAL  A  R   +     
Sbjct: 86  LERVTRFLDLVRARSGVTAPATITSRASVPLAAGLASSAAGFAALAAAASRAAGMDLDGR 145

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR GSGSA RS + G   W  G D     S+A P   +  DL + ++ +  R K 
Sbjct: 146 ELSRLARRGSGSATRSVFGGLVLWNAGHDD--ASSYAEPVACEM-DLAMVVVVLSQRYKP 202

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S  AM  T   SP F  W +    DL    +A+   D  +LGE+ E NAL MHATMIA
Sbjct: 203 ISSTRAMRATMASSPLFPAWVEASGRDLQVALEAVRAGDLARLGEIVEGNALGMHATMIA 262

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A P ++YW  +T+  +  +   R++ +PI+ T+DAGPN+K+L
Sbjct: 263 ARPGIIYWLPQTVAALHAIRAMREEGLPIWATIDAGPNVKVL 304


>gi|332363140|gb|EGJ40925.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK49]
          Length = 315

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIIKYWGKKDAERMIPSTSSISLTLENMYTETQLSPLPDTATEDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|298253293|ref|ZP_06977085.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis 5-1]
 gi|297532688|gb|EFH71574.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis 5-1]
          Length = 365

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 168/310 (54%), Gaps = 17/310 (5%)

Query: 15  ECNPKIN-----EKSSAFLPSN--IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT 67
           E  PKI        +SAF  +N  IAL KYWGKRD KL LP  +SLSL+L  L T T ++
Sbjct: 5   EIQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVS 64

Query: 68  VIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLAS 124
            +++ + D   L+ +KIS  +  F++     DL R+ + +     + + N +PT AGLAS
Sbjct: 65  FVNNLEQDTFTLDNEKISPSAKPFRRVVAMLDLVREIAGISTKASVISHNIVPTAAGLAS 124

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SASGFAAL  A      +      LSR+AR GSGSACRS + G   W  G D     S+A
Sbjct: 125 SASGFAALASAASYAAGLNLTPRELSRLARCGSGSACRSIFGGLSIWHAGCDDE--TSYA 182

Query: 185 VPFNNQWPDLR-IGLLKII----DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIK 239
            P  N    L+ + L  I+    D +K I SREAM  T   SP + QW +Q   DL   K
Sbjct: 183 EPIENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQSKDDLEIAK 242

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT 299
            AI   D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R+    ++ T
Sbjct: 243 NAIKRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMRKDGWLVWST 302

Query: 300 LDAGPNLKLL 309
           +DAGPN+K+L
Sbjct: 303 MDAGPNVKVL 312


>gi|168044045|ref|XP_001774493.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674205|gb|EDQ60717.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 426

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/313 (32%), Positives = 166/313 (53%), Gaps = 24/313 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  PSNIA+ KYWGKRD KL LP+N+S+S++L   HL   T +    + + D + LNG+
Sbjct: 14  TARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERDRLWLNGK 73

Query: 82  KISSQSSFFKKT-----TQFCDLFRQ----------FSKVYFLIETSNNIPTKAGLASSA 126
           ++S +   ++        +  D+  +          +S ++  I + NN PT AGLASSA
Sbjct: 74  EVSVEGERYRNCLREMRARATDVVIESSGKVITKEVWSTLHIHIASENNFPTAAGLASSA 133

Query: 127 SGFAALTLALFRIYSIPEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  +L ++ ++ EK E  L+ +ARLGSGSACRS Y GF +W  G + +G DS A 
Sbjct: 134 AGFACLVYSLAQLMNVKEKYEGELTAIARLGSGSACRSLYGGFVKWNMGKEADGKDSIAT 193

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
               Q  W DL I +  +  R+K+  S   M+ +   SP      ++ +   +  +++AI
Sbjct: 194 QLAEQSHWEDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEMVPKRIGQMEKAI 253

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
              DF +   +   ++ + HAT +  SPP+ Y    +  + G+   W+       + +T 
Sbjct: 254 KSMDFAEFARITCADSNQFHATCLDTSPPIFYLNDSSRRLIGLVERWNRHAGEPQVAYTF 313

Query: 301 DAGPNLKLLFTHK 313
           DAGPN  +   +K
Sbjct: 314 DAGPNAVMFAKNK 326


>gi|219684321|ref|ZP_03539265.1| diphosphomevalonate decarboxylase [Borrelia garinii PBr]
 gi|219672310|gb|EED29363.1| diphosphomevalonate decarboxylase [Borrelia garinii PBr]
          Length = 312

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 169/314 (53%), Gaps = 32/314 (10%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS 87
           + +++AL KYWGK+D+ LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+
Sbjct: 7   VNASLALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELEL--SDQDEIILNSKPVVFQN 64

Query: 88  SFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALT---LALFRIYS 141
               +   F D  R+      V F I++ NN PT AGLASS+SGFA++    L  F  YS
Sbjct: 65  ----REKVFFDYARKIISEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFNKYS 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                 S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I
Sbjct: 121 F----NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAII 172

Query: 202 IDREKKIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
              EK++ SR AM I +HH  ++  W   +++I  D  +     + +DFI+ G    K+ 
Sbjct: 173 DSNEKELSSRVAMNICKHHEFYYDAWIASSKKIFKDALYF---FLKKDFIRFGANVVKSY 229

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----I 314
             M A M A+S  + Y++  TI  ++   + R + I ++ T+DAGP +K L   K    I
Sbjct: 230 QNMFALMFASS--IFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFLCLEKNLNTI 287

Query: 315 EETIKQFFPEITII 328
            + +KQ F +I  I
Sbjct: 288 LKRLKQNFTDINFI 301


>gi|71022191|ref|XP_761326.1| hypothetical protein UM05179.1 [Ustilago maydis 521]
 gi|46097820|gb|EAK83053.1| hypothetical protein UM05179.1 [Ustilago maydis 521]
          Length = 427

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 167/335 (49%), Gaps = 31/335 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCIILNGQKIS 84
           P NIA+ KYWGK+D+ L LP N+SLS++L   HL ++T      S    D + LNG++ +
Sbjct: 13  PVNIAVIKYWGKKDTTLILPTNDSLSVTLDQDHLRSVTTARADASFGSQDRLWLNGEEEA 72

Query: 85  SQS-SFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGFAAL 132
            ++    ++        RQ            S+    + + NN PT AGLASSASGFAAL
Sbjct: 73  IKADGRLRRCIDEMRKLRQAKESKDSNLAKLSEWAVHVCSENNFPTAAGLASSASGFAAL 132

Query: 133 TLALFRIYSI-PEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
             +L  +Y + PE S S LSR+AR GSGSACRS + G+  W  G   +G DS AV    Q
Sbjct: 133 IASLAALYELQPEVSSSELSRIARQGSGSACRSLFGGYVAWQGGEHPSGQDSLAVQVAPQ 192

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
             WPDL+  +  + D +K   S   M+ T   SP      +++    +  I +AI  QDF
Sbjct: 193 SHWPDLQALICVVSDAKKGTPSTAGMQRTVQTSPLLQHRIKEVVPQRMIKISEAIQKQDF 252

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQK------ETIQGMERVWDARQQSIPIYFTLD 301
               E+   ++   HA  +  +PP+ Y         + ++ + R  +A  +   + +T D
Sbjct: 253 NTFAEITMADSNNFHACCLDTAPPIFYMNDVSRAIVQLVEELNRANEADGKGKLVAYTYD 312

Query: 302 AGPNLKLLFTH----KIEETIKQFFPEITIIDPLD 332
           AGPN  L        +I +TI+ +FP     D  D
Sbjct: 313 AGPNAVLYAPKDNMPRILQTIRHYFPNADFDDTFD 347


>gi|227831354|ref|YP_002833134.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.S.2.15]
 gi|229580265|ref|YP_002838665.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.G.57.14]
 gi|229581089|ref|YP_002839488.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.N.15.51]
 gi|227457802|gb|ACP36489.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.S.2.15]
 gi|228010981|gb|ACP46743.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.G.57.14]
 gi|228011805|gb|ACP47566.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.N.15.51]
          Length = 325

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 167/306 (54%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N ++I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-ERILPE 66

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + I +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|322386747|ref|ZP_08060371.1| diphosphomevalonate decarboxylase [Streptococcus cristatus ATCC
           51100]
 gi|321269029|gb|EFX51965.1| diphosphomevalonate decarboxylase [Streptococcus cristatus ATCC
           51100]
          Length = 315

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/299 (34%), Positives = 166/299 (55%), Gaps = 20/299 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++ + ++A  D   ++GQ  S + 
Sbjct: 12  ANIAIVKYWGKADAERMIPSTSSISLTLENMYTQTQLSPLSAEAAGDEFYIDGQLQSPEE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  I+TSNN+PT AGL+SS+SG +AL  A    +     +E
Sbjct: 72  --HAKVSRIIDRFRTEPSDWVRIDTSNNMPTAAGLSSSSSGLSALVKACDAYFETNYNTE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVQT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR  M++    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRLGMQLCSETSKDFQAWIDQSAQDYQDMLAYLKDNDFEKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
              A+PP  Y  +E+   M+ V   R Q    YFT+DAGPN+K+L    +EE ++   P
Sbjct: 240 TETATPPFTYLTEESYAAMDFVRQLRDQGRRCYFTMDAGPNVKVLC---LEENLEDLVP 295


>gi|329769190|ref|ZP_08260610.1| diphosphomevalonate decarboxylase [Gemella sanguinis M325]
 gi|328839409|gb|EGF88987.1| diphosphomevalonate decarboxylase [Gemella sanguinis M325]
          Length = 303

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 156/291 (53%), Gaps = 11/291 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+     LP N ++SL L +L + T I    S+ D   +N +K   +   
Sbjct: 9   ANIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKSLSNEDEFYINDEKQGPEE-- 66

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
             K  +F   F   ++    I++ N +PT AGL+SS+SG  AL LA    + + + ++ +
Sbjct: 67  VNKMIKFISKFTPVAREKICIKSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKSTQEM 126

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
             +A+ GSGS+CRSFY+    W+   +   ++  +        D  + +L + +  KKI 
Sbjct: 127 VEIAKEGSGSSCRSFYK-LAAWL---EDGSVEELSCKL-----DFGMMVLVVNEDRKKIS 177

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AME     S  F  W ++   D   +K+A+ + DF K+GE+ E NAL MH T   +S
Sbjct: 178 SRVAMEQCVQTSTTFASWVEKAKKDFVLMKEALKEADFEKIGEITESNALAMHETTTTSS 237

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           P   +  +E+ + M+ V   R Q    YFT+DAGPN+K+L+  + +E + +
Sbjct: 238 PSFTFLTEESHRAMDIVKQLRSQGYKCYFTMDAGPNVKVLYLKEDQEKLHE 288


>gi|329768011|ref|ZP_08259522.1| diphosphomevalonate decarboxylase [Gemella haemolysans M341]
 gi|328838496|gb|EGF88104.1| diphosphomevalonate decarboxylase [Gemella haemolysans M341]
          Length = 303

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 157/297 (52%), Gaps = 14/297 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+     LP N ++SL L +L + T I   D++ D   +N +K S +   
Sbjct: 9   ANIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKNDNNVDEFYINDEKQSQEE-- 66

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
             K  +F   F    +    I + N +PT AGL+SS+SG  AL LA    + + + ++ L
Sbjct: 67  VDKMIKFISKFTPTEREAITIRSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKTTKEL 126

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
             +A+ GSGS+CRSFY+    W+   +   ++           D  + +L + +  KKI 
Sbjct: 127 VEIAKEGSGSSCRSFYK-LAAWL---EDGSVEELECSL-----DFGMMVLVVNEDRKKIS 177

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AME     S  F  W ++   D   +K+A+ + DF K+GE+ E NAL MH T   ++
Sbjct: 178 SRVAMERCVQTSTTFDAWVEKAKNDFVLMKEALKEADFEKIGEITESNALAMHGTTSTST 237

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
           P   +  +E+   M+ V + R +    YFT+DAGPN+K+L+   + E   + + EI+
Sbjct: 238 PSFSFLTEESHMAMDIVKELRSKGHRCYFTMDAGPNVKVLY---LREDQDKLYEEIS 291


>gi|145256805|ref|XP_001401521.1| diphosphomevalonate decarboxylase [Aspergillus niger CBS 513.88]
 gi|134058430|emb|CAK47917.1| unnamed protein product [Aspergillus niger]
          Length = 404

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 168/331 (50%), Gaps = 29/331 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID--SDADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +        D + L
Sbjct: 11  RATTTAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQRSLRTLTTASCAPFYPAKDELTL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S     I + NN PT AGLAS
Sbjct: 71  NGKPQDIQSS--KRTLACLASLRAHRRELEDANPSLPKLSSFPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+ ++G DS A
Sbjct: 129 SAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGSLEDGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V   + WP++R  +L +   +K + S E M+ T   S  F T+ +  +   +A I+ A
Sbjct: 189 EEVAPQSHWPEMRALILVVSAAKKDVPSTEGMQTTVATSNLFATRASTVVPERMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFT 299
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +        +T
Sbjct: 249 IQNRDFPAFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAIGRTVCAYT 308

Query: 300 LDAGPNLKLLFTHKIEE----TIKQFFPEIT 326
            DAGPN  + +  K  E    T+K    E T
Sbjct: 309 YDAGPNAVIYYLEKDTELVAGTVKAILGEKT 339


>gi|225870468|ref|YP_002746415.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           equi 4047]
 gi|225699872|emb|CAW93759.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           equi 4047]
          Length = 314

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 159/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ + + A  D   +NG  +   +
Sbjct: 12  ANIAIVKYWGKKDEAKMIPSTSSISLTLEGMYTTTSLSFLPASAKGDQFYING--VLQDA 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +++      E
Sbjct: 70  KEHAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQLFQAKLSQE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGSA RSF+     W    D++    + V       DL++ ++ ++  D  
Sbjct: 130 ELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVK-----TDLKLAMIMLVLNDAR 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NAL MHAT 
Sbjct: 181 KPISSREGMKRCSATSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y  + + Q M RV + RQ+    YFT+DAGPN+K+L   +  E +   F
Sbjct: 241 KTASPSFSYLTEASYQAMLRVKELRQEGYSCYFTMDAGPNVKVLCLEEDLERLSHLF 297


>gi|156847450|ref|XP_001646609.1| hypothetical protein Kpol_1028p24 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117288|gb|EDO18751.1| hypothetical protein Kpol_1028p24 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 396

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 178/347 (51%), Gaps = 32/347 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T     +    D + LNG
Sbjct: 5   ASTTAPVNIATLKYWGKRDKDLNLPTNSSISVTLAQEDLRTLTSAATDEGFTQDKLWLNG 64

Query: 81  QKISSQSSFFKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           ++ S  S+     TQ C  DL   RQ            S+    I + NN PT AGLASS
Sbjct: 65  KEESLDSA----RTQQCLADLRGLRQQVEAQDPQAPKMSQWKLHIVSENNFPTAAGLASS 120

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G + +G DS AV
Sbjct: 121 AAGFAALVVAIAKLYQLPQDYSEISKIARKGSGSACRSLFGGYVAWEMGENLDGSDSKAV 180

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAI 242
                N WP+++  +L + D +K   S   M++T   S  F +  + +       +KQAI
Sbjct: 181 EVAPLNHWPNMKAAILVVSDMKKDTPSTSGMQLTVKTSDLFQERIKNVVPQRFEEMKQAI 240

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFTL 300
            ++DF    ++  K++   HAT + + PP+ Y    + + +  V   +A      + +T 
Sbjct: 241 RNKDFPTFADLTMKDSNSFHATCLDSYPPIFYMNDTSRKIIRLVHSINAFYNETIVAYTY 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
           DAGPN  L +  + E  +  F  ++      D    W TK + ++ N
Sbjct: 301 DAGPNAVLYYLEENESKLFAFIYKL-----FDKVSGWETKYTEAELN 342


>gi|302881821|ref|XP_003039821.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256720688|gb|EEU34108.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 391

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 109/333 (32%), Positives = 168/333 (50%), Gaps = 31/333 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  +  +S    D + L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLSQADLRTLTTASCSNSYTSGDSLTL 67

Query: 79  NGQKISSQSSFFKKTTQFC---------------DLFRQFSKVYFLIETSNNIPTKAGLA 123
           NG+      +     TQ C                   + S +   + + NN PT AGLA
Sbjct: 68  NGESADVSGA----RTQACFRELRARRAALEAADSSLPKLSAMNLKLVSENNFPTAAGLA 123

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LS VAR GSGSACRS + G+  W  G   +G DS 
Sbjct: 124 SSAAGFAALVQAIALLYELPDSPSDLSLVARQGSGSACRSLFGGYVAWRMGEKDDGSDSK 183

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQ 240
           A  V   + WP++R  +L     +K + S   M+ T   S  F +  T  +  ++A +++
Sbjct: 184 AELVAPASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFKERITNIVPANMALMEE 243

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIY 297
           A+ ++DF K  EV  + +   HAT     PP+ Y     +  I+ +E +     +++  Y
Sbjct: 244 AVKNKDFAKFAEVTMRESNSFHATCADTYPPIFYMNDVSRAAIRAVEDINTKAGKTVAAY 303

Query: 298 FTLDAGPNLKLLFTHK-IEETIKQFFPEITIID 329
            T DAGPN  + +  +     +  F+  ++ +D
Sbjct: 304 -TFDAGPNCVVYYLEENANAVLGTFYQALSGVD 335


>gi|284998885|ref|YP_003420653.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.D.8.5]
 gi|284446781|gb|ADB88283.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.D.8.5]
          Length = 325

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 166/306 (54%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N  +I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-DRILPE 66

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++    + +  +E+    P  AGLASSA+G AALT  +  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGVNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + I +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|323353484|ref|ZP_08088017.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis VMC66]
 gi|322121430|gb|EFX93193.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis VMC66]
          Length = 315

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 160/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    ++E
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNSYFQTGYQTE 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLRDQGERCYFTMDAGPNVKVL 284


>gi|67528432|ref|XP_662018.1| hypothetical protein AN4414.2 [Aspergillus nidulans FGSC A4]
 gi|40741141|gb|EAA60331.1| hypothetical protein AN4414.2 [Aspergillus nidulans FGSC A4]
 gi|259482774|tpe|CBF77574.1| TPA: diphosphomevalonate decarboxylase (AFU_orthologue;
           AFUA_4G07130) [Aspergillus nidulans FGSC A4]
          Length = 404

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 166/327 (50%), Gaps = 27/327 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   S   AD + L
Sbjct: 11  RATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSASYPAADELTL 70

Query: 79  NGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLAS 124
           NG+    QSS  K+T       R              + S +   I + NN PT AGLAS
Sbjct: 71  NGKPQDIQSS--KRTLACLASLRAHRQELESADPSLPKLSTLPLRIVSENNFPTAAGLAS 128

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G   +G DS A
Sbjct: 129 SAAGFAALVRAVADLYKLPQSPTELSRIARQGSGSACRSLMGGYVAWRAGELADGSDSLA 188

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQA 241
             V     WP++R  +L +   +K + S   M+ T   S  F T+    +   +A I+ A
Sbjct: 189 EEVAPQAHWPEMRALILVVSAEKKDVPSTTGMQTTVATSELFATRANAVVPARMAAIETA 248

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYF 298
           I ++DF    E+  +++   HAT + + PP+ Y    +   +  V D   A  +++  Y 
Sbjct: 249 IQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINNAVGRTVCAY- 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEI 325
           T DAGPN  + +  K    +   F  I
Sbjct: 308 TFDAGPNAVIYYLEKDSNLVAGTFKSI 334


>gi|297242909|ref|ZP_06926847.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis AMD]
 gi|296889120|gb|EFH27854.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis AMD]
          Length = 365

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 167/310 (53%), Gaps = 17/310 (5%)

Query: 15  ECNPKIN-----EKSSAFLPSN--IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT 67
           E  PKI        +SAF  +N  IAL KYWGKRD KL LP  +SLSL+L  L T T ++
Sbjct: 5   EIQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVS 64

Query: 68  VIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLAS 124
             ++ + D   L+ +KIS  +  F++     DL R+ + +     + + N +PT AGLAS
Sbjct: 65  FANNLEQDTFTLDNEKISPSAKTFRRVVAMLDLVREIAGISTKASVISHNIVPTAAGLAS 124

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SASGFAAL  A      +      LSR+AR GSGSACRS + G   W  G D     S+A
Sbjct: 125 SASGFAALASAASYAAGLNLTPRELSRLARRGSGSACRSIFGGLSIWHAGCDDE--TSYA 182

Query: 185 VPFNNQWPDLR-IGLLKII----DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIK 239
            P  N    L+ + L  I+    D +K I SREAM  T   SP + QW +Q   DL   K
Sbjct: 183 EPIENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQSKDDLEIAK 242

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT 299
            AI   D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R+    ++ T
Sbjct: 243 NAIQRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMRKDGWLVWST 302

Query: 300 LDAGPNLKLL 309
           +DAGPN+K+L
Sbjct: 303 MDAGPNVKVL 312


>gi|323475698|gb|ADX86304.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus REY15A]
          Length = 325

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 166/306 (54%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N ++I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-ERILPE 66

Query: 87  SSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++     F   +E+    P  AGLASSA+G AALT  L  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + + +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDVLEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|227828609|ref|YP_002830389.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.14.25]
 gi|238620809|ref|YP_002915635.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.4]
 gi|227460405|gb|ACP39091.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.14.25]
 gi|238381879|gb|ACR42967.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.4]
          Length = 325

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 165/306 (53%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N  +I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-DRILPE 66

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIIGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KLEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + I      + +AI ++D  K      +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYFVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + I +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|170016979|ref|YP_001727898.1| diphosphomevalonate decarboxylase [Leuconostoc citreum KM20]
 gi|169803836|gb|ACA82454.1| Diphosphomevalonate decarboxylase [Leuconostoc citreum KM20]
          Length = 316

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 165/293 (56%), Gaps = 16/293 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
           S+A   +NIAL KYWGK++++LNLP  +S+SL+L    T T +T  +S AD + +NG   
Sbjct: 3   STATAHTNIALIKYWGKKNTRLNLPTTSSISLTLDQFYTKTTVTP-NSQADQLFINGNAT 61

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            +      +   F +  RQ+   +    + ++N++PT AGLASSAS FAALT A  R  +
Sbjct: 62  DA-----TRVHNFLNNLRQYLGDFEPLTVTSNNHVPTSAGLASSASAFAALTAATARELN 116

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                 +LSR+AR GSGSA RSFY  F  W  G D     SFA   N     + + + ++
Sbjct: 117 FNLPLTTLSRLARRGSGSASRSFYGHFAIWHEGIDDTS--SFAESLNAPAMPIALVVAEV 174

Query: 202 IDREKKIGSREAME--ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            D  KK+GS E M   +T   SP +  W ++ +  L  +KQAI   D  K+G +AEKNAL
Sbjct: 175 SDAAKKVGSTEGMRRAVT---SPDYQDWLRESAKQLVDMKQAIQHSDIEKIGAIAEKNAL 231

Query: 260 KMHA-TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
            MHA  + A   P  Y+  +T + +  V D R Q I  + TLDAGPN+K++ T
Sbjct: 232 SMHALNLTARQKPFTYFTCDTQRILSIVSDLRHQGILAFATLDAGPNVKIITT 284


>gi|118618817|ref|YP_907149.1| diphosphomevalonate decarboxylase [Mycobacterium ulcerans Agy99]
 gi|118570927|gb|ABL05678.1| diphosphomevalonate decarboxylase [Mycobacterium ulcerans Agy99]
          Length = 336

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 112/314 (35%), Positives = 157/314 (50%), Gaps = 12/314 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI----TVIDSDADCIILN 79
           +SA    NIAL KYWGKRD +   P+ +SLS++L    T T +    T      D +++ 
Sbjct: 6   ASAVAHPNIALIKYWGKRDEEFMPPMTSSLSMTLDIFPTTTTVEVGPTGGGVGPDIVMMA 65

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G+   +  +F  + T+F DL R    S+   +++T N  PT AGLASSASGFAAL  A  
Sbjct: 66  GKP--APEAFSTRVTEFLDLLRVRVKSRAPAIVDTHNAGPTGAGLASSASGFAALAAAAC 123

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
             Y +      LSR+AR GSGSA RS + GF  W  G    G D  A  +          
Sbjct: 124 AAYGLDTDVRELSRLARRGSGSASRSVFGGFSVWHAGA-AIGADGDAQSYAEPIDVALDL 182

Query: 198 LLKIIDRE---KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            L ++  E   K+I SR AM  T   SP +  W      D   ++ A+   D    G +A
Sbjct: 183 ALVVVVVEAGAKQISSRAAMSQTVKTSPLYRAWADASGDDPHAMQAALAAGDLHGAGAIA 242

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E NA+ MH TM+AA P + Y    ++Q ++RV   R   I  Y T+DAGPN+K+L +   
Sbjct: 243 EANAMGMHVTMLAARPAVRYISAASLQVIDRVVAMRGNGIAAYLTMDAGPNVKVLCSRDD 302

Query: 315 EETIKQFFPEITII 328
              I     E++ +
Sbjct: 303 AALIAASLKELSQV 316


>gi|229585836|ref|YP_002844338.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.27]
 gi|228020886|gb|ACP56293.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.27]
          Length = 325

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 165/306 (53%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N  +I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-DRILPE 66

Query: 87  SSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIIGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KLEELSKIARLGSGSACRSMFGGFVVWNKGLREDGGDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + I      + +AI ++D  K      +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYFVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + I +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|262281876|ref|ZP_06059645.1| diphosphomevalonate decarboxylase [Streptococcus sp. 2_1_36FAA]
 gi|262262330|gb|EEY81027.1| diphosphomevalonate decarboxylase [Streptococcus sp. 2_1_36FAA]
          Length = 315

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HTKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYKAMLSYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ + M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYKAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|125717208|ref|YP_001034341.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK36]
 gi|125497125|gb|ABN43791.1| Diphosphomevalonate decarboxylase, putative [Streptococcus
           sanguinis SK36]
          Length = 315

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 160/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++ Q  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDSQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYKAMLSYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|315612568|ref|ZP_07887481.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis ATCC
           49296]
 gi|315315549|gb|EFU63588.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis ATCC
           49296]
          Length = 317

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 164/297 (55%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ + S++
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ-LQSEA 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 71  EH-AKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLNRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DLR+ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLRLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF  +GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFANVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|327459082|gb|EGF05430.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1057]
          Length = 315

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 160/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQLQSLAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISRIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M  V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMNAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|254582390|ref|XP_002497180.1| ZYRO0D17270p [Zygosaccharomyces rouxii]
 gi|186703818|emb|CAQ43507.1| Diphosphomevalonate decarboxylase [Zygosaccharomyces rouxii]
 gi|238940072|emb|CAR28247.1| ZYRO0D17270p [Zygosaccharomyces rouxii]
          Length = 397

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 112/337 (33%), Positives = 173/337 (51%), Gaps = 26/337 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T   T  +   D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDKALNLPTNSSISVTLSQEDLRTLTSAATGPELKQDKLWLNG 65

Query: 81  QKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGF 129
           ++ S +S   ++  +     R+           FS     I + NN PT AGLASSA+GF
Sbjct: 66  KEESLESERTQQCLKGLRKLRKELEDKDSNLPKFSNWGLHIVSENNFPTAAGLASSAAGF 125

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           AAL +A+ R+Y +P+    LS +AR GSGSACRS + G+  W  G  ++G DS AV  + 
Sbjct: 126 AALVVAIARLYQLPQSMSELSEIARQGSGSACRSLFGGYVAWEMGEKEDGSDSKAVEISP 185

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQD 246
              WP ++  +L +   +K   S   M++T   S  F +  + +      H+K+AI  ++
Sbjct: 186 LEHWPQMKAAILVVNASKKDTPSTSGMQLTVKTSELFQERVKNVVPQRFTHMKEAIEHKN 245

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAG 303
           + K  E+  K++   HAT + + PP+ Y     K+ I+    + +   +++ + +T DAG
Sbjct: 246 WPKFAELTMKDSNSFHATCLDSYPPIFYMNDTSKKIIKLCHAINEFYGKTV-VAYTFDAG 304

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
           PN  L +  + E  +  F     I    D    W TK
Sbjct: 305 PNAVLYYLQENEAKLFAF-----IYKLFDKVPGWETK 336


>gi|307711407|ref|ZP_07647823.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK321]
 gi|307616780|gb|EFN95964.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK321]
          Length = 317

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDAKADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIIDRYRPAGEGFIRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFTKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|332358634|gb|EGJ36458.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1056]
          Length = 315

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + + A  D   ++ Q  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATGDEFYIDSQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|328945444|gb|EGG39596.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1087]
          Length = 315

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 160/284 (56%), Gaps = 15/284 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T ++ + + A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAKKMIPSTSSISLTLENMYTETQLSPLLATATEDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L+++A+  SGS+ RSF+     W    D+     + V       DL++ ++ ++  D +
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW----DKESGAIYPVK-----TDLKLAMIMLVLHDEK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+MHAT 
Sbjct: 181 KPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
             A PP  Y  +E+   M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 241 EKAYPPFSYLTEESYHAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|261206464|ref|XP_002627969.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis
           SLH14081]
 gi|239593028|gb|EEQ75609.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis
           SLH14081]
 gi|239610798|gb|EEQ87785.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis ER-3]
 gi|327350330|gb|EGE79187.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 404

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 164/328 (50%), Gaps = 29/328 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIIL 78
           ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T   S      D + L
Sbjct: 9   RASATAPVNIAVIKYWGKRDAILNLPTNSSLSVTLSQSSLRAYTTASCSPTYPAEDSLTL 68

Query: 79  NGQKISSQSSFFKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAGLA 123
           N Q  S + S   K T  C  DL   RQ            S     I + NN PT AGLA
Sbjct: 69  NSQPHSIKDS---KRTLACLSDLRSLRQELENANPSLPKLSTFPLRIVSENNFPTAAGLA 125

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 126 SSAAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRTGVLEDGTDSL 185

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQ 240
           A  V   + WP++R  +L + D +K + S   M+ T   S  F T+    +   +  I+ 
Sbjct: 186 AEEVAPASHWPEMRALILVVSDVKKDVPSTLGMQATVATSTLFATRAETVVPARMVAIET 245

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIY 297
           AI ++DF    E+  K++   HAT +   PP  Y    +   +  V D   A  ++I  Y
Sbjct: 246 AIKNRDFPSFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAY 305

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            T DAGPN  + + +   E +   F  I
Sbjct: 306 -TFDAGPNAVIYYLNNESERVIGTFRSI 332


>gi|325689461|gb|EGD31466.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK115]
          Length = 315

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFSKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|156371457|ref|XP_001628780.1| predicted protein [Nematostella vectensis]
 gi|156215765|gb|EDO36717.1| predicted protein [Nematostella vectensis]
          Length = 406

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 111/320 (34%), Positives = 162/320 (50%), Gaps = 29/320 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNG--QKI 83
           P NIA+ KYWGKRD +L LPLN+SLS ++      T  TV+   D+  D + +N   Q I
Sbjct: 25  PINIAVIKYWGKRDEELILPLNSSLSATINLDELCTTTTVVARRDNPQDSLWINKREQPI 84

Query: 84  SSQSSFFKKTTQFCDLFRQFS-------KVYFL-IETSNNIPTKAGLASSASGFAALTLA 135
           +      K  ++   L ++ S       + Y L I + NN PT AGLASSASG+A L LA
Sbjct: 85  AESPRIQKCISKVRQLAKENSPERWQELRNYGLCIYSKNNFPTAAGLASSASGYACLVLA 144

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPD 193
           L ++Y +      LS +AR GSGSACRS Y GF +W  G   +G DS A    ++  W  
Sbjct: 145 LSKLYHL---DMELSSIARQGSGSACRSMYGGFVKWEAGCRPDGTDSIASQIVDEKHWST 201

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGE 252
           LRI +L I D  K   S   M  +   S       Q+ +   + +I +AI ++DF    E
Sbjct: 202 LRILILVINDERKANPSTSGMRRSTETSELLQFRAQKCVPKRMENITKAIKERDFHTFAE 261

Query: 253 VAEKNALKMHA----TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKL 308
           +  K++ ++HA    T    +PP +      +  +   ++    +  + +T DAGPN  +
Sbjct: 262 ITMKDSNQLHAVCQDTYPPITPPYMNSTSHLVVQLVTAYNNNHGNNKVAYTFDAGPN-SV 320

Query: 309 LFTH-----KIEETIKQFFP 323
           LFT      ++   IK FFP
Sbjct: 321 LFTQEGDLPELVALIKHFFP 340


>gi|224110186|ref|XP_002315441.1| predicted protein [Populus trichocarpa]
 gi|222864481|gb|EEF01612.1| predicted protein [Populus trichocarpa]
          Length = 416

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 168/309 (54%), Gaps = 25/309 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGK 70

Query: 82  KIS-----SQSSFFKKTTQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS      Q+   +   Q CD            + + K++  + + NN PT AGLASSA
Sbjct: 71  EISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G  ++G DS AV 
Sbjct: 131 AGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAEDGSDSLAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W +L I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKRIKQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
           ++DF    ++   ++ + HA  +   PP+ Y    +   I  +E+ W+  +++  + +T 
Sbjct: 251 NRDFGSFAQLTCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEK-WNRSEETPQVAYTF 309

Query: 301 DAGPNLKLL 309
           DAGPN  L+
Sbjct: 310 DAGPNAVLI 318


>gi|241888607|ref|ZP_04775914.1| diphosphomevalonate decarboxylase [Gemella haemolysans ATCC 10379]
 gi|241864630|gb|EER69005.1| diphosphomevalonate decarboxylase [Gemella haemolysans ATCC 10379]
          Length = 303

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 158/297 (53%), Gaps = 14/297 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+     LP N ++SL L +L + T I   +++ D   +N +K S +   
Sbjct: 9   ANIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKNNNNIDEFYINDEKQSQEE-- 66

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
             K  +F   F   ++    I + N +PT AGL+SS+SG  AL LA    + + + ++ L
Sbjct: 67  VDKMIKFISKFTPTNREAITIRSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKTTKEL 126

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
             +A+ GSGS+CRSFY+    W+   +   ++           D  + +L + +  KKI 
Sbjct: 127 VEIAKEGSGSSCRSFYK-LAAWL---EDGSVEELQCSL-----DFGMMVLVVNEDRKKIS 177

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AME     S  F  W ++   D   +K+A+ D +F K+GE+ E NAL MH T   ++
Sbjct: 178 SRVAMERCVQTSTTFDAWVEKAKGDFVLMKEALKDANFEKIGEITESNALAMHGTTSTST 237

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEIT 326
           P   +  +E+   M+ V + R +    YFT+DAGPN+K+L+   + E   + + EI+
Sbjct: 238 PSFSFLTEESHMAMDIVKELRSKGYKCYFTMDAGPNVKVLY---LREDQDKLYEEIS 291


>gi|326692553|ref|ZP_08229558.1| diphosphomevalonate decarboxylase [Leuconostoc argentinum KCTC
           3773]
          Length = 317

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 162/293 (55%), Gaps = 16/293 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
           ++A   +NIAL KYWGK+DS LNLP  +S+SL+L    T T ++  ++ AD +++NGQ  
Sbjct: 3   TTATAHTNIALIKYWGKKDSILNLPTTSSISLTLNEFYTRTTVSQ-NASADELLINGQPF 61

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            SQ     +  +F D+ R     +    + + N++PT AGLASSAS FAALT A+ R   
Sbjct: 62  DSQ-----RIHRFLDMLRDTLGDFAPLTVASENHVPTGAGLASSASAFAALTGAVTRELG 116

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL-- 199
           +   + +LSR+AR GSGSA RSFY  F  W  G D     SFA       PD+ I L+  
Sbjct: 117 LDLDNMTLSRLARRGSGSASRSFYGHFAIWHEGHDD--ASSFAESL--HAPDMPIALVVA 172

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           ++    KK+GS E M      SP +  W +  +  L  ++ AI   D  K+G +AE NAL
Sbjct: 173 EVSTAMKKVGSTEGMRRAA-TSPDYATWVKNSAAQLRDMQAAIQASDIEKIGTIAEANAL 231

Query: 260 KMH-ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
            MH     A   P  Y+  +T   +  V D R+Q +  + TLDAGPN+K++ T
Sbjct: 232 AMHDLNRTARLEPFTYFTNDTTDILTLVADMRRQGLLAFATLDAGPNVKIITT 284


>gi|323478406|gb|ADX83644.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus HVE10/4]
          Length = 325

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 165/306 (53%), Gaps = 15/306 (4%)

Query: 29  PSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILNGQKISSQ 86
           PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+  SD + +I+N ++I  +
Sbjct: 10  PSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTL--SDKNIVIVN-ERILPE 66

Query: 87  SSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   +  + F++     F   +E+    P  AGLASSA+G AALT  L  +  +  
Sbjct: 67  DEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLNELLELEL 126

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           K E LS++AR+GSGS CRS + GF  W  G  ++G DS+      +  W +L + ++ I+
Sbjct: 127 KPEELSKIARVGSGSGCRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSEL-VDIIPIL 185

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            ++EKKI SR+ M  +   S       + I      + +AI ++D  K   +  +++  M
Sbjct: 186 SEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYLVMRHSNSM 245

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA ++ + P   Y    +I+ ME +    Q+     +T DAGPN  +  T +  + I +F
Sbjct: 246 HAIILDSWPSFFYLNDTSIRIMEWI----QEYGKAGYTFDAGPNPHIFTTERYVQDILEF 301

Query: 322 FPEITI 327
              + I
Sbjct: 302 LKSLEI 307


>gi|256273360|gb|EEU08298.1| Mvd1p [Saccharomyces cerevisiae JAY291]
          Length = 396

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + I      + ++A
Sbjct: 181 VQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHIVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|332364784|gb|EGJ42553.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1059]
          Length = 315

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 161/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + + A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATEDEFYIDGQLQSPAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  --HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFAKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPCSYLTEESYQAMDAVRKLRDQGERCYFTMDAGPNVKVL 284


>gi|324990338|gb|EGC22276.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK353]
          Length = 315

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 162/285 (56%), Gaps = 17/285 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + + A  D   ++GQ  S   
Sbjct: 12  ANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATGDEFYIDGQLQSLAE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    +    +++
Sbjct: 72  HV--KISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQTGYQTQ 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PFNNQWPDLRIGLLKII--DR 204
            L+++A+  SGS+ RSF+     W         DS A+ P      DL++ ++ ++  D 
Sbjct: 130 ELAQLAKFASGSSARSFFGPLAAW-------DKDSGAIYPVKT---DLKLAMIMLVLHDE 179

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+MHAT
Sbjct: 180 KKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFSKVGQLTEENALRMHAT 239

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
              A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 240 TEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVL 284


>gi|151944571|gb|EDN62849.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae
           YJM789]
          Length = 396

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + +      + ++A
Sbjct: 181 VQIADSSNWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|6324371|ref|NP_014441.1| Mvd1p [Saccharomyces cerevisiae S288c]
 gi|1706682|sp|P32377|MVD1_YEAST RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Ergosterol biosynthesis protein 19; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase; Short=MDD;
           Short=MDDase
 gi|1235684|gb|AAC49252.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae]
 gi|1292890|emb|CAA66158.1| diphosphomevalonate decarboxylase [Saccharomyces cerevisiae]
 gi|1302550|emb|CAA96324.1| MVD1 [Saccharomyces cerevisiae]
 gi|285814690|tpg|DAA10584.1| TPA: Mvd1p [Saccharomyces cerevisiae S288c]
          Length = 396

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + +      + ++A
Sbjct: 181 VQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|190408959|gb|EDV12224.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae
           RM11-1a]
 gi|259148994|emb|CAY82238.1| Mvd1p [Saccharomyces cerevisiae EC1118]
 gi|323303229|gb|EGA57028.1| Mvd1p [Saccharomyces cerevisiae FostersB]
 gi|323331783|gb|EGA73196.1| Mvd1p [Saccharomyces cerevisiae AWRI796]
 gi|323335756|gb|EGA77037.1| Mvd1p [Saccharomyces cerevisiae Vin13]
 gi|323346764|gb|EGA81045.1| Mvd1p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323352485|gb|EGA84986.1| Mvd1p [Saccharomyces cerevisiae VL3]
          Length = 396

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + +      + ++A
Sbjct: 181 VQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|270293343|ref|ZP_06199552.1| diphosphomevalonate decarboxylase [Streptococcus sp. M143]
 gi|270278192|gb|EFA24040.1| diphosphomevalonate decarboxylase [Streptococcus sp. M143]
          Length = 317

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 165/297 (55%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ + S++
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ-LQSEA 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 71  EH-AKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLNRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   +  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEEDLEHLSEIF 297


>gi|255560311|ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gi|223539619|gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
          Length = 415

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 169/313 (53%), Gaps = 25/313 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  + D D + LNG+
Sbjct: 10  TAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGK 69

Query: 82  KIS-----SQSSFFKKTTQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS      Q+   +   + CD+           + + K++  I + NN PT AGLASSA
Sbjct: 70  EISLSGGRYQNCLREIRARACDVEDKEKGIKIAKKDWEKLHVHIASFNNFPTAAGLASSA 129

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G   +G DS AV 
Sbjct: 130 AGFACLVFALAKLMNAREDNSELSAIARQGSGSACRSLFGGFVKWIMGKVDDGSDSLAVQ 189

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 190 LVDEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRIIQMEEAIN 249

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
            +DF    ++   ++ + HA  +   PP+ Y    +   I  +E+ W+  +++  + +T 
Sbjct: 250 KRDFASFAQITCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEK-WNRSEETPQVAYTF 308

Query: 301 DAGPNLKLLFTHK 313
           DAGPN  L+  ++
Sbjct: 309 DAGPNAVLIAQNR 321


>gi|207341552|gb|EDZ69577.1| YNR043Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 396

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 109/323 (33%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   +  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAAIAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + +      + ++A
Sbjct: 181 VQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|322377082|ref|ZP_08051574.1| diphosphomevalonate decarboxylase [Streptococcus sp. M334]
 gi|321281795|gb|EFX58803.1| diphosphomevalonate decarboxylase [Streptococcus sp. M334]
          Length = 344

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 39  ANIAIIKYWGKKQEKEMVPATSSISLTLENMYTETTLSPLPTDATADVFYINGQ--LQNE 96

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 97  AEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRS 156

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 157 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 207

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D  ++   +   DF K+GE+ EKNAL MHAT 
Sbjct: 208 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQNMLVYLKGNDFAKVGELTEKNALAMHATT 267

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 268 KTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEIF 324


>gi|222152927|ref|YP_002562104.1| mevalonate diphosphate decarboxylase [Streptococcus uberis 0140J]
 gi|222113740|emb|CAR41735.1| mevalonate diphosphate decarboxylase [Streptococcus uberis 0140J]
          Length = 314

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 158/297 (53%), Gaps = 11/297 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIA+ KYWGK + +  +P  +S+SL+L ++ T T +  +D  A   +          + 
Sbjct: 12  ANIAIIKYWGKENQEKMIPSTSSISLTLENMYTETSLKRLDHGAQKDLFYIDDHLQDQAE 71

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
            +K +   D FR     +  + T NN+PT AGL+SS+SG +AL  A    +      + L
Sbjct: 72  HQKISAIIDQFRTDKNQFVEVRTRNNMPTAAGLSSSSSGLSALVKACNLFFDCRLNQKEL 131

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKK 207
           ++ A+  SGSA RSF+     W    D++  D + V       DL++ ++ ++  D  K 
Sbjct: 132 AQKAKFASGSASRSFFGPLSAW----DKDSGDIYQVE-----TDLKLAMIMLVVNDARKP 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M++ R  S  F QW QQ   D   +   + + DF K+G++ EKNAL MHAT   
Sbjct: 183 ISSREGMKLCRETSTTFDQWIQQSEQDYQEMLLYLKNNDFEKVGQLTEKNALAMHATTRT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           A P   Y  +++ Q M++V   R++    YFT+DAGPN+K+L   K  +++ + F E
Sbjct: 243 AKPSFSYLTEDSYQAMDKVKALREEGFQCYFTMDAGPNVKVLCLEKDLDSLSKRFAE 299


>gi|51013755|gb|AAT93171.1| YNR043W [Saccharomyces cerevisiae]
          Length = 396

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 170/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSSFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP ++  +L + D +K + S + M++T   S  F +  + +      + ++A
Sbjct: 181 VQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 241 IVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 300 TFDAGPNAVLYYLAENESKLFAF 322


>gi|312088278|ref|XP_003145798.1| diphosphomevalonate decarboxylase [Loa loa]
 gi|307759036|gb|EFO18270.1| diphosphomevalonate decarboxylase [Loa loa]
          Length = 314

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 140/287 (48%), Gaps = 20/287 (6%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQS 87
           P NIAL KYWGKR+  L LPLN+S+SLS+  L   T I +  S   D +++NG  I    
Sbjct: 19  PINIALVKYWGKRNEDLMLPLNDSISLSINDLCAKTRIRIGPSIKKDSVLINGSNIC--- 75

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K   F   F+  S+  F        P +AGLASSASGFAA+   L ++Y +     
Sbjct: 76  --LSKYPGFLRCFKVVSETSF--------PIEAGLASSASGFAAIAYGLGQVYHL--NIN 123

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDRE 205
            + RVAR+GSGSACRS   G   W  GT ++G D     V   + WP LR  +L      
Sbjct: 124 DVIRVARMGSGSACRSILSGLVHWKAGTAEDGADCICETVFPEDYWPTLRSLILVTSYDP 183

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KK+GS   M+ T   S         +   +  +K A  ++DF K  +V   ++ ++HA  
Sbjct: 184 KKVGSSNGMQSTVKTSKLLQARMDIVPEQITKLKNAFRNRDFEKFAQVIMSDSGQLHALC 243

Query: 266 IAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +   P L Y    +   M+ +   +   +S  + +T DAGPN  L  
Sbjct: 244 MDTMPSLRYLNNHSWYFMQLIHALNRHCKSTKVAYTFDAGPNCCLFL 290


>gi|307704244|ref|ZP_07641163.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK597]
 gi|307622155|gb|EFO01173.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK597]
          Length = 312

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIIDRYRPDGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVLCQEKDLEHLSEMF 297


>gi|9711347|dbj|BAB07818.1| mevalonate diphosphate decaroboxylase [Kitasatospora griseola]
          Length = 300

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 137/261 (52%), Gaps = 13/261 (4%)

Query: 74  DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAA 131
           D +  NG+  + ++   ++ T F  L R+ S       +ET N +PT AGLASSASGFAA
Sbjct: 21  DTVAFNGEPATGEAE--RRITAFLRLVRERSGRTERARVETENTVPTGAGLASSASGFAA 78

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVP 186
           L +A    Y +   +  LSR+AR GSGSA RS + GF  W  G      ++  + S+A P
Sbjct: 79  LAVAAAAAYGLGLDARGLSRLARRGSGSASRSIFDGFAVWHAGHAGGTPEEADLGSYAEP 138

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
                 +  + +  +    K + SREAM  T   SP +  W      DLA I  A+   +
Sbjct: 139 VPAVDLEPALVVAVVSAAPKAVSSREAMRRTVDTSPLYEPWAVSSRADLADIGAALARGN 198

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL 306
              +GE+AE+NAL MHATM+AA P + Y    ++  ++ V   R+  +P Y T+DAGPN+
Sbjct: 199 LPAVGEIAERNALGMHATMLAARPAVRYLSPASLAVLDGVLQLRRDGVPAYATMDAGPNV 258

Query: 307 KLLF----THKIEETIKQFFP 323
           K+L       ++ E ++   P
Sbjct: 259 KVLCPRSDAERVAEALRAAAP 279


>gi|332522362|ref|ZP_08398614.1| diphosphomevalonate decarboxylase [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313626|gb|EGJ26611.1| diphosphomevalonate decarboxylase [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 314

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 159/299 (53%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK D K  +P  +S+SL+L ++ T T +  +   +D D   ++ Q + SQ 
Sbjct: 12  ANIAIIKYWGKEDQKKMIPSTSSISLTLENMYTETQLQGLPKGADKDLFYIDDQ-LQSQE 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
              +K +   + FR    ++  + + NN+PT AGL+SS+SG +AL  A  + +       
Sbjct: 71  EH-EKISAIINQFRTPKDLFVQVRSRNNMPTAAGLSSSSSGLSALVKACNQFFETGLTQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGSA RSF+     W    D+N  D + V       DL++ ++ +I  D  
Sbjct: 130 QLAQKAKFASGSASRSFFGPLSAW----DKNSGDIYKVK-----TDLKLAMIMLILNDER 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++ R  S  F QW ++   D   + Q +   DF K+G + E+NAL MH T 
Sbjct: 181 KSISSRDGMKLCRQTSTTFDQWIRKSEVDYQEMLQYLESNDFEKVGLLTEENALAMHETT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             +SP   Y  + + Q M +V D R +    YFT+DAGPN+K+L   K  E +   F +
Sbjct: 241 RTSSPSFSYLTEASYQAMNKVRDMRSKGYQCYFTMDAGPNVKVLCLEKDLEELAHLFEQ 299


>gi|329947849|ref|ZP_08294781.1| diphosphomevalonate decarboxylase [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328523473|gb|EGF50571.1| diphosphomevalonate decarboxylase [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 344

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 170/323 (52%), Gaps = 20/323 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQ 81
           ++A   +NIAL KYWGK D  L +P  +SLSL+L    T T ++      D D + +NG 
Sbjct: 15  ATASANTNIALIKYWGKADESLMIPTTSSLSLTLDDTWTTTTVSFDGGTGDTDAVSINGS 74

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             S  +    + + F DL R+ S +     + + + +P  AGLASSA+GFAAL  A  R 
Sbjct: 75  APSGTA--LTRVSGFLDLVRERSGITQRANVTSISTVPLAAGLASSAAGFAALAAAASRA 132

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ----WPDLR 195
             +     +LSR+AR GSGSA RS + G   W  G D     S+A P  +       DL 
Sbjct: 133 AGMDLDGRALSRLARRGSGSAARSVFGGLVLWNAGDDD--ATSYAEPVQDAIGHTASDLD 190

Query: 196 IGLLKII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + ++ ++     K I S  AM  T   SP +  W +    DL    +A+   D  +LG+V
Sbjct: 191 LAMVVVVLSGGRKTISSTRAMRRTMTASPLYPAWVEASRQDLRDALEAVRCGDLARLGKV 250

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF--- 310
           AE NAL MHA+M+AA P ++YW   TI+ +  + + RQ  +P + T+DAGPN+K+L    
Sbjct: 251 AEANALGMHASMMAARPAIMYWLPRTIEVLHVIGEMRQDGLPAWATIDAGPNVKVLTRGG 310

Query: 311 -THKIEETIKQFFP--EITIIDP 330
              ++   +++  P  E+++  P
Sbjct: 311 SAERVAAALRERVPGAEVSVRRP 333


>gi|297827457|ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327450|gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 412

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 167/312 (53%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T ++V  S D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVSVSPSFDRDRMWLNGK 70

Query: 82  KISSQSSFFKKT-----TQFCDL----------FRQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++       ++  DL           + + K++  I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRSRADDLEDKEKGIKIEKKDWQKLHLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV 
Sbjct: 131 AGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAVQ 190

Query: 187 F--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
              +  W DL I +  +  REK+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LVDDKHWDDLVIIIAVVSSREKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+    +  I +T D
Sbjct: 251 NRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFD 310

Query: 302 AGPNLKLLFTHK 313
           AGPN  L+  ++
Sbjct: 311 AGPNAVLIARNR 322


>gi|149918167|ref|ZP_01906659.1| mevalonate diphosphate decarboxylase [Plesiocystis pacifica SIR-1]
 gi|149820927|gb|EDM80334.1| mevalonate diphosphate decarboxylase [Plesiocystis pacifica SIR-1]
          Length = 344

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 155/311 (49%), Gaps = 21/311 (6%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKR---DSKLNLPLNNSLSLSLGHLGTITHITVIDSDA- 73
           PK+   + A   SNIAL KYWGKR   D  LNLP   SLS++LG L T T +    +   
Sbjct: 2   PKLR-AARAVAHSNIALVKYWGKRAGVDPALNLPAVGSLSMTLGELRTDTTVAPAPAGGS 60

Query: 74  -----DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
                D  ++ G+  +   +   +      L  + ++   ++ + N++PT AGLASSASG
Sbjct: 61  DRFELDGALVEGKPAAKVFAHLDRLHALAGL--EGARPACVVTSINHLPTAAGLASSASG 118

Query: 129 FAALTLALFRIYSIPEKSESLSRV-----ARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           FAALT+A    Y + +  +  +R      +R GSGSA RS +  F     G  ++G D  
Sbjct: 119 FAALTVAAAGAYGLYDSLDGAARTRLSGWSRQGSGSAARSLWGAFVRLDAGAAEDGSDCI 178

Query: 184 AVPFNNQWPDLRIGLLKIIDRE---KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           A P            L ++      KK+GS   ME +R  SP++  W +    DL   + 
Sbjct: 179 ARPLEVPAALAADLRLLVVHTARGAKKVGSTGGMESSRLTSPYYGPWVESSPADLDAAEA 238

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYF-T 299
           A+  QDF  LG V E +  KMHA M+A  PPL+YW   T++ +  V   R    P  F T
Sbjct: 239 ALNAQDFDALGAVMEHSCFKMHACMLATVPPLIYWNGTTLEVIREVQSVRADGGPKGFVT 298

Query: 300 LDAGPNLKLLF 310
            DAGP++K+L 
Sbjct: 299 SDAGPHVKVLV 309


>gi|326910927|ref|NP_001192100.1| diphosphomevalonate decarboxylase [Acyrthosiphon pisum]
 gi|328705024|ref|XP_003242673.1| PREDICTED: diphosphomevalonate decarboxylase [Acyrthosiphon pisum]
          Length = 386

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 112/326 (34%), Positives = 164/326 (50%), Gaps = 26/326 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISS 85
           P NIA  KYWGKRD  L LPLN+S+SL+L         +V+     D D + LNGQ +S 
Sbjct: 10  PVNIATIKYWGKRDEHLILPLNDSVSLTLDCDQMHAKTSVLAGPFIDEDSVWLNGQIMSI 69

Query: 86  QSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           +++  K+  +  DL R           Q +K    + + NN PT AGLASSA+G+A L  
Sbjct: 70  ETN--KRLKKCFDLIRNLIRIRKGENSQEAKWNIRVCSENNFPTAAGLASSAAGYACLVY 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWP 192
            L   + + +  E L  +AR GSGSACRS Y GF  W  GTD  G DS AV    +  WP
Sbjct: 128 TLANAFGLVD--EDLPSIARQGSGSACRSIYGGFVHWKAGTDDLGSDSTAVQISADTHWP 185

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLG 251
           ++RI +L + D +KK  S   M+ +   S       Q+ +      I QAI D++F K  
Sbjct: 186 EMRIIILVVNDSQKKTSSTVGMKQSVKTSELLKYRIQKCVPERTNEIIQAITDKNFEKFA 245

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDAGPNLKLL 309
           E+  +++ + HA  +   PP +Y  + + + +  + D  +    I + +T DAGPN  L 
Sbjct: 246 EITMRDSNQFHAVCLDTYPPCVYLNQVSHEIISFIHDYNEAVGQIKVSYTFDAGPNAFLF 305

Query: 310 FTHKIEETIKQFFPEITIIDPLDSPD 335
              K    +  F  E+  + P   P+
Sbjct: 306 IQQK---DLSLFMSELVNVFPSQQPN 328


>gi|302795167|ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gi|300153115|gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
          Length = 403

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 160/313 (51%), Gaps = 24/313 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD  L LPLN+S+S++L       T T  T  D DAD + LN +
Sbjct: 13  TARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDK 72

Query: 82  KISSQSSFF---------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S  S  +                + T        +  +   I + NN PT AGLASSA
Sbjct: 73  EVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L   + ++  I E     LS +AR GSGSACRS + GF +W  G   +G DS AV
Sbjct: 133 AGFACLVFTVAQLMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMGKRDDGKDSIAV 192

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
           P   +++W DLRI +  +  R+K++ S   M+ +   SP      ++ +   +  +++A+
Sbjct: 193 PLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKRITEMEEAL 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
             +DF    ++   ++ + HAT +  SPP+ Y    +  I G+   W+  + S    +T 
Sbjct: 253 SKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTF 312

Query: 301 DAGPNLKLLFTHK 313
           DAGPN  +    K
Sbjct: 313 DAGPNAVIFVPQK 325


>gi|111115519|ref|YP_710137.1| mevalonate pyrophosphate decarboxylase [Borrelia afzelii PKo]
 gi|110890793|gb|ABH01961.1| mevalonate pyrophosphate decarboxylase [Borrelia afzelii PKo]
          Length = 312

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SDRDEIILNSKPVILQN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + +      
Sbjct: 65  --REKVFFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFD-KYSF 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDESYFNDLRIIFAIIDSSEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I +HH  ++  W   +++I  D  +     + +DF+  G    K+   M A
Sbjct: 178 ELSSRAAMNICKHHGFYYDAWIASSKKIFKDALYF---FLKKDFVHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IEETIK 319
            M A+S  + Y++  TI  ++     R + I ++ T+DAGP +K L   K    I + +K
Sbjct: 235 LMFASS--IFYFKNSTIDLIKYAAYLRNKGILVFETMDAGPQVKFLCLEKNLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F +I  I
Sbjct: 293 QNFTDIEFI 301


>gi|320161393|ref|YP_004174617.1| diphosphomevalonate decarboxylase [Anaerolinea thermophila UNI-1]
 gi|319995246|dbj|BAJ64017.1| diphosphomevalonate decarboxylase [Anaerolinea thermophila UNI-1]
          Length = 326

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 165/304 (54%), Gaps = 17/304 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILN 79
           +++A    NIA  KYWG RD+ L +P N S+S++L  L   T  TVI    S  D +ILN
Sbjct: 3   QATAIAHPNIAFIKYWGNRDAVLRIPENGSISMNLAELTVKT--TVIFEKHSREDTLILN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G    +     K+ + F D  R+F+ +  +  + + NN PT AG+ASSA+ FAAL LA  
Sbjct: 61  GAL--ADEPALKRVSHFLDRVREFAGISWHAHVISENNFPTGAGIASSAAAFAALALAAT 118

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG-TDQNGMDSFAVPFN--NQWPDL 194
               +      LSR+AR GSGSACRS   GF EWI G TD+   DS+AV       W  L
Sbjct: 119 SAIGLHLSERDLSRLARKGSGSACRSIPGGFVEWIPGETDE---DSYAVSIAPPEHW-AL 174

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
              +  +  + K IGS +   +    SP            L  +++AI+++DF+ L E+ 
Sbjct: 175 TDCIAILSTQHKPIGSTQGHALAST-SPLQPARVADTPRRLEIVRRAILERDFLSLAEMI 233

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E ++  MHA M+ ++PPL YW+  ++  M+ V + R+  +P  +TLDAGPN+ ++   + 
Sbjct: 234 EHDSNLMHAVMMTSTPPLFYWEPVSLVIMKSVREWRESGLPCAYTLDAGPNVHVICPSEY 293

Query: 315 EETI 318
            E +
Sbjct: 294 AEEV 297


>gi|331266992|ref|YP_004326622.1| diphosphomevalonate decarboxylase [Streptococcus oralis Uo5]
 gi|326683664|emb|CBZ01282.1| diphosphomevalonate decarboxylase [Streptococcus oralis Uo5]
          Length = 317

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIA+ KYWGKR  K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKRKEKEMVPATSSISLTLENMYTETTLSPLQAHATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNSYFQLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + +F K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENNFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    T + M+ V   R+Q    YFT+DAGPN+K+L   +  E + + F
Sbjct: 241 KTASPAFSYLTDATYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEEDLEHLSEIF 297


>gi|16417950|gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
          Length = 415

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 166/309 (53%), Gaps = 25/309 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDSDA-DCIILNGQ 81
           +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL T T + V  S A D + LNG+
Sbjct: 10  TAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVAVSPSFAQDRMWLNGK 69

Query: 82  KIS-----SQSSFFKKTTQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS      Q+   +   + CD+           + + K+Y  I + NN PT AGLASSA
Sbjct: 70  EISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLYVHIASYNNFPTAAGLASSA 129

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +W  G  ++G DS AV 
Sbjct: 130 AGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWKMGKVEDGSDSLAVQ 189

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  T   S       ++I    +  ++++I 
Sbjct: 190 VVDEKHWDDLVIIIAVVSSRQKETSSTTGMRETVETSLLLQHRAKEIVPKRIVQMEESIK 249

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
           +++F     +   ++ + HA  +   PP+ Y    +   I  +E+ W+    +  + +T 
Sbjct: 250 NRNFASFAHLTCADSNQFHAVCMDTCPPIFYMNDTSHRIISCVEK-WNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLL 309
           DAGPN  L+
Sbjct: 309 DAGPNAVLI 317


>gi|302821362|ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gi|300139887|gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
          Length = 403

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 159/313 (50%), Gaps = 24/313 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD  L LPLN+S+S++L       T T  T  D DAD + LN +
Sbjct: 13  TARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDK 72

Query: 82  KISSQSSFF---------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S  S  +                + T        +  +   I + NN PT AGLASSA
Sbjct: 73  EVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L   +  +  I E     LS +AR GSGSACRS + GF +W  G   +G DS AV
Sbjct: 133 AGFACLVFTVAELMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMGKRADGKDSIAV 192

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
           P   +++W DLRI +  +  R+K++ S   M+ +   SP      ++ +   +  +++A+
Sbjct: 193 PLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKRITEMEEAL 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
             +DF    ++   ++ + HAT +  SPP+ Y    +  I G+   W+  + S    +T 
Sbjct: 253 SKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTF 312

Query: 301 DAGPNLKLLFTHK 313
           DAGPN  +    K
Sbjct: 313 DAGPNAVIFVPQK 325


>gi|289620875|emb|CBI52609.1| unnamed protein product [Sordaria macrospora]
          Length = 394

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 166/317 (52%), Gaps = 22/317 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D ++L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDTKLNLPTNSSLSVTLSQADLRTLTTASCSASYPEGDSLLL 67

Query: 79  NGQK-----ISSQSSFFKKTTQFCDL------FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NG+         Q+ F +  T+   L        + S +   I + NN PT AGLASSA+
Sbjct: 68  NGEPSDVSGARPQACFRELRTRRAALEAADPSLPKLSTMPLRIVSENNFPTAAGLASSAA 127

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           GFAA   A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A  V
Sbjct: 128 GFAAFVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGEAADGTDSMADQV 187

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
              + WP++R  +L     +K + S   M+ T   S  F +  +  +  ++  +++AI +
Sbjct: 188 AEASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFQERIKSVVPKNMEIMEKAISE 247

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF    EV  +++   HAT     PP+ Y     +  I+ +E +  A  +++  Y T D
Sbjct: 248 RDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINAAAGRTVAAY-TFD 306

Query: 302 AGPNLKLLFTHKIEETI 318
           AGPN  + +  +  E +
Sbjct: 307 AGPNAVIYYLEQDTEAV 323


>gi|328705847|ref|XP_001950422.2| PREDICTED: diphosphomevalonate decarboxylase-like isoform 1
           [Acyrthosiphon pisum]
          Length = 390

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 166/326 (50%), Gaps = 26/326 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LPLN+S+SL+L      T  ++I       DC+ LNGQ +S 
Sbjct: 10  PVNIAVIKYWGKRDEHLILPLNDSVSLTLDCDQMHTKTSIIAGPFITEDCVWLNGQIMSI 69

Query: 86  QSSFFKKTTQFCDLFRQFSKVY-----------FLIETSNNIPTKAGLASSASGFAALTL 134
           + +  ++  +  DL R   K+              + + NN PT AGLASSA+G+A L  
Sbjct: 70  ERN--ERLKKCFDLIRNLIKIQKGENSQEVKWKIRVCSENNFPTAAGLASSAAGYACLVY 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWP 192
            L   + +   +  L  +AR GSGSACRS Y GF +W  G D  G DS AV    +  WP
Sbjct: 128 TLANAFGLV--NGDLPSIARQGSGSACRSIYGGFVQWTAGVDDQGYDSTAVQIAADTHWP 185

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLG 251
           ++RI +L + D +KK  S   M+     S       Q+ +      I QAI D++F K  
Sbjct: 186 EMRIIILVVNDSKKKTSSTVGMKQAVKTSELLKYRIQKCVPERTKEIIQAITDKNFEKFA 245

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDAGPNLKLL 309
           E+  +++ + HA  +   PP +Y  + + + +  V D  + +  I + +T  AGPN   L
Sbjct: 246 EITMRDSNQFHAICLDTYPPCVYLNQVSHEIISFVHDYNEATGQIKVSYTFYAGPN-AFL 304

Query: 310 FTHKIEETIKQFFPEITIIDPLDSPD 335
           F  +I+ ++  F  E+  + P   P+
Sbjct: 305 FIQQIDLSL--FMSELVNVFPTMQPN 328


>gi|258568314|ref|XP_002584901.1| diphosphomevalonate decarboxylase [Uncinocarpus reesii 1704]
 gi|237906347|gb|EEP80748.1| diphosphomevalonate decarboxylase [Uncinocarpus reesii 1704]
          Length = 403

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 161/327 (49%), Gaps = 25/327 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------DCI 76
           +SS   P NIA+ KYWGKRD  LNLP N+SLS++L       H T   SD+      D +
Sbjct: 10  RSSTTAPVNIAVIKYWGKRDETLNLPTNSSLSVTLSQADLRAHTTASCSDSYPHAQGDTL 69

Query: 77  ILNG--QKISSQSSFFKKTTQFCDLFR----------QFSKVYFLIETSNNIPTKAGLAS 124
            LNG  Q I +        +    L R          + S     I + NN PT AGLAS
Sbjct: 70  TLNGTPQDIRASKRTLACLSDLRILRRALEDANPSLPRLSAFPLRIVSENNFPTAAGLAS 129

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+  +G DS A
Sbjct: 130 SAAGFAALVRAVADLYELPQSPSELSRIARQGSGSACRSLMGGYVAWRAGSKGDGSDSIA 189

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQA 241
             V     WP++R  +L +   +K + S + M+ T   S  F    + I  + +A ++ A
Sbjct: 190 EQVAPAGHWPEMRALILVVSAAKKDVPSTKGMQSTFTTSTLFPTRAKSIVPERMAAMETA 249

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSIPIYF 298
           I + DF    E+  +++   HAT +   PP+ Y    +   +  V +  +   ++I  Y 
Sbjct: 250 IRNWDFKSFAEITMRDSNNFHATCLDTWPPIFYINDVSRAAINLVHEVNRIAGKAICAY- 308

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEI 325
           T DAGPN  + +  K    +   F +I
Sbjct: 309 TFDAGPNAVIYYLEKDSMQVLGTFRQI 335


>gi|306825826|ref|ZP_07459165.1| diphosphomevalonate decarboxylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432187|gb|EFM35164.1| diphosphomevalonate decarboxylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 317

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 163/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ + S++
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPKDATADAFYINGQ-LQSEA 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 71  EH-AKMSKIIDRYRPAGEGFVRIDTHNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + +F K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENNFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    T + M  V   R Q    YFT+DAGPN+K+L   K  + + + F
Sbjct: 241 KTASPAFSYLTDATYEAMNFVRQLRGQGEACYFTMDAGPNVKVLCQEKDLDHLSEIF 297


>gi|224097622|ref|XP_002311015.1| predicted protein [Populus trichocarpa]
 gi|222850835|gb|EEE88382.1| predicted protein [Populus trichocarpa]
          Length = 416

 Score =  145 bits (366), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 168/309 (54%), Gaps = 25/309 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGK 70

Query: 82  KIS-----SQSSFFKKTTQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS      Q+   +   + C +           + + K++  + + NN PT AGLASSA
Sbjct: 71  EISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G  ++G DS AV 
Sbjct: 131 AGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAEDGSDSLAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W +L I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKRIKQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
           ++DF    +++  ++ + HA  +   PP+ Y    +   I  +E+ W+  + +  + +T 
Sbjct: 251 NRDFGSFAQLSCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEK-WNCSEGTPQVAYTF 309

Query: 301 DAGPNLKLL 309
           DAGPN  L+
Sbjct: 310 DAGPNAVLI 318


>gi|306828924|ref|ZP_07462116.1| diphosphomevalonate decarboxylase [Streptococcus mitis ATCC 6249]
 gi|304429102|gb|EFM32190.1| diphosphomevalonate decarboxylase [Streptococcus mitis ATCC 6249]
          Length = 317

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGKR  K  +P  +S+SL+L ++ T T ++ +   + AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKRKEKEMVPATSSISLTLENMYTETTLSPLPAHATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ E+NAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFTKVGELTEENALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    T + M+ V   R+Q    YFT+DAGPN+K+L   K  E + +  
Sbjct: 241 KTASPAFSYLTDATYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLSELL 297


>gi|328773164|gb|EGF83201.1| hypothetical protein BATDEDRAFT_34046 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 783

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 109/342 (31%), Positives = 161/342 (47%), Gaps = 44/342 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHI-TVIDS--DADCIILNGQKI 83
           P NIA+ KYWGKRD++L LP N+SLS++L   HL + T I T  D+  + D + LN  ++
Sbjct: 368 PVNIAVVKYWGKRDTQLLLPTNSSLSVTLSQDHLRSTTTIHTATDASLERDRLWLNHSEV 427

Query: 84  S-SQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGFAA 131
           + + SS  +         R+            S     I + NN PT AGLASSASGFA 
Sbjct: 428 NIAASSRLRNVLAEARRLRRTVEEANPTLPILSTCPLHIASVNNFPTAAGLASSASGFAC 487

Query: 132 LTLALFRIYSI--PEKSES---------LSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           +  AL +++ +  P    +         LSR+AR+GSGSACRS + GF  W  G   +G+
Sbjct: 488 MVYALDQLFELNGPNTQTADLQTRHLSDLSRLARIGSGSACRSLFGGFVAWDMGDRLDGL 547

Query: 181 DSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAH 237
           DS AV  + +  WPDL   +L + D +K  GS   M+ T   S         +  D +  
Sbjct: 548 DSVAVQVDTELHWPDLEALILVVSDAQKDTGSTVGMQRTVETSALLQHRIHHVVPDRMVE 607

Query: 238 IKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK---------ETIQGMERVWD 288
           +  AI  +DF    ++  +++ + HA  +   PP+ Y                 +  V  
Sbjct: 608 MTNAIHCKDFDTFAKLTMQDSNQFHAVCLDTFPPISYMNDISRAIVRLITAYNDLFTVES 667

Query: 289 ARQQSIPIYFTLDAGPNLKLLFTHK----IEETIKQFFPEIT 326
              +   + +T DAGPN  L    K    +   I  FFP+ T
Sbjct: 668 GTAKGYRVAYTFDAGPNAVLYLPRKHVAEVLGLINHFFPQPT 709


>gi|216263644|ref|ZP_03435639.1| diphosphomevalonate decarboxylase [Borrelia afzelii ACA-1]
 gi|215980488|gb|EEC21309.1| diphosphomevalonate decarboxylase [Borrelia afzelii ACA-1]
          Length = 312

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 164/309 (53%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SDRDEIILNSKPVILQN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + +      
Sbjct: 65  --REKVFFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFD-KYSF 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDESYFNDLRIIFAIIDSSEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I +HH  ++  W   +++I  D  +     + +DF+  G    K+   M A
Sbjct: 178 ELSSRAAMNICKHHGFYYDAWIASSKKIFKDALYF---FLKKDFVHFGANIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IEETIK 319
            M A+S  + Y++  TI  ++     R + I ++ T+DAGP +K L   K    I + +K
Sbjct: 235 LMFASS--IFYFKNSTIDLIKYAAYLRNKGILVFETMDAGPQVKFLCLEKNLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F +I  I
Sbjct: 293 QNFTDIEFI 301


>gi|307710529|ref|ZP_07646965.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK564]
 gi|307618682|gb|EFN97822.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK564]
          Length = 317

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 157/288 (54%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +N Q      
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYINDQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R     +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIIDRYRPAGGGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLTRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF+K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFVKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEK 288


>gi|297820160|ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297323801|gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 419

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 169/312 (54%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  + D D + LNG+
Sbjct: 11  TAKTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGK 70

Query: 82  KISSQSSFFKKT-----TQFCDL----------FRQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++       ++  D+           + + K++  I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV 
Sbjct: 131 AGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T D
Sbjct: 251 NRDFASFTQLTCTDSNQFHAVCVDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFD 310

Query: 302 AGPNLKLLFTHK 313
           AGPN  L+  ++
Sbjct: 311 AGPNAVLIARNR 322


>gi|229552296|ref|ZP_04441021.1| possible diphosphomevalonate decarboxylase [Lactobacillus rhamnosus
           LMS2-1]
 gi|229314278|gb|EEN80251.1| possible diphosphomevalonate decarboxylase [Lactobacillus rhamnosus
           LMS2-1]
          Length = 341

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 160/287 (55%), Gaps = 13/287 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + +L LP  +S+SL+L    T T +T   + D D   LN Q  S  + 
Sbjct: 16  TNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPALDQDQFTLNHQMQSPTA- 74

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +    
Sbjct: 75  ----VSRFLDHVRHLAQIDTRARVNSLNHVPTAAGLASSASAFAALALATSRAAGLNLTP 130

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL--RIGLLKIIDR 204
            +LSR+AR GSGSA RS + G   W  G+D     SFA P   Q P L  R+ ++ + D+
Sbjct: 131 TALSRLARRGSGSATRSIFGGAVIWHRGSDDQS--SFAEPLTIQ-PTLPLRMLVVTVSDQ 187

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MHA 
Sbjct: 188 KKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMHAA 247

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T
Sbjct: 248 IMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTT 294


>gi|303389554|ref|XP_003073009.1| mevalonate pyrophosphate decarboxylase [Encephalitozoon
           intestinalis ATCC 50506]
 gi|303302153|gb|ADM11649.1| mevalonate pyrophosphate decarboxylase [Encephalitozoon
           intestinalis ATCC 50506]
          Length = 302

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 150/300 (50%), Gaps = 17/300 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIA+ KYWGK D+  N P N+S+S  L +  T T  TV  S++D   LNG+ +S    F 
Sbjct: 14  NIAVIKYWGKVDTINNTPSNSSVSFPLTNFQTET--TVEYSNSDRFYLNGEMLS----FG 67

Query: 91  KKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
           KK +Q  ++FR  S  +    + + NN P   GLASSASGFAAL LAL   Y +    E 
Sbjct: 68  KKMSQVVEIFRTRSGDRRSICVRSFNNFPHSCGLASSASGFAALALALDDFYGLKTSEEE 127

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKI 208
           L R+AR+GSGSA RS   G          +  D   V     W +++I  + +    KKI
Sbjct: 128 LCRIARIGSGSAGRSISPGI---------HLFDGVFVEKLPSWREIKILSIVLSKDPKKI 178

Query: 209 GSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
           GS E M  TR  S F+ +   ++   +  + + I  +DF     +  + + + H  ++  
Sbjct: 179 GSTEGMIRTRETSEFYQERLARMKEKVEAMAKCISQKDFDGFAYLTMRESNEFHGMLMET 238

Query: 269 SPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITII 328
            PP+ Y + +  Q +E      +  + + +T DAGPN  ++   +  + +K FF    ++
Sbjct: 239 YPPIRYIKDDGFQVIEMCHRFNRDKVRVAYTFDAGPNPFIITLEQYLKEVKDFFRAYELV 298


>gi|260943830|ref|XP_002616213.1| hypothetical protein CLUG_03454 [Clavispora lusitaniae ATCC 42720]
 gi|238849862|gb|EEQ39326.1| hypothetical protein CLUG_03454 [Clavispora lusitaniae ATCC 42720]
          Length = 385

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 171/331 (51%), Gaps = 35/331 (10%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +   +    D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDLRTLTSVATSEEFSKDNLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFR-------------QFSKVYFLIETSNNIPTKAGLASS 125
                +     + T  C  DL R             + S+    I + NN PT AGLASS
Sbjct: 66  ----VEEGIKGERTIACLKDLRRLRKELEEQDSSLPKLSEWGLHIVSENNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G  +NG DS AV
Sbjct: 122 AAGFAALVVAIAKLYKLPQSMSEISKIARKGSGSACRSLFGGYVAWEMGDLENGEDSKAV 181

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW--TQQISTDLAHIKQA 241
                  WP ++  +L + D +K   S   M+ T   S  F QW   + +      +K++
Sbjct: 182 EVAPLEHWPTMKAAILVVSDDKKDTPSTTGMQSTVATSDLF-QWRIKEVVPKRFEQMKKS 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I ++DF   GE+  K++   HA  + + PP+ Y     K+ I+ + ++ + ++  I   +
Sbjct: 241 IAERDFQTFGELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKLIHKL-NEQEGKIIAAY 299

Query: 299 TLDAGPNLKLLFTH----KIEETIKQFFPEI 325
           T DAGPN  + +      K+   I ++F ++
Sbjct: 300 TFDAGPNAVIYYEEENVTKVLGLIHKYFHQV 330


>gi|293364808|ref|ZP_06611525.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|307703057|ref|ZP_07640004.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|291316258|gb|EFE56694.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|307623450|gb|EFO02440.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
          Length = 317

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  + +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKISKIINRYRPEGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    +++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----NKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFTKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVHQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|258539705|ref|YP_003174204.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus Lc 705]
 gi|257151381|emb|CAR90353.1| Diphosphomevalonate decarboxylase [Lactobacillus rhamnosus Lc 705]
          Length = 334

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 160/287 (55%), Gaps = 13/287 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + +L LP  +S+SL+L    T T +T   + D D   LN Q  S  + 
Sbjct: 9   TNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPALDQDQFTLNHQMQSPTA- 67

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +    
Sbjct: 68  ----VSRFLDHVRHLAQIDTRARVNSLNHVPTAAGLASSASAFAALALATSRAAGLNLTP 123

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL--RIGLLKIIDR 204
            +LSR+AR GSGSA RS + G   W  G+D     SFA P   Q P L  R+ ++ + D+
Sbjct: 124 TALSRLARRGSGSATRSIFGGAVIWHRGSDDQS--SFAEPLTIQ-PTLPLRMLVVTVSDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MHA 
Sbjct: 181 KKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMHAA 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T
Sbjct: 241 IMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTT 287


>gi|319940310|ref|ZP_08014661.1| diphosphomevalonate decarboxylase [Streptococcus anginosus
           1_2_62CV]
 gi|319810497|gb|EFW06836.1| diphosphomevalonate decarboxylase [Streptococcus anginosus
           1_2_62CV]
          Length = 314

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 164/298 (55%), Gaps = 18/298 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+D+   +P  +S+SL+L ++ T T ++   + + +D   +NG  +    
Sbjct: 12  ANIAIIKYWGKKDTVKIIPATSSISLTLENMYTETTLSSLPVSAQSDEFYING--VLQDQ 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +  KK +   D FR     +  I+T NN+PT AGL+SS+SG +AL  A    + +   ++
Sbjct: 70  AEHKKMSNIVDRFRPQGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNDFFELHLSTK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
              + A+L SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 EQVQKAKLASGSSSRSFYGPIAAW----DKDSGEIYPVK-----TDLKLAMIMLVLYDQK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F+ W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSREGMKRCAETSTIFSDWVRQSEEDYKAMLTYLSNNDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
             A+P   Y  +++ + M+ +   R Q    YFT+DAGPN+K+L    +EE ++   P
Sbjct: 241 QTATPAFSYLTEKSYEAMDFIKQLRSQGERCYFTMDAGPNVKVLC---LEEDLEHLVP 295


>gi|21593039|gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
          Length = 404

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 163/312 (52%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  S D D + LNG+
Sbjct: 3   TAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLNGK 62

Query: 82  KISSQSSFFK---------------KTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++               K        + + K++  I + NN PT AGLASSA
Sbjct: 63  EISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLASSA 122

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV 
Sbjct: 123 AGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAVQ 182

Query: 187 F--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
              +  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 183 LVDDKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAIK 242

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+    +  I +T D
Sbjct: 243 NRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFD 302

Query: 302 AGPNLKLLFTHK 313
           AGPN  ++  ++
Sbjct: 303 AGPNAVMIARNR 314


>gi|164423595|ref|XP_001728068.1| diphosphomevalonate decarboxylase [Neurospora crassa OR74A]
 gi|157070160|gb|EDO64977.1| diphosphomevalonate decarboxylase [Neurospora crassa OR74A]
 gi|206597125|dbj|BAG71667.1| diphosphomevalonate decarboxylase [Neurospora crassa]
          Length = 394

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 170/329 (51%), Gaps = 23/329 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCIIL 78
           ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D ++L
Sbjct: 8   RASTTAPVNIAVVKYWGKRDTKLNLPTNSSLSVTLSQADLRTLTTASCSASYPEGDSLLL 67

Query: 79  NGQK-----ISSQSSFFKKTTQFCDL------FRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NG+         Q+ F +   +   L        + S +   I + NN PT AGLASSA+
Sbjct: 68  NGEPSDVSGARPQACFRELRARRAALEAADPSLPKLSTMPLRIVSENNFPTAAGLASSAA 127

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           GFAA   A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A  V
Sbjct: 128 GFAAFVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGEAADGSDSMADQV 187

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIID 244
              + WP++R  +L     +K + S   M+ T   S  F +  T  +  ++  +++AI +
Sbjct: 188 AEASHWPEMRALILVASAAKKGVSSTSGMQQTVATSSLFKERITSVVPKNMEIMEKAIAE 247

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLD 301
           +DF    EV  +++   HAT     PP+ Y     +  I+ +E +  A  +S+  Y T D
Sbjct: 248 RDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINAAAGRSVAAY-TFD 306

Query: 302 AGPNLKLLFTHK-IEETIKQFFPEITIID 329
           AGPN  + +  +  E  +   +  ++ +D
Sbjct: 307 AGPNAVIYYLEQDTEAVVGNLYSVLSKVD 335


>gi|290580617|ref|YP_003485009.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           NN2025]
 gi|254997516|dbj|BAH88117.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           NN2025]
          Length = 320

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 168/298 (56%), Gaps = 14/298 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIA+ KYWGK ++K  +P  +S+SL+L ++ T T +T++ +++AD   ++   I    +
Sbjct: 22  ANIAIIKYWGKTNTKKMIPATSSISLTLENMYTETRLTLLRNAEADEFYIDH--ILQNEA 79

Query: 89  FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
             +K ++  D FR+ +  +  +ETSNN+PT AGL+SS+SG +AL  A    +      E 
Sbjct: 80  EHRKISKVLDFFRKETPFFVKVETSNNMPTAAGLSSSSSGLSALVKAANIFFETNATQEE 139

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREK 206
           L+++A+  SGS+ RSF+     W    D++  + + VP      DL++ ++ ++  D  K
Sbjct: 140 LAQIAKFASGSSSRSFFGPLTAW----DKDSGEIYPVP-----SDLKLAMIMLVLNDTRK 190

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I SR+ M+     S  F  W  Q   D   +   +   DF K+G++ E NAL MHAT  
Sbjct: 191 PISSRQGMQRCSETSTNFADWIAQSEKDYVAMLDYLKAADFEKVGDLTEANALAMHATTR 250

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A+PP  Y  K + Q MERV + R+Q    YFT+DAGPN+K+L   K  E + + F +
Sbjct: 251 TANPPFSYLTKASYQAMERVKELRRQGERCYFTMDAGPNVKVLCLEKDLERLSRIFAQ 308


>gi|13786942|pdb|1FI4|A Chain A, The X-Ray Crystal Structure Of Mevalonate 5-Diphosphate
           Decarboxylase At 2.3 Angstrom Resolution
          Length = 416

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 109/323 (33%), Positives = 168/323 (52%), Gaps = 31/323 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 26  ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 85

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 86  EP----HSIDNERTQNCLRDL-RQLRKEXESKDASLPTLSQWKLHIVSENNFPTAAGLAS 140

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 141 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEXGKAEDGHDSXA 200

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQA 241
           V    ++ WP  +  +L + D +K + S +  ++T   S  F +  + +      + ++A
Sbjct: 201 VQIADSSDWPQXKACVLVVSDIKKDVSSTQGXQLTVATSELFKERIEHVVPKRFEVXRKA 260

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I+++DF    +    ++   HAT + + PP+ Y     K  I     +     ++I + +
Sbjct: 261 IVEKDFATFAKETXXDSNSFHATCLDSFPPIFYXNDTSKRIISWCHTINQFYGETI-VAY 319

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           T DAGPN  L +  + E  +  F
Sbjct: 320 TFDAGPNAVLYYLAENESKLFAF 342


>gi|24379381|ref|NP_721336.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           UA159]
 gi|24377310|gb|AAN58642.1|AE014934_6 putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           UA159]
          Length = 310

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 168/298 (56%), Gaps = 14/298 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSS 88
           +NIA+ KYWGK ++K  +P  +S+SL+L ++ T T +T++ +++AD   ++   I    +
Sbjct: 12  ANIAIIKYWGKTNTKKMIPATSSISLTLENMYTETRLTLLRNAEADEFYIDH--ILQNEA 69

Query: 89  FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
             +K ++  D FR+ +  +  +ETSNN+PT AGL+SS+SG +AL  A    +      E 
Sbjct: 70  EHRKISKVLDFFRKETPFFVKVETSNNMPTAAGLSSSSSGLSALVKAANIFFETNATQEE 129

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREK 206
           L+++A+  SGS+ RSF+     W    D++  + + VP      DL++ ++ ++  D  K
Sbjct: 130 LAQIAKFASGSSSRSFFGPLTAW----DKDSGEIYPVP-----SDLKLAMIMLVLNDTRK 180

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            I SR+ M+     S  F  W  Q   D   +   +   DF K+G++ E NAL MHAT  
Sbjct: 181 PISSRQGMQRCSETSTNFADWIAQSEKDYVAMLDYLKAADFEKVGDLTEANALAMHATTR 240

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            A+PP  Y  K + Q MERV + R+Q    YFT+DAGPN+K+L   K  E + + F +
Sbjct: 241 TANPPFSYLTKASYQAMERVKELRRQGERCYFTMDAGPNIKVLCLEKDLERLSRIFAQ 298


>gi|307708221|ref|ZP_07644688.1| diphosphomevalonate decarboxylase [Streptococcus mitis NCTC 12261]
 gi|307615667|gb|EFN94873.1| diphosphomevalonate decarboxylase [Streptococcus mitis NCTC 12261]
          Length = 317

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T +  +  D+ AD   +NG  + S++
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETALLPLPTDATADVFYINGL-LQSEA 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
              K  ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 71  EHVK-MSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLTRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W  Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVCQSEKDYQDMLLYLKENDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|315222755|ref|ZP_07864643.1| diphosphomevalonate decarboxylase [Streptococcus anginosus F0211]
 gi|315188168|gb|EFU21895.1| diphosphomevalonate decarboxylase [Streptococcus anginosus F0211]
          Length = 314

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 165/298 (55%), Gaps = 18/298 (6%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+D+   +P  +S+SL+L ++ T T ++   + + +D   +NG  +    
Sbjct: 12  ANIAIIKYWGKKDTVKIIPATSSISLTLENMYTETTLSSLPVSAQSDEFYING--VLQDQ 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +  KK +   D FR     +  I+T NN+PT AGL+SS+SG +AL  A    + +   ++
Sbjct: 70  AEHKKMSNIIDRFRPQGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNDFFELHLSTK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
             ++ A+L SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 EQAQKAKLASGSSSRSFYGPIAAW----DKDSGEIYPVK-----TDLKLAMIMLVLYDQK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F+ W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSREGMKRCAETSTTFSDWVRQSEEDYKAMLTYLSNNDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
             A+P   Y  +++ + M+ +   R Q    YFT+DAGPN+K+L    +EE ++   P
Sbjct: 241 QTATPVFSYLTEKSYEAMDFIKQLRSQGERCYFTMDAGPNVKVLC---LEEDLEHLVP 295


>gi|15224931|ref|NP_181404.1| MVD1 (MEVALONATE DIPHOSPHATE DECARBOXYLASE 1); diphosphomevalonate
           decarboxylase/ protein homodimerization [Arabidopsis
           thaliana]
 gi|2288887|emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|3250736|emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|3786002|gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|31711704|gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 gi|110736665|dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|330254480|gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
          Length = 412

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 163/312 (52%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  S D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLNGK 70

Query: 82  KISSQSSFFK---------------KTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++               K        + + K++  I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV 
Sbjct: 131 AGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAVQ 190

Query: 187 F--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
              +  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LVDDKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+    +  I +T D
Sbjct: 251 NRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFD 310

Query: 302 AGPNLKLLFTHK 313
           AGPN  ++  ++
Sbjct: 311 AGPNAVMIARNR 322


>gi|260794527|ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gi|229277476|gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
          Length = 409

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 164/322 (50%), Gaps = 34/322 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N SLS++L         TV    D   D + LNGQ+ S 
Sbjct: 22  PVNIAVIKYWGKRDEQLVLPINPSLSVTLSQDQLCARTTVAASADFKRDRVWLNGQEQSV 81

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFLIE-------------TSNNIPTKAGLASSASGFAAL 132
            +   +K     ++ R   K     E             + NN PT AGLASSA+G+A L
Sbjct: 82  DAPRLQKC--LGEIRRLARKRKHKDERAGDLLGSCVHVCSENNFPTAAGLASSAAGYACL 139

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
             +L +++ I      +S +AR GSGSACRS Y GF EW  G  ++G DS A  V     
Sbjct: 140 VQSLAKLFHI---DGDVSHIARQGSGSACRSMYGGFVEWTMGRLEDGADSVAKQVAPAEH 196

Query: 191 WPDLRIGLLKIIDREKK-IGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFI 248
           WP+LR+ L+ +++  KK +GS E M+ T   S       +  + +    ++QAI+++DF 
Sbjct: 197 WPELRV-LVAVVNAGKKAVGSTEGMQTTVKTSALVKYRAEHVVPSRQEDMRQAILERDFQ 255

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPN 305
             GE+  K++ + HAT +   PP+ Y     K  I  + R ++     I   +T DAGPN
Sbjct: 256 TFGEITMKDSNQFHATCLDTYPPIFYLNETSKHIIHLVHR-YNRHHGKIKAAYTFDAGPN 314

Query: 306 LKL-LFTHKIEET---IKQFFP 323
             L L    + E    ++ FFP
Sbjct: 315 AVLYLLQDDVPEVLALLRHFFP 336


>gi|194894289|ref|XP_001978042.1| GG17907 [Drosophila erecta]
 gi|190649691|gb|EDV46969.1| GG17907 [Drosophila erecta]
          Length = 388

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 161/328 (49%), Gaps = 30/328 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNGQKISS 85
           P NIAL KYWGKR   L LP+N+S+S++L         TV  S+    + + LNG+++  
Sbjct: 9   PVNIALIKYWGKRHEDLILPVNDSISMTLSTDELCAKTTVTASETFERNRMWLNGEEVP- 67

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-------------IETSNNIPTKAGLASSASGFAAL 132
               F++ ++     ++  ++                I + NN PT AGLASSA+G+A L
Sbjct: 68  ----FEEGSRLQRCLKEVHRLAVAKGSQKVPPSWKLHIASVNNFPTAAGLASSAAGYACL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
             +L R+Y IP  +E L+ VAR GSGSACRS Y GF +W  G   NG DS A  +  ++ 
Sbjct: 124 VYSLSRLYDIP-LNEELTTVARQGSGSACRSLYGGFVQWHRGALDNGSDSVAKQIAPSDH 182

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WPD+ + +L + D  KK  S   M+ +   S        Q+  D +  ++QAI   DF  
Sbjct: 183 WPDMHVLILVVNDARKKTASTRGMQQSVKTSQLIKHRVDQVVPDRITKLRQAIRSHDFQT 242

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLK 307
             E+  K++ + HA  +   PP +Y      +I      ++ R  S    +T DAGPN  
Sbjct: 243 FAEITMKDSNQFHAVALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNAC 302

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPD 335
           L   + + E +      +  + P D  D
Sbjct: 303 L---YVLAENVPHLLSAVQKVFPNDLTD 327


>gi|322374889|ref|ZP_08049403.1| diphosphomevalonate decarboxylase [Streptococcus sp. C300]
 gi|321280389|gb|EFX57428.1| diphosphomevalonate decarboxylase [Streptococcus sp. C300]
          Length = 317

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +   + AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPAHATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  + +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMSKIINRYRPEGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQLGLNRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFGDWVRQSEKDYQDMLVYLKENDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|18410026|ref|NP_566995.1| mevalonate diphosphate decarboxylase, putative [Arabidopsis
           thaliana]
 gi|332645683|gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
          Length = 419

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 167/312 (53%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  + D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGK 70

Query: 82  KISSQSSFFK--------KTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++        +     D+ +        + K+   I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV 
Sbjct: 131 AGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T D
Sbjct: 251 NRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFD 310

Query: 302 AGPNLKLLFTHK 313
           AGPN  L+  ++
Sbjct: 311 AGPNAVLIARNR 322


>gi|301755146|ref|XP_002913420.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate
           decarboxylase-like [Ailuropoda melanoleuca]
          Length = 400

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 113/328 (34%), Positives = 169/328 (51%), Gaps = 31/328 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKIS- 84
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   +  D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWLNGREEDV 74

Query: 85  SQSSFFKKTTQFCDLFRQFS--------------KVYFLIETSNNIPTKAGLASSASGFA 130
            Q        +   L R+ S              KV+  I + NN PT AGLASSA+G+A
Sbjct: 75  GQPRLQACLREIRRLARKRSSAGEEXPLPLSLSYKVH--IASVNNFPTAAGLASSAAGYA 132

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFN 188
            L  AL R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   
Sbjct: 133 CLAYALARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGERADGKDSIARQVAPE 189

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDF 247
           + WP+LR+ +L +   +K +GS   M+ +   SP    +    +   +A + + + ++DF
Sbjct: 190 SHWPELRVLILVVSAEKKPMGSTAGMQTSVETSPLLRFRAESVVPARMAEMTRCVQERDF 249

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
              G++  K++ + HAT +   PP+ Y    +  I  +   ++A      + +T DAGPN
Sbjct: 250 QGFGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIVHLVHRFNAHHGQTKVAYTFDAGPN 309

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDS 333
             ++FT  +++T+ +F   +    P +S
Sbjct: 310 -AVVFT--LDDTVPEFVAAVRHCFPPES 334


>gi|19114939|ref|NP_594027.1| diphosphomevalonate decarboxylase (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74626617|sp|O13963|MVD1_SCHPO RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
 gi|2330786|emb|CAB11260.1| diphosphomevalonate decarboxylase (predicted) [Schizosaccharomyces
           pombe]
          Length = 393

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 106/323 (32%), Positives = 161/323 (49%), Gaps = 30/323 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISS 85
           P NIA+ KYWGKRD  LNLP N+S+S++L    L T+T  +  +  + D + LNG   ++
Sbjct: 13  PVNIAVIKYWGKRDVALNLPTNSSISVTLSQDDLRTVTTASCSEKFENDTLWLNG---NA 69

Query: 86  QSSFFKKTTQFC---------------DLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
           +  F  K  + C               D   +   +   + + NN PT AGLASSA+G+A
Sbjct: 70  EEIFANKRLRVCVEELRKARLDLEEENDDLDKIGALKLHVVSENNFPTAAGLASSAAGYA 129

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV---PF 187
           A   A+ R+Y +P     LSR+AR GSGSACRS + G+  W  G   +G DS AV   P 
Sbjct: 130 AFCEAIARLYDLPWTPTQLSRIARQGSGSACRSLFGGYVAWEMGELHSGADSVAVQVEPV 189

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQD 246
            N WP++R+ +L     +K + S   M+ T   S  F    Q I    +  +K AI ++D
Sbjct: 190 EN-WPEIRVAVLVASAAKKGVSSTAGMQATVASSTLFQHRIQNIVPQRIQEMKTAIRERD 248

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAG 303
           F    ++   ++ + HA  +   PP+ Y     +  I+ +E +     ++I  Y T DAG
Sbjct: 249 FETFAKLTMTDSNQFHACCLDTFPPIFYLNDTSRAVIRVVENINATAGKTIAAY-TFDAG 307

Query: 304 PNLKLLFTHKIEETIKQFFPEIT 326
           PN  + F  +  E +      +T
Sbjct: 308 PNAVIYFLEENSEIVLNTLYAVT 330


>gi|226287852|gb|EEH43365.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb18]
          Length = 388

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 160/317 (50%), Gaps = 31/317 (9%)

Query: 36  KYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDA-DCIILNGQKISSQSSF 89
           +YWGKRD+ LNLP N+SLS++L       + T        +DA D + LN +  S Q S 
Sbjct: 5   RYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPTDAGDTLTLNSEPHSIQDS- 63

Query: 90  FKKTTQFC--DL--FRQ-----------FSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
             K T  C  DL   RQ            S     I + NN PT AGLASSA+GFAAL  
Sbjct: 64  --KRTLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAGLASSAAGFAALVC 121

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWP 192
           A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+DS A  V   + WP
Sbjct: 122 AIANLYKLPQSPRELSRIARQGSGSACRSMMGGYVAWRAGVLEDGIDSLAEEVAPASHWP 181

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIIDQDFIKLG 251
           D+R  +L + D +K++ S + M+ T   S  F T+    +   +  I+ AI ++DF    
Sbjct: 182 DMRALILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARITAIEAAIQNRDFPSFA 241

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ---QSIPIYFTLDAGPNLKL 308
           E+  +++   HAT +   PP  Y    +   +  V D  +   ++I  Y T DAGPN  +
Sbjct: 242 EITMRDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETICAY-TFDAGPNAVI 300

Query: 309 LFTHKIEETIKQFFPEI 325
            +  K  E +   F  I
Sbjct: 301 YYLKKESERVIGTFKSI 317


>gi|322391508|ref|ZP_08064977.1| diphosphomevalonate decarboxylase [Streptococcus peroris ATCC
           700780]
 gi|321145591|gb|EFX40983.1| diphosphomevalonate decarboxylase [Streptococcus peroris ATCC
           700780]
          Length = 317

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 156/284 (54%), Gaps = 15/284 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK++ K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKNEKEMVPATSSISLTLENMYTETTLSPLPTDAKADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K ++  D +R     +  I+T NN+PT AGL+SS+SG +AL       + +    +
Sbjct: 70  AEHAKMSKIIDRYRPEGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKVCNAYFQLGLNRK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L+  A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 ELALEAKFASGSSSRSFYGPLAAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDQK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFEDWVRQSEQDYKDMLSYLKENDFKKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
             A+P   Y    + + M+ V   R+Q    YFT+DAGPN+K+L
Sbjct: 241 KTATPSFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVL 284


>gi|154278631|ref|XP_001540129.1| hypothetical protein HCAG_05596 [Ajellomyces capsulatus NAm1]
 gi|150413714|gb|EDN09097.1| hypothetical protein HCAG_05596 [Ajellomyces capsulatus NAm1]
          Length = 371

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 155/313 (49%), Gaps = 25/313 (7%)

Query: 37  YWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDA-DCIILNGQK-------- 82
           YWGKRD+ LNLP N+SLS++L       + T        +DA D + LN Q         
Sbjct: 7   YWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPTYPTDAGDSLTLNSQPQNIKDSKR 66

Query: 83  ----ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
               +S   S  ++         + S     I + NN PT AGLASSA+GFAAL  A+  
Sbjct: 67  TLACLSDLRSLRRELENANPSLPKLSGFPLRIVSENNFPTAAGLASSAAGFAALVRAVAN 126

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRI 196
           +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSFA  V   + WP++R 
Sbjct: 127 LYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRTGVLEDGSDSFAEEVAPASHWPEMRA 186

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
            +L + D +K + S + M+ T   S  F T+    +   +A I+ AI ++DF    E+  
Sbjct: 187 LILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIESAIKNRDFASFAEITM 246

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYFTLDAGPNLKLLFTH 312
           K++   HAT +   PP  Y    +   +  V D   A  ++I  Y T DAGPN  + +  
Sbjct: 247 KDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAY-TFDAGPNAVIYYLD 305

Query: 313 KIEETIKQFFPEI 325
           K  E +   F  I
Sbjct: 306 KDSEHVIGTFKSI 318


>gi|300173495|ref|YP_003772661.1| diphosphomevalonate decarboxylase [Leuconostoc gasicomitatum LMG
           18811]
 gi|299887874|emb|CBL91842.1| diphosphomevalonate decarboxylase [Leuconostoc gasicomitatum LMG
           18811]
          Length = 316

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 111/293 (37%), Positives = 157/293 (53%), Gaps = 28/293 (9%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIAL KYWGK+D  LNLP  +SLSL+L    T T +T  ++ +D +ILN   + +    
Sbjct: 9   TNIALIKYWGKKDPILNLPTTSSLSLTLEQFYTQTTVTP-NTHSDQLILNNLSVDT---- 63

Query: 90  FKKTTQFCDLFRQ----FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
             +T  F ++ R+    FS     + ++N++PT AGLASSAS FAALT A+     +   
Sbjct: 64  -TRTHHFLNVLREQLGNFSP--LTVTSTNHVPTSAGLASSASAFAALTGAVTHELGLEMS 120

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL------ 199
           +ESLSR+AR GSGSA RS Y  F  W  G D   + SFA       PD+ I L+      
Sbjct: 121 NESLSRLARRGSGSASRSLYGHFAVWHEGMDD--LSSFAESL--HAPDMPIALVVAEVSS 176

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +       G R AM      SP +  W  Q       ++ AI+ +D  K+G +AE NAL
Sbjct: 177 DVKKVSSSEGMRRAMT-----SPNYGDWLNQSKNQFVDMQAAIMTRDIEKIGSIAEDNAL 231

Query: 260 KMHA-TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
            MHA  + A      Y+  ET Q ++ + D R Q +  + T+DAGPN+K++ T
Sbjct: 232 SMHALNLTARQQAFTYFTSETQQILKIIQDIRHQGLLAFATIDAGPNVKIITT 284


>gi|225548898|ref|ZP_03769875.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 94a]
 gi|225370501|gb|EEG99937.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 94a]
          Length = 312

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 163/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +KLL   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKLLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGINFI 301


>gi|225464152|ref|XP_002266399.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296087980|emb|CBI35263.3| unnamed protein product [Vitis vinifera]
          Length = 422

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 169/310 (54%), Gaps = 25/310 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V     +D + LNG
Sbjct: 13  TTAQTPTNIAVIKYWGKRDEALILAVNDSISVTLDPQHLCTTTTVAVSPMFQSDRMWLNG 72

Query: 81  QKIS--------------SQSSFFKKTTQFCDLFRQ-FSKVYFLIETSNNIPTKAGLASS 125
           ++IS              S++S  +   +   + ++ + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS Y GF +W+ G ++NG DS AV
Sbjct: 133 AAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEENGSDSIAV 192

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
              ++  W +L I +  +  R+K+  S   M  +   S       ++ +   +  +++AI
Sbjct: 193 QLQDEKHWDELVIIIAVVSSRQKETSSTSGMRDSVETSLLLQHRAKEVVPKRIIEMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFT 299
            ++DF     +   ++ + HA  +  SPP+ Y    +   I  +E+ W+  + +  + +T
Sbjct: 253 KNRDFPSFARLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISCVEK-WNRSEGTPQVAYT 311

Query: 300 LDAGPNLKLL 309
            DAGPN  L+
Sbjct: 312 FDAGPNAVLI 321


>gi|159024148|gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
          Length = 422

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 100/318 (31%), Positives = 171/318 (53%), Gaps = 25/318 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V  S   D + LN +
Sbjct: 14  TAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQDRMWLNKK 73

Query: 82  KISSQSSFFK--------KTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   + ++        +   + D  +        +  ++  I++ NN PT AGLASSA
Sbjct: 74  EISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPTAAGLASSA 133

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E +  LS +AR GSGSACRS + GF +W+ G +++G DS AVP
Sbjct: 134 AGFACLVFSLAKLMNVQEDNGRLSAIARQGSGSACRSLFGGFVKWVMGKEEDGSDSIAVP 193

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W +L I +  +  R+K+  S   M  T   S       ++ +   +  +++AI 
Sbjct: 194 LADEKHWDELVIIIAVVSSRQKETSSTSGMRETVVTSALIDHRAKEVVPKRIVQMEEAIQ 253

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK---ETIQGMERVWDARQQSIPIYFTL 300
           ++DF    ++   ++ + HA  +  SPP+ Y        I  +E+ W+  + +  + +T 
Sbjct: 254 NRDFPTFAQLTCSDSNQFHAVCMDTSPPIFYMNDTSHRVISCVEK-WNRAEGTPQVAYTF 312

Query: 301 DAGPNLKLLFTHKIEETI 318
           DAGPN  L+  ++   T+
Sbjct: 313 DAGPNAVLIARNRKAATL 330


>gi|328350516|emb|CCA36916.1| diphosphomevalonate decarboxylase [Pichia pastoris CBS 7435]
          Length = 514

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 166/318 (52%), Gaps = 27/318 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNG 80
           +S+  P NIA+ KYWGKRD+ LNLP N+S+S++L      T  TV  S   + D + LNG
Sbjct: 138 ASSSAPVNIAVLKYWGKRDTNLNLPTNSSISVTLSQKDLRTLTTVNSSRNFEKDSLYLNG 197

Query: 81  QKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLASSA 126
               S S    +TT   +  R              + S+    I + NN PT AGLASSA
Sbjct: 198 ---VSHSIENDRTTNCLEQLRSLRQQLEEDDPNLPKLSQWKLHIISENNFPTAAGLASSA 254

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFAA+  A+ ++Y +P+ +  LSR+AR GSGSACRS + G+  W  G   +G DS AV 
Sbjct: 255 AGFAAMVAAISKLYELPQDASELSRIARKGSGSACRSMFGGYVAWEMGEKLDGTDSKAVQ 314

Query: 187 FN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAII 243
                 WP+++  +  + D +K + S   M+ T   S  F  +  Q +    + +  AI 
Sbjct: 315 IAPPEHWPNMKAAICIVSDLKKDVSSTSGMQTTVQTSELFQYRVNQVVPPRYSQMVDAIK 374

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYW---QKETIQGMERVWDARQQSIPIYFTL 300
           ++DF   G +  K++   HAT + + PP+ Y     K+ I+ +  + DA  + +  Y T 
Sbjct: 375 NRDFETFGTLTMKDSNSFHATCLDSYPPIFYLTDTSKKIIKLIHTLNDAIGKVVAAY-TF 433

Query: 301 DAGPNLKLLFTHKIEETI 318
           DAGPN  + +  + EE +
Sbjct: 434 DAGPNAVIYYESENEEVV 451


>gi|327388366|gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
          Length = 421

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 172/324 (53%), Gaps = 30/324 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKIS- 84
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S  +D + LNG++IS 
Sbjct: 18  PTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPSFRSDRMWLNGKEISL 77

Query: 85  -------------SQSSFFKKTTQFCDLFRQ-FSKVYFLIETSNNIPTKAGLASSASGFA 130
                        S++S F+   +   + ++ +  ++  I + NN PT AGLASSA+GFA
Sbjct: 78  AGGRYQNCLREIRSRASCFEDEKKGISIRKEDWENLHLHIASYNNFPTAAGLASSAAGFA 137

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
            L  AL  +  + E   ++S +AR GSGSACRS Y GF +W  G D +G DS A+   ++
Sbjct: 138 CLVFALGNLMCVKEDLGAISAIARQGSGSACRSLYGGFVKWNTGYDVSGRDSIAMQLASE 197

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDF 247
             W DL I +  +  R+K+  S   M  +   S     ++ + +   +  +++AI ++DF
Sbjct: 198 SHWDDLVIIIAVVSSRQKETSSTAGMRESVETSTLLQYRFKEVVPKRILQMEEAIRNKDF 257

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGP 304
                +   ++ + HA  +   PP+ Y    +   I  ME+ W+  + +  + +T DAGP
Sbjct: 258 TTFARLTCADSNQFHAVCLDTCPPIFYMNDTSHRIINYMEK-WNQLEGTPQVAYTFDAGP 316

Query: 305 NLKLLF-THKIEETIKQ----FFP 323
           N  L+    K  E + Q    +FP
Sbjct: 317 NAVLIARNRKTAEALLQRLLFYFP 340


>gi|312147908|gb|ADQ30567.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi JD1]
          Length = 312

 Score =  142 bits (358), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 163/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +KLL   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKLLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGIDFI 301


>gi|54292590|gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
          Length = 430

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 165/306 (53%), Gaps = 26/306 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL   T + V  S  +D + LNG+
Sbjct: 16  TARAPTNIAVIKYWGKRDEKLILPINDSISVTLDPDHLSATTTVAVSPSFSSDRMWLNGK 75

Query: 82  KIS-----SQSSFFKKTTQFCDLFRQFS----------KVYFLIETSNNIPTKAGLASSA 126
           ++S      Q+   +  ++  D+  + S           ++  I + NN PT AGLASSA
Sbjct: 76  EVSLGGERYQNCLREIRSRGRDVVDEKSGTLIKKEDWQTLHLHIASHNNFPTAAGLASSA 135

Query: 127 SGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  AL ++  I E+ +  LS +AR GSGSACRS Y GF +W  G +++G DS AV
Sbjct: 136 AGFACLVYALAKLMDIEERYAGELSAIARQGSGSACRSLYGGFVKWDMGKERDGSDSIAV 195

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
               +  W +L I +  +  R+K+  S   M  +   S       Q+ +   +  +++AI
Sbjct: 196 QLATEEHWEELVILVAVVSSRQKETSSTTGMRESVETSELLHHRAQEVVPKRIVQMQEAI 255

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFT 299
            + DF     +   ++ + HA  + ASPP+ Y    +   I  +E+ W+  + +  + +T
Sbjct: 256 ANHDFASFARITCVDSNQFHAVCLDASPPIFYMNDTSHRIINCIEK-WNRFEGTPQVSYT 314

Query: 300 LDAGPN 305
            DAGPN
Sbjct: 315 FDAGPN 320


>gi|289168578|ref|YP_003446847.1| mevalonate pyrophosphate decarboxylase [Streptococcus mitis B6]
 gi|288908145|emb|CBJ22986.1| mevalonate pyrophosphate decarboxylase [Streptococcus mitis B6]
          Length = 317

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ + +++
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYINGQ-LQNEA 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
              K  ++  D +R     +  I+T N++PT AGL+SS+SG +AL  A    + +     
Sbjct: 71  EHVK-MSKIIDRYRPDGDGFVRIDTQNSMPTAAGLSSSSSGLSALVKACNAYFKLGLNRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V        L++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETG-----LKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   +   DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKANDFAKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEIF 297


>gi|282160515|gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
          Length = 417

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 167/309 (54%), Gaps = 25/309 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P NIA+ KYWGKRD  L LP+N+S+ +SL   HL T T ++V  S + D + LNG+
Sbjct: 10  TAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFEQDRMWLNGK 69

Query: 82  KISS-----QSSFFKKTTQFCDLFRQ----------FSKVYFLIETSNNIPTKAGLASSA 126
           +IS      QS   +  ++  DL  +          + K++F I + NN PT AGLASSA
Sbjct: 70  EISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFPTAAGLASSA 129

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +G A    AL ++ ++ E +  LS +AR GSGSACRS Y GF +WI G ++NG DS AV 
Sbjct: 130 AGLACFVFALAKLLTLQEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENGSDSIAVQ 189

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M+ +   S       ++ +   +  ++ AI 
Sbjct: 190 LADEKHWDDLVIVIAVVSARQKETSSTTGMQDSCKTSMLIQHRAKEVVPKRILQMEDAIE 249

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
            +DF     +A  ++ + HA  +  SPP+ Y    +   I  +E+ W+    +  + +T 
Sbjct: 250 KRDFPSFARLACADSNQFHAVCLDTSPPIFYINDTSHKIISCVEK-WNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLL 309
           DAGPN  L+
Sbjct: 309 DAGPNAVLI 317


>gi|164604978|dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
          Length = 415

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 165/309 (53%), Gaps = 25/309 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDSDA-DCIILNGQ 81
           +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL T T + V  S A D + LNG+
Sbjct: 10  TAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPVHLCTTTTVAVSPSFAQDRMWLNGK 69

Query: 82  KIS-----SQSSFFKKTTQFCDLF----------RQFSKVYFLIETSNNIPTKAGLASSA 126
           +IS      Q+   +   + CD+           + + K++  I + NN PT AGLASSA
Sbjct: 70  EISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLHVHIASYNNFPTAAGLASSA 129

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  AL ++ +  E    LS +AR GSGSACRS + GF +W  G  ++G DS AV 
Sbjct: 130 AGFACLVFALAKLMNAKEDHSELSAIARQGSGSACRSLFGGFVKWKMGKVEDGSDSLAVQ 189

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  T   S       ++I    +  ++++I 
Sbjct: 190 VVDEKHWDDLVIIIAVVSSRQKETSSTTGMRETVETSLLLQHRAKEIVPKRIVQMEESIK 249

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTL 300
           +++F     +   ++ + HA  +   PP+ Y    +   I  +E+ W+    +  + +T 
Sbjct: 250 NRNFASFAHLTCADSNQFHAVCMDTCPPIFYMNDTSHRIISCVEK-WNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLL 309
           DAGPN  L+
Sbjct: 309 DAGPNAVLI 317


>gi|162447658|ref|YP_001620790.1| diphosphomevalonate decarboxylase [Acholeplasma laidlawii PG-8A]
 gi|161985765|gb|ABX81414.1| diphosphomevalonate decarboxylase [Acholeplasma laidlawii PG-8A]
          Length = 315

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 108/305 (35%), Positives = 165/305 (54%), Gaps = 10/305 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A    NIAL KYWGK+D + NLPL +S+SL+L    T T +T   +  AD ++++ + I
Sbjct: 4   TAIANVNIALIKYWGKKDIEWNLPLTSSISLTLDAFYTKTTVTYDPTLTADILLIDDEII 63

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +     + + T++ D  R+   +  Y  I + N +P KAGLASS+S FAAL  A  + Y 
Sbjct: 64  TGGE--YLRVTKYMDKLRKLYSIPFYAKITSYNFVPKKAGLASSSSAFAALAYAATKAYG 121

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +   S+ LS +ARLGSGSA RS Y G   W  G D   M S+A    +   DL + +  I
Sbjct: 122 LNLDSKELSSLARLGSGSASRSIYGGLVLWHEGHDH--MSSYAEHLTHM-DDLAVIVCLI 178

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            +  KK+ S +AM     +      W       L  +K+AII+ DF K+G +AE +A  M
Sbjct: 179 DETPKKVNSTDAMNRLNEYPDLKELWILSTQDALNDMKEAIIENDFDKMGSIAESHASLM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H   I     + Y   ++ + M+     R + IP+Y+T+DAG N+K+L   +  ETIK  
Sbjct: 239 H--YIIQETGVSYLTDQSFKVMDLTEKIRNEGIPVYYTMDAGANVKILTKKEYVETIKAR 296

Query: 322 FPEIT 326
           + +++
Sbjct: 297 YEKLS 301


>gi|301793630|emb|CBW36013.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           INV104]
          Length = 317

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 162/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVIADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + ++V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYSVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|302309175|ref|NP_986435.2| AGL232Cp [Ashbya gossypii ATCC 10895]
 gi|299788235|gb|AAS54259.2| AGL232Cp [Ashbya gossypii ATCC 10895]
          Length = 397

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 169/348 (48%), Gaps = 36/348 (10%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRDS LNLP N+S+S++L    L T+T   T  +   D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDSMLNLPTNSSISVTLSQEDLRTLTSAATGPELAEDRLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC----------------DLFRQFSKVYFLIETSNNIPTKAGLAS 124
           +      S     TQ C                DL R  S+    I + NN PT AGLAS
Sbjct: 66  KP----ESLGNARTQQCLADLRALRRALETEEPDLPR-MSEWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL +A+ ++Y +P+    +S++AR GSGSACRS Y G+  W  G + +G DS A
Sbjct: 121 SAAGFAALVVAVAKLYGLPQDYSEISKIARKGSGSACRSLYGGYVAWEMGAEADGSDSRA 180

Query: 185 VPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQA 241
           V   +   WP++R  +L +    K   S   M+ T H S  F +     +      +  A
Sbjct: 181 VQIADVEHWPEMRAAILVVSADRKDTPSTSGMQQTVHTSDLFKERVATVVPRRYGEMAAA 240

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYF 298
           I  +DF     +  +++   HAT + + PP+ Y     +  ++    + +   ++I + +
Sbjct: 241 IRARDFATFARLTMQDSNSFHATCLDSFPPIFYMNDTSRRIVKLCHLINEFYNETI-VAY 299

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           T DAGPN  L +  + E  +  F   +       + D W T  S  Q+
Sbjct: 300 TFDAGPNAVLYYLAENEARLCGFLSAV-----FGANDGWETTFSTEQR 342


>gi|224531822|ref|ZP_03672454.1| diphosphomevalonate decarboxylase [Borrelia valaisiana VS116]
 gi|224511287|gb|EEF81693.1| diphosphomevalonate decarboxylase [Borrelia valaisiana VS116]
          Length = 312

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 166/311 (53%), Gaps = 26/311 (8%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS 87
           + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+
Sbjct: 7   VNASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SDRDEIILNSKPVILQN 64

Query: 88  SFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++   
Sbjct: 65  ----REKVFFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFN-KY 119

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
              S S +AR+GS SA R+ Y GF     G+ +    SF +     + DL I    I   
Sbjct: 120 SFNSASNLARIGSASAARAIYGGFTILKEGSKE----SFQLRDQYYFDDLCIIFAIIDSN 175

Query: 205 EKKIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
           EK++ SREAM I ++H  ++  W   +++I  D  +     + +DFI  G    K+   M
Sbjct: 176 EKELSSREAMNICKYHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGTTIVKSYQNM 232

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IEET 317
            A M A+S  + Y++  TI  ++   + R + I ++ T+DAGP +K +   K    I + 
Sbjct: 233 FALMFASS--IFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFICLEKNLNTILKR 290

Query: 318 IKQFFPEITII 328
           ++Q F +I  I
Sbjct: 291 LEQNFNDIDFI 301


>gi|225853957|ref|YP_002735469.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae JJA]
 gi|225724271|gb|ACO20124.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae JJA]
          Length = 317

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEYLSEIF 297


>gi|327287778|ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase-like [Anolis
           carolinensis]
          Length = 406

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 110/324 (33%), Positives = 168/324 (51%), Gaps = 42/324 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD KL LP+N+SLS++L    L T T   +  D   D + LNG+    
Sbjct: 15  PINIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTEDRLWLNGK---- 70

Query: 86  QSSFFKKTTQFC-----DLFRQ----------------FSKVYFL-IETSNNIPTKAGLA 123
           +S       Q C      L R+                 S  Y + I + NN PT AGLA
Sbjct: 71  ESDIGHPRLQSCLREIRRLARKRRSGDTKGPEGGEPSPLSLTYKVHIASENNFPTAAGLA 130

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+G+A L   L ++Y +      LS VAR+GSGSACRS + GF +W+ G D +G +S 
Sbjct: 131 SSAAGYACLVYTLAKLYGV---EGDLSEVARMGSGSACRSMFGGFVQWVKGEDADGKESI 187

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQ 240
           A  V     WP++R+ +L +   +K IGS   M+ +   S       +++  + +A + +
Sbjct: 188 AEQVAPETHWPEMRVLILVVSAEKKPIGSTAGMQTSVETSHLLKHRAEKLVPEYMAQMTR 247

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIY 297
            I  +DF   GE+  K++ ++HAT +   PP+ Y     K+ ++ + R  D   ++  + 
Sbjct: 248 HIRRRDFEAFGELTMKDSNQLHATCLDTFPPIFYLNDISKQVVRLVHRFNDHYGKT-KVA 306

Query: 298 FTLDAGPNLKLLFTHKIEETIKQF 321
           +T DAGPN  +     +EET+ +F
Sbjct: 307 YTFDAGPNAVVFM---MEETVAEF 327


>gi|224533370|ref|ZP_03673964.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi CA-11.2a]
 gi|224513535|gb|EEF83892.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi CA-11.2a]
          Length = 312

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 165/317 (52%), Gaps = 26/317 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IEETIK 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +    I + +K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITIIDPLDSPDL 336
           Q F  I  I      DL
Sbjct: 293 QNFTGIDFIVSKVGRDL 309


>gi|169848281|ref|XP_001830848.1| diphosphomevalonate decarboxylase [Coprinopsis cinerea
           okayama7#130]
 gi|116508017|gb|EAU90912.1| diphosphomevalonate decarboxylase [Coprinopsis cinerea
           okayama7#130]
          Length = 415

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 109/334 (32%), Positives = 164/334 (49%), Gaps = 32/334 (9%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILN 79
           +++A  P NIA+ KYWGKRD+ L LP N+SLS++L   HL + T      S D D + LN
Sbjct: 7   EATASAPVNIAVIKYWGKRDTSLILPTNSSLSVTLSQDHLRSTTTSRASSSFDKDRLWLN 66

Query: 80  GQK------------ISSQSSFFKKTTQFCDL-FRQFSKVYFLIETSNNIPTKAGLASSA 126
           GQ+            I       K+  +  D    + S +   I + NN PT AGLASSA
Sbjct: 67  GQEDVIKPGSRLETCIREMKKLRKELVEDKDANAPKLSTLPVHIASYNNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSI--PEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SGFAAL  +L  +Y++  P  S S LS +AR GSGSACRS + GF  W  G+   G DS 
Sbjct: 127 SGFAALVSSLAHLYTLTPPLTSPSTLSLIARQGSGSACRSLFGGFVAWEMGSTPTGTDSL 186

Query: 184 AVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQ 240
           AV   ++  WP++   +  + D +K   S   M+ T   S       +  +   +  + +
Sbjct: 187 AVQIADEAHWPEMHALICVVSDDKKGTSSTAGMQRTVETSTLLQHRIKDVVPRRMDEMIR 246

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET------IQGMERVWDARQQSI 294
           AI ++DF     +   ++   HA  +   PP+ Y    +      I  + RV   + +  
Sbjct: 247 AIKEKDFDSFARITMADSNSFHAVALDTEPPIFYMNDVSRAIIALIVELNRVSLEKGEGY 306

Query: 295 PIYFTLDAGPNLKLLFTHK-IEETIK---QFFPE 324
              +T DAGPN  +    K ++E I+   ++FP+
Sbjct: 307 KAAYTYDAGPNAVIYTLDKNVKEVIQLIVKYFPQ 340


>gi|28571205|ref|NP_573068.3| CG8239 [Drosophila melanogaster]
 gi|17862156|gb|AAL39555.1| LD10857p [Drosophila melanogaster]
 gi|28381624|gb|AAF48505.3| CG8239 [Drosophila melanogaster]
 gi|220943024|gb|ACL84055.1| CG8239-PA [synthetic construct]
 gi|220953128|gb|ACL89107.1| CG8239-PA [synthetic construct]
          Length = 388

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 109/323 (33%), Positives = 168/323 (52%), Gaps = 37/323 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P NIAL KYWGKR  +L LP+N+S+S++L    L   T +T  +S + + + LNG+++  
Sbjct: 9   PVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWLNGEEVP- 67

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL----------------IETSNNIPTKAGLASSASGF 129
               F+++++   L R  ++V+ L                I + NN PT AGLASSA+G+
Sbjct: 68  ----FEESSR---LQRCLNEVHRLAVASGSQKVPPTWKLHIASVNNFPTAAGLASSAAGY 120

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPF 187
           A L  +L R+Y IP  +E L+ VAR GSGSACRS Y GF +W  G   +G DS A  +  
Sbjct: 121 ACLVYSLSRLYDIP-LNEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAP 179

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQD 246
           ++ WP++ + +L + D  KK  S   M+     S        Q+  D +  +++AI   D
Sbjct: 180 SDHWPNMHVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHD 239

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGP 304
           F    E+  K++ + HA  +   PP +Y      +I      ++ R  S    +T DAGP
Sbjct: 240 FQAFAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGP 299

Query: 305 N--LKLLFTH--KIEETIKQFFP 323
           N  L +L  H   +   I++ FP
Sbjct: 300 NACLYVLAEHVPHLLSAIQKVFP 322


>gi|195355405|ref|XP_002044182.1| GM22575 [Drosophila sechellia]
 gi|194129471|gb|EDW51514.1| GM22575 [Drosophila sechellia]
          Length = 354

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 106/320 (33%), Positives = 164/320 (51%), Gaps = 31/320 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P NIAL KYWGKR  +L LP+N+S+S++L    L   T +T  +S + + + LNG+++  
Sbjct: 9   PVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFERNRMWLNGEEVP- 67

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-------------IETSNNIPTKAGLASSASGFAAL 132
               F++ ++     ++  ++                I + NN PT AGLASSA+G+A L
Sbjct: 68  ----FEEGSRLQRCLKEVHRLAVANGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYACL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
             +L R+Y IP  SE L+ VAR GSGSACRS Y GF +W  G   +G DS A  +  ++ 
Sbjct: 124 VYSLSRLYDIP-LSEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPSDH 182

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP++ + +L + D  KK  S   M+     S       +Q+  D +  +++AI   DF  
Sbjct: 183 WPNMHVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVEQVVPDRITRLREAIASHDFQA 242

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPN-- 305
             E+  K++ + HA  +   PP +Y       I      ++ R  S    +T DAGPN  
Sbjct: 243 FAEITMKDSNQFHAVALDTYPPCVYMNDVSHRIVSFVHDYNDRMGSYHAAYTFDAGPNAC 302

Query: 306 LKLLFTH--KIEETIKQFFP 323
           L +L  H   +   I++ FP
Sbjct: 303 LYVLAEHVPHLLSAIQKVFP 322


>gi|148988141|ref|ZP_01819604.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP6-BS73]
 gi|149003484|ref|ZP_01828358.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS69]
 gi|149012126|ref|ZP_01833235.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP19-BS75]
 gi|149018080|ref|ZP_01834539.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP23-BS72]
 gi|169832809|ref|YP_001693894.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182683347|ref|YP_001835094.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae CGSP14]
 gi|221231253|ref|YP_002510405.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae ATCC
           700669]
 gi|237649354|ref|ZP_04523606.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae CCRI
           1974]
 gi|237821528|ref|ZP_04597373.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae CCRI
           1974M2]
 gi|298230946|ref|ZP_06964627.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298254647|ref|ZP_06978233.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298502182|ref|YP_003724122.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303255734|ref|ZP_07341777.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           BS455]
 gi|303259457|ref|ZP_07345434.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP-BS293]
 gi|303262988|ref|ZP_07348922.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS292]
 gi|303263541|ref|ZP_07349464.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS397]
 gi|303267345|ref|ZP_07353204.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS457]
 gi|303269850|ref|ZP_07355595.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS458]
 gi|147758420|gb|EDK65419.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS69]
 gi|147763728|gb|EDK70662.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP19-BS75]
 gi|147926605|gb|EDK77678.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147931644|gb|EDK82622.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP23-BS72]
 gi|168995311|gb|ACA35923.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182628681|gb|ACB89629.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae CGSP14]
 gi|220673713|emb|CAR68209.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae ATCC
           700669]
 gi|298237777|gb|ADI68908.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301801297|emb|CBW33977.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           INV200]
 gi|302597294|gb|EFL64397.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           BS455]
 gi|302635879|gb|EFL66380.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639391|gb|EFL69849.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP-BS293]
 gi|302640618|gb|EFL71020.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS458]
 gi|302643116|gb|EFL73404.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS457]
 gi|302647314|gb|EFL77538.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS397]
 gi|332202288|gb|EGJ16357.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA41317]
          Length = 317

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|116515775|ref|YP_815860.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae D39]
 gi|148994466|ref|ZP_01823667.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP9-BS68]
 gi|148996793|ref|ZP_01824511.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|149006134|ref|ZP_01829863.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|168488079|ref|ZP_02712278.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae SP195]
 gi|168494575|ref|ZP_02718718.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC3059-06]
 gi|168576777|ref|ZP_02722635.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           MLV-016]
 gi|225856119|ref|YP_002737630.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae P1031]
 gi|225858237|ref|YP_002739747.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 70585]
 gi|307067038|ref|YP_003876004.1| mevalonate pyrophosphate decarboxylase [Streptococcus pneumoniae
           AP200]
 gi|307126594|ref|YP_003878625.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 670-6B]
 gi|116076351|gb|ABJ54071.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae D39]
 gi|147757368|gb|EDK64407.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|147762490|gb|EDK69451.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|147927215|gb|EDK78250.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP9-BS68]
 gi|183572899|gb|EDT93427.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae SP195]
 gi|183575493|gb|EDT96021.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC3059-06]
 gi|183577536|gb|EDT98064.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           MLV-016]
 gi|225722154|gb|ACO18008.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 70585]
 gi|225724934|gb|ACO20786.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae P1031]
 gi|306408575|gb|ADM84002.1| Mevalonate pyrophosphate decarboxylase [Streptococcus pneumoniae
           AP200]
 gi|306483656|gb|ADM90525.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 670-6B]
 gi|332076822|gb|EGI87284.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA17545]
 gi|332077670|gb|EGI88131.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA41301]
          Length = 317

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|225551866|ref|ZP_03772809.1| diphosphomevalonate decarboxylase [Borrelia sp. SV1]
 gi|225371661|gb|EEH01088.1| diphosphomevalonate decarboxylase [Borrelia sp. SV1]
          Length = 312

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 162/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDIFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGINFI 301


>gi|195941505|ref|ZP_03086887.1| mevalonate pyrophosphate decarboxylase [Borrelia burgdorferi 80a]
 gi|226320477|ref|ZP_03796043.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 29805]
 gi|226234119|gb|EEH32834.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 29805]
          Length = 312

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 104/317 (32%), Positives = 164/317 (51%), Gaps = 26/317 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITIIDPLDSPDL 336
           Q F  I  I      DL
Sbjct: 293 QNFTGIDFIVSRVGCDL 309


>gi|168482616|ref|ZP_02707568.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1873-00]
 gi|168485524|ref|ZP_02710032.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1087-00]
 gi|172043858|gb|EDT51904.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1873-00]
 gi|183571122|gb|EDT91650.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1087-00]
          Length = 317

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + ++V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYSVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|15902383|ref|NP_357933.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae R6]
 gi|15457897|gb|AAK99143.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae R6]
          Length = 344

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 161/297 (54%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 39  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 98

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 99  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 156

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 157 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 207

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 208 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 267

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 268 KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 324


>gi|15595031|ref|NP_212820.1| mevalonate pyrophosphate decarboxylase [Borrelia burgdorferi B31]
 gi|216264792|ref|ZP_03436784.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 156a]
 gi|218249665|ref|YP_002375186.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi ZS7]
 gi|223889449|ref|ZP_03624035.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 64b]
 gi|225549999|ref|ZP_03770960.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 118a]
 gi|226321384|ref|ZP_03796911.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi Bol26]
 gi|2688615|gb|AAC67031.1| mevalonate pyrophosphate decarboxylase [Borrelia burgdorferi B31]
 gi|215981265|gb|EEC22072.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 156a]
 gi|218164853|gb|ACK74914.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi ZS7]
 gi|223885135|gb|EEF56239.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 64b]
 gi|225369458|gb|EEG98910.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 118a]
 gi|226233180|gb|EEH31932.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi Bol26]
          Length = 312

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 162/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGIDFI 301


>gi|221217970|ref|ZP_03589437.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 72a]
 gi|221192276|gb|EEE18496.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 72a]
          Length = 312

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 162/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGIDFI 301


>gi|296110439|ref|YP_003620820.1| diphosphomevalonate decarboxylase [Leuconostoc kimchii IMSNU 11154]
 gi|295831970|gb|ADG39851.1| diphosphomevalonate decarboxylase [Leuconostoc kimchii IMSNU 11154]
          Length = 316

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 166/293 (56%), Gaps = 16/293 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
           ++A   +NIA  KYWGK+D++LNLP  +SLSL+L    T T     ++D D ++LNG+ +
Sbjct: 3   TTATAHTNIAFIKYWGKKDARLNLPTTSSLSLTLSQFYTTT-TVTQNTDKDQLVLNGE-L 60

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           +  +          D+   F  V   + + N++PT AGLASSAS FAALT A+ R     
Sbjct: 61  ADPTRIHHFLNTIRDILGDFPAV--TVTSENHVPTSAGLASSASSFAALTGAVTREMGFD 118

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL--KI 201
             ++SLSR+AR GSGSA RSFY  F  W  G D     SFA   N   PD+ I L+  ++
Sbjct: 119 LSNQSLSRLARRGSGSASRSFYSHFAIWHAGMDD--ASSFAESLNA--PDMPIALVVAEV 174

Query: 202 IDREKKIGSREAME--ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
               KK+ S + M+  IT   SP +  W  + +T    ++ AI   D  K+G +AE+NAL
Sbjct: 175 STSAKKVSSSDGMQRAIT---SPNYDDWLNRSATQFMDMQSAIQQSDIEKIGTLAEENAL 231

Query: 260 KMHA-TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
            MHA  + A   P  Y+ +ET Q +  V D R+Q I  + T+DAGPN+K++ T
Sbjct: 232 AMHALNLTARHKPFTYFTQETQQILALVSDLRRQGILAFATMDAGPNVKIITT 284


>gi|21593243|gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis
           thaliana]
          Length = 419

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 166/312 (53%), Gaps = 23/312 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKR     LP+N+S+S++L   HL T+T + V  + D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRHEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGK 70

Query: 82  KISSQSSFFK--------KTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++        +     D+ +        + K+   I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV 
Sbjct: 131 AGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
             ++  W DL I +  +  R+K+  S   M  +   S       ++ +   +  +++AI 
Sbjct: 191 LADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAIK 250

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLD 301
           ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T D
Sbjct: 251 NRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFD 310

Query: 302 AGPNLKLLFTHK 313
           AGPN  L+  ++
Sbjct: 311 AGPNAVLIARNR 322


>gi|224532415|ref|ZP_03673045.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi WI91-23]
 gi|224512722|gb|EEF83093.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi WI91-23]
          Length = 312

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 162/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLKENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGIDFI 301


>gi|312149286|gb|ADQ29357.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi N40]
          Length = 312

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 162/309 (52%), Gaps = 26/309 (8%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +++ + +  S+ D IILN + +  ++  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSVSELEL--SNRDEIILNSKPVILKN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN-KYSC 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I + H  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYF---FLKKDFIHFGATIVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI----K 319
            M A+S  + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI    K
Sbjct: 235 LMFASS--IFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGLK 292

Query: 320 QFFPEITII 328
           Q F  I  I
Sbjct: 293 QNFTGIDFI 301


>gi|322387266|ref|ZP_08060876.1| diphosphomevalonate decarboxylase [Streptococcus infantis ATCC
           700779]
 gi|321141795|gb|EFX37290.1| diphosphomevalonate decarboxylase [Streptococcus infantis ATCC
           700779]
          Length = 317

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 156/288 (54%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ +  D+ AD   +NGQ      
Sbjct: 12  ANIAIIKYWGKKAEKEMVPATSSISLTLENMYTETTLSPLPADATADAFYINGQ--LQNE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +   K  +  D +R     +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 70  AEHAKMRKIIDRYRPEGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNAYFQLGLNRR 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L+  A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 ELALEAKFASGSSSRSFYGPLAAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDQK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F +W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDEWIRQSEQDYKDMLVYLKENDFKKVGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+P   Y    + + M+ V   R++    YFT+DAGPN+K+L   K
Sbjct: 241 KTATPSFSYLTDASYEAMDFVRQLREKGESCYFTMDAGPNVKVLCLEK 288


>gi|199598405|ref|ZP_03211824.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus rhamnosus
           HN001]
 gi|258508494|ref|YP_003171245.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
 gi|199590724|gb|EDY98811.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus rhamnosus
           HN001]
 gi|257148421|emb|CAR87394.1| Diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
 gi|259649804|dbj|BAI41966.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
          Length = 334

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 105/287 (36%), Positives = 161/287 (56%), Gaps = 13/287 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSS 88
           +NIAL KYWGK + +L LP  +S+SL+L    T T +T   + + D + LN Q  S  + 
Sbjct: 9   TNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPELNQDQLTLNHQMQSPTA- 67

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +    
Sbjct: 68  ----VSRFLDHVRHLAQIDTRARVTSLNHVPTAAGLASSASAFAALALAASRAAGLNLTP 123

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL--RIGLLKIIDR 204
            +LSR+AR GSGSA RS + G   W  G+D     SFA P   Q P L  R+ ++ + D+
Sbjct: 124 TALSRLARRGSGSATRSIFGGAVIWHRGSDDQS--SFAEPLTIQ-PTLPLRMLVVTVSDQ 180

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MHA 
Sbjct: 181 KKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMHAA 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T
Sbjct: 241 IMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTT 287


>gi|153791289|ref|NP_001093300.1| diphosphomevalonate decarboxylase [Bombyx mori]
 gi|146424702|dbj|BAF62111.1| diphosphomevalonate decarboxylase [Bombyx mori]
          Length = 390

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 166/330 (50%), Gaps = 45/330 (13%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL------GHLGTITHITVIDSDADCIIL 78
           +   P NIA+ KYWGKRD KL LPLN+S+S +             TH   ++   D I L
Sbjct: 6   TVIAPVNIAVIKYWGKRDEKLILPLNDSVSATFDTSVMCAKTSVSTHPDFVE---DQIWL 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFS----------------KVYFLIETSNNIPTKAGL 122
           NG+    + SF     Q C   R+                  KV+  + + NN PT AGL
Sbjct: 63  NGK----EESFSNPRLQNC--LREIKSRAVAEKTIAEDVLSWKVH--VSSENNFPTAAGL 114

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+G+A L  AL ++Y I  KS+ +S +ARLGSGSACRS Y GF  W  G+  +G DS
Sbjct: 115 ASSAAGYACLVSALAKLYKI--KSD-VSSIARLGSGSACRSVYGGFVRWHAGSKPDGSDS 171

Query: 183 FA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIK 239
            A  +  +N WP++R+ +L + + +KK+ S   M+I+   S       Q  +      I 
Sbjct: 172 IATQIADSNHWPEMRVLVLVVGNTQKKVSSTVGMKISSETSELLKHRIQHCVPQRTERII 231

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIY 297
           +AI ++DF K  E+  K++ + HA  + + PP++Y      +I  +   ++       + 
Sbjct: 232 EAIKNKDFYKFAEITMKDSNQFHAICLDSYPPIVYMTDISHSIVDLIHKYNDFSGETKVA 291

Query: 298 FTLDAGPNLKL-LFTH---KIEETIKQFFP 323
           +T DAG N  L L  H   K+   IK  FP
Sbjct: 292 YTFDAGSNACLYLLKHDVPKVISLIKYAFP 321


>gi|148983786|ref|ZP_01817105.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP3-BS71]
 gi|168490698|ref|ZP_02714841.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC0288-04]
 gi|225860414|ref|YP_002741923.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|9937408|gb|AAG02456.1|AF290099_2 mevalonate diphosphate decarboxylase [Streptococcus pneumoniae]
 gi|147923933|gb|EDK75045.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP3-BS71]
 gi|183574929|gb|EDT95457.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC0288-04]
 gi|225726850|gb|ACO22701.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|301799492|emb|CBW32038.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           OXC141]
 gi|332203548|gb|EGJ17615.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA47368]
          Length = 317

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|15900305|ref|NP_344909.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae TIGR4]
 gi|111657160|ref|ZP_01407940.1| hypothetical protein SpneT_02001625 [Streptococcus pneumoniae
           TIGR4]
 gi|14971852|gb|AAK74549.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae TIGR4]
          Length = 317

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|118794452|ref|XP_321487.3| AGAP001611-PA [Anopheles gambiae str. PEST]
 gi|116116303|gb|EAA00918.3| AGAP001611-PA [Anopheles gambiae str. PEST]
          Length = 382

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 166/320 (51%), Gaps = 27/320 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITV-IDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+S+S++L   HL T T IT   +   + + LNG + S 
Sbjct: 10  PVNIAIIKYWGKRDDDLILPINDSISVTLSTDHLRTKTTITAGPEISKNVLRLNGVEESF 69

Query: 86  QSSFFKKTTQ----FCDLFRQFSKVYFL-----IETSNNIPTKAGLASSASGFAALTLAL 136
           ++   ++  Q          + SK   L     +E+ NN PT AGLASSA+G+A     L
Sbjct: 70  ENPRIQRCLQEVKRIAKASGKCSKPEMLEWNVHVESENNFPTAAGLASSAAGYACFVYTL 129

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
             +Y +  +SE LS +AR+GSGSACRS + G+ +W  G   +G DS AV     + WPD+
Sbjct: 130 ATLYGV--ESEELSGIARMGSGSACRSLHSGYVQWARGERADGSDSLAVQLAPASAWPDM 187

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEV 253
            + +L + DR+K   S   M  +   S          +   +  +++AI ++DF   G +
Sbjct: 188 HVLILVVSDRKKATASTHGMATSVKTSDLLKHRASVCVPERVKLVQKAIAEKDFDTFGRI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQS---IPIYFTLDAGPNLK 307
           A K++ + HA  +   PP  Y     +  I+ ++++ +  + +   + + ++ DAGPN  
Sbjct: 248 AMKDSNQFHAICLDTYPPCFYLNDVSRSIIRMVDQINNLAEPNLAPVKVAYSFDAGPNAC 307

Query: 308 LLFTHK----IEETIKQFFP 323
           L    K    +   +++ FP
Sbjct: 308 LFLLEKDVAEVSAIVRRVFP 327


>gi|330834517|ref|YP_004409245.1| diphosphomevalonate decarboxylase [Metallosphaera cuprina Ar-4]
 gi|329566656|gb|AEB94761.1| diphosphomevalonate decarboxylase [Metallosphaera cuprina Ar-4]
          Length = 326

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 171/305 (56%), Gaps = 17/305 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           ++ A  P+NIA+ KYWGKR+ +LNLPLN+SLS++L  L   + +T  ++ + D I +NG+
Sbjct: 4   EAEAVAPANIAVVKYWGKRNKQLNLPLNDSLSITLESLQVRSKVTFDENLNHDEIFVNGE 63

Query: 82  KISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           ++S   +  +   +  ++ R+    +V+  IE+++N P+ AGLASSA+G AALT A    
Sbjct: 64  RLSDYETR-EYAGRVLEIIRKLYGKRVFARIESTSNFPSSAGLASSAAGIAALTFASNAA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLR-- 195
            ++    + LS++AR+GSGSACRS + GF  W  G    G DSF   V   + WP+L   
Sbjct: 123 LNLGLDDKELSKIARVGSGSACRSMFGGFVRWNKGESDEGDDSFCEQVFGPDHWPNLVDV 182

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           IG+ K  + +KK+ SR  ME +   S       + +      I +AI D+D      +  
Sbjct: 183 IGIFK--EEKKKVSSRSGMESSVASSSLLKCRLRFVEETFDDIIKAIRDRDVNSFFHLTM 240

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P + Y   ++   M+ V +  + +    +T DAGPN  +L    +E
Sbjct: 241 RHSNSMHAIILDSWPSMSYLNDKSFVVMDWVHEFGKAA----YTFDAGPNPHILV---LE 293

Query: 316 ETIKQ 320
           E +++
Sbjct: 294 ENVQE 298


>gi|139473958|ref|YP_001128674.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes str.
           Manfredo]
 gi|134272205|emb|CAM30451.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes str.
           Manfredo]
          Length = 314

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 161/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  EEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACNQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|198421777|ref|XP_002126591.1| PREDICTED: similar to Mevalonate (diphospho) decarboxylase [Ciona
           intestinalis]
          Length = 382

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 108/330 (32%), Positives = 162/330 (49%), Gaps = 36/330 (10%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILN 79
           K +   P NIA+ KYWGK     NLPLN+S S++L +    T  TV  + +   D + +N
Sbjct: 12  KITCCAPINIAIIKYWGKLCEVENLPLNSSFSITLNYHDLCTTTTVTTAPSYVKDQVYVN 71

Query: 80  G--QKISSQSSF---FKKTTQFC------------DLFRQFSKVYFLIETSNNIPTKAGL 122
              Q I+        F++  +              +L     K++  +++ NN PTKAGL
Sbjct: 72  DLWQDINENPRLKVCFEEMRRLARKQAISENAAAKELMSCSKKIH--VQSVNNFPTKAGL 129

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSASG+AALT AL ++  +      LS VAR GSGSACRS   GF EW+    +   +S
Sbjct: 130 ASSASGYAALTFALGQLLGV---KGDLSGVARRGSGSACRSMCGGFVEWL--KSEESKNS 184

Query: 183 FAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIK 239
            A  F ++  WP+LR+ +L +  ++K  GS   M+ +   S       + I    +  +K
Sbjct: 185 TAKQFVDETHWPELRVFILVVSSKQKSFGSTVGMQRSVETSALLKHRIENIVPHRIKVLK 244

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK--ETIQGMERVWDARQQSIPIY 297
           QA++++DF    E+  K + ++HA  +   PPL Y     E I      ++ R  S  + 
Sbjct: 245 QAVLEKDFCLFAEICMKESNQLHAICMDTFPPLRYLNNVSEKIMNFVYSYNERCGSTRVA 304

Query: 298 FTLDAGPNLKLL----FTHKIEETIKQFFP 323
           +T DAGPN  L     F   +   I Q FP
Sbjct: 305 YTFDAGPNAFLFTLAPFAEDLANQIYQVFP 334


>gi|15674902|ref|NP_269076.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes M1
           GAS]
 gi|71910496|ref|YP_282046.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS5005]
 gi|13622042|gb|AAK33797.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes M1
           GAS]
 gi|71853278|gb|AAZ51301.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS5005]
          Length = 314

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 160/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  I    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--ILQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++      +
Sbjct: 70  EEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|313890546|ref|ZP_07824174.1| diphosphomevalonate decarboxylase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313121063|gb|EFR44174.1| diphosphomevalonate decarboxylase [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 314

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 156/299 (52%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQS 87
           +NIA+ KYWGK D K  +P  +S+SL+L ++ T T +  +    D D   ++ Q + SQ 
Sbjct: 12  ANIAIIKYWGKEDQKKMIPSTSSISLTLENMYTETQVQALPEGVDRDLFYIDDQ-LQSQE 70

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
              +K +   + FR    +Y  + + NN+PT AGL+SS+SG +AL  A  + +       
Sbjct: 71  EH-EKISAIINQFRTPKNLYVQVRSRNNMPTAAGLSSSSSGLSALVKACNQFFETGLTQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGSA RSF+     W    D++    + V       DL++ ++ +I  +  
Sbjct: 130 QLAQKAKFASGSASRSFFGPLSAW----DKSSGHIYKVT-----TDLKLAMIMLILNEER 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M + R  S  F QW ++   D   +   +   DF K+G + E+NAL MH T 
Sbjct: 181 KPISSRDGMRLCRQTSTTFDQWIKKSEVDYQEMLHYLETNDFEKVGLLTEENALAMHETT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             ++P   Y  + + Q M++V D R +    YFT+DAGPN+K+L   K  E +   F +
Sbjct: 241 RTSTPSFSYLTEASYQAMDKVRDMRSKGYQCYFTMDAGPNVKVLCLEKDLEKLAHLFAQ 299


>gi|157042753|gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii x
           Nicotiana sanderae]
          Length = 406

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 98/313 (31%), Positives = 168/313 (53%), Gaps = 23/313 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQKIS- 84
           P+NIA+ KYWGKRD  L L +N+S+ ++L   HL T T + V  + + D + LNG++IS 
Sbjct: 2   PTNIAVIKYWGKRDEDLILAINDSIGVTLDPAHLCTTTTVAVSPAFNQDRMWLNGKEISL 61

Query: 85  -------------SQSSFFKKTTQFCDLFRQ-FSKVYFLIETSNNIPTKAGLASSASGFA 130
                        +++S  +   +   + ++ +  ++  I + NN PT AGLASSA+GFA
Sbjct: 62  SGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIASYNNFPTAAGLASSAAGFA 121

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
            L  +L ++ ++ E +  LS +AR GSGSACRS Y GF +WI G ++NG DS AV   ++
Sbjct: 122 CLVFSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWIMGKEENGSDSIAVQLVDE 181

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDF 247
             W +L I +  +  R+K+  S   M  T   S       ++ +   +  +++AI ++DF
Sbjct: 182 KHWDELVIIIAVVSSRQKETSSTSGMRDTVETSALIEHRAKEVVPKRIVQMEEAIQNRDF 241

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
               ++   ++ + HA  +  S P+ Y    +  + G    W+  + +  + +T DAGPN
Sbjct: 242 PTFAQLTCADSNQFHAVSMDTSLPIFYMNDTSHRVIGCVEKWNRSEGTPQVAYTFDAGPN 301

Query: 306 LKLLFTHKIEETI 318
             L+  ++   T+
Sbjct: 302 AVLIARNRKAATL 314


>gi|291230240|ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus
           kowalevskii]
          Length = 405

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 164/318 (51%), Gaps = 26/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP N+SLS SL   HL + T  ++      D + LNG++ S 
Sbjct: 20  PINIAVIKYWGKRDEQLILPTNSSLSASLDQDHLKSTTTASISKEFKRDRLWLNGKEESI 79

Query: 86  QSSFF-----------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           ++              +K     D   +       I + NN PT AGLASSA+G+A L  
Sbjct: 80  ENPRIQNCLIEIRRRARKRKHNDDSKSEMLNWSVHICSENNFPTAAGLASSAAGYACLVY 139

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWP 192
            L ++Y I   +  +S +AR GSGSACRS Y GF +W  G  +NG DS A  V   + WP
Sbjct: 140 TLSKLYDI---NGDVSDIARRGSGSACRSIYGGFVQWTVGEKKNGSDSIAKVVADVDHWP 196

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLG 251
           ++R+ +L + D++K   S   M  + + S F     +  + + +  + +AI ++D+ K  
Sbjct: 197 EMRVLVLVVSDQKKHTSSTNGMRNSVNTSDFLRYRAEHVVPSRMEEMIKAIEEKDYQKFA 256

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN--LK 307
           E+  K++ +MHA  +   PP+ Y    +  I  M   ++  Q  + + +T DAGPN  L 
Sbjct: 257 ELTIKDSNQMHAVCLDTYPPISYMNDTSRKIINMIHAFNKYQGELKVAYTYDAGPNAVLY 316

Query: 308 LLFTH--KIEETIKQFFP 323
           LL  H   +   I  +FP
Sbjct: 317 LLDEHVPDVVSLINYYFP 334


>gi|73956933|ref|XP_546783.2| PREDICTED: similar to Diphosphomevalonate decarboxylase (Mevalonate
           pyrophosphate decarboxylase) (Mevalonate
           (diphospho)decarboxylase) [Canis familiaris]
          Length = 400

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 168/326 (51%), Gaps = 27/326 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   V  D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAVSKDFTEDRIWLNGREEDV 74

Query: 86  QSSFFKKT-TQFCDLFRQ-----------FSKVYFL-IETSNNIPTKAGLASSASGFAAL 132
           +    +    +   L R+            S  Y + I + NN PT AGLASSA+G+A L
Sbjct: 75  EQPRLQACLREIRRLARKRRSTGDEDPLPLSLTYKVHIASVNNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLAQVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMGERADGKDSIARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K +GS   M+ +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLMGSTAGMQTSVETSPLLRFRAESVVPARMAEMTRCIQERDFQG 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
            G++  K++ + HAT +   PP+ Y    + + +  V  ++       + +T DAGPN  
Sbjct: 252 FGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIVHLVHRFNTHHGQTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDS 333
           ++FT  +E+T+ +F   +    P +S
Sbjct: 311 VVFT--LEDTVPEFVAAVQHCFPPES 334


>gi|194397794|ref|YP_002037062.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae G54]
 gi|194357461|gb|ACF55909.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae G54]
          Length = 317

 Score =  139 bits (350), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQS 87
           +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +   
Sbjct: 12  ANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE 71

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +     
Sbjct: 72  --HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++
Sbjct: 130 QLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT 
Sbjct: 181 KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
             A P   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 241 KTARPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 297


>gi|56808906|ref|ZP_00366615.1| COG3407: Mevalonate pyrophosphate decarboxylase [Streptococcus
           pyogenes M49 591]
 gi|209559230|ref|YP_002285702.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes NZ131]
 gi|209540431|gb|ACI61007.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes NZ131]
          Length = 314

 Score =  139 bits (350), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 160/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++      +
Sbjct: 70  EEHTKISTIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|191638487|ref|YP_001987653.1| Diphosphomevalonate decarboxylase [Lactobacillus casei BL23]
 gi|190712789|emb|CAQ66795.1| Diphosphomevalonate decarboxylase [Lactobacillus casei BL23]
 gi|327382522|gb|AEA53998.1| NapT5 [Lactobacillus casei LC2W]
 gi|327385719|gb|AEA57193.1| NapT5 [Lactobacillus casei BD-II]
          Length = 334

 Score =  139 bits (350), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 160/288 (55%), Gaps = 13/288 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +  + 
Sbjct: 9   TNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNNDRFMLNGEEQNPVA- 67

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +    
Sbjct: 68  ----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGLNLSP 123

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-IDRE 205
             LSR+AR GSGSA RS + G   W  G D     SFA P   Q P L + +L + +  E
Sbjct: 124 TELSRLARRGSGSATRSIFGGAVIWHRGHDD--ASSFAEPLAIQ-PSLPLRMLVVTVSAE 180

Query: 206 KK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           KK + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MHA 
Sbjct: 181 KKAVSSRKGMANTVATSPYYEAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMHAA 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T 
Sbjct: 241 IMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTE 288


>gi|326432730|gb|EGD78300.1| diphosphomevalonate decarboxylase [Salpingoeca sp. ATCC 50818]
          Length = 400

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 166/322 (51%), Gaps = 25/322 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILN 79
           +++   P NIA+ KYWGKRD+KL LP+N+SLS +L         TV  S   +AD I LN
Sbjct: 12  RATTTAPVNIAVIKYWGKRDTKLLLPINSSLSGTLDQEQLHARTTVAASSSFEADEIWLN 71

Query: 80  GQK--ISSQS-----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
           G++  IS+Q         +      D        +  I + NN PT AGLASSA+G+A L
Sbjct: 72  GKQEDISNQRLQNVLGAVRALAAKKDPEHPLKDAHIKIASVNNFPTAAGLASSAAGYACL 131

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA---VPFNN 189
             AL  ++ +  + + L+ +AR+GSGSACRS   GF  W  GT  +G DS A   VP  +
Sbjct: 132 VAALAELFGV--QDQELTAIARVGSGSACRSLMGGFVRWEKGTRDDGADSLASQVVP-ES 188

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFI 248
            WPD+++ +L +   +K + S   M+ T   S       + +    +  I++AI D+DF 
Sbjct: 189 HWPDMQVLILVVNAGKKGVSSTSGMQSTVKTSALINHRAEVVVPQRMKDIEKAIQDRDFQ 248

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPN 305
             G +  +++ + HAT +   PP+ Y     ++ +Q + +  DA  + I   +T DAGPN
Sbjct: 249 TFGRITMQDSNQFHATCLDTYPPIFYMNDVSRQIVQILTQYNDAAGE-IRAAYTYDAGPN 307

Query: 306 LKLL----FTHKIEETIKQFFP 323
             +        +I   +  +FP
Sbjct: 308 CVIYCLKQHVQEILSLVCHYFP 329


>gi|19745945|ref|NP_607081.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes
           MGAS8232]
 gi|19748103|gb|AAL97580.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes
           MGAS8232]
          Length = 314

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 160/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++      +
Sbjct: 70  EEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|194704310|gb|ACF86239.1| unknown [Zea mays]
 gi|223944587|gb|ACN26377.1| unknown [Zea mays]
          Length = 420

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 168/333 (50%), Gaps = 25/333 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 17  PTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 76

Query: 86  QSSFF--------KKTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSASGFA 130
               F        K+   F D  +        + K++  I + NN PT AGLASSA+G A
Sbjct: 77  LGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAAGLASSAAGLA 136

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L ++ ++ E    LS +AR GSGSACRS Y GF +W  G   +G DS AV   ++
Sbjct: 137 CFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAVQLADE 196

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
             W DL I +  +  ++K+  S   M  +   SP      Q +    +  +++AI ++DF
Sbjct: 197 THWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPGRVLKMEEAIKNRDF 256

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
               ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T DAGPN
Sbjct: 257 ESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPN 316

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS 338
             L+  ++  +T   F  ++    P    DL S
Sbjct: 317 AVLIAQNR--KTAAHFLQKLLYYFPPQDNDLSS 347


>gi|116494976|ref|YP_806710.1| mevalonate pyrophosphate decarboxylase [Lactobacillus casei ATCC
           334]
 gi|227535020|ref|ZP_03965069.1| possible diphosphomevalonate decarboxylase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|301066543|ref|YP_003788566.1| mevalonate pyrophosphate decarboxylase [Lactobacillus casei str.
           Zhang]
 gi|116105126|gb|ABJ70268.1| diphosphomevalonate decarboxylase [Lactobacillus casei ATCC 334]
 gi|227187335|gb|EEI67402.1| possible diphosphomevalonate decarboxylase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|300438950|gb|ADK18716.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus casei str.
           Zhang]
          Length = 334

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 160/288 (55%), Gaps = 13/288 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +  + 
Sbjct: 9   TNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNDDRFMLNGEEQNPVA- 67

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +    
Sbjct: 68  ----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGLNLSP 123

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-IDRE 205
             LSR+AR GSGSA RS + G   W  G D     SFA P   Q P L + +L + +  E
Sbjct: 124 TELSRLARRGSGSATRSIFGGAVIWHRGHDD--ASSFAEPLAIQ-PSLPLRMLVVTVSAE 180

Query: 206 KK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           KK + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MHA 
Sbjct: 181 KKAVSSRKGMANTVATSPYYDAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMHAA 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T 
Sbjct: 241 IMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTE 288


>gi|242063382|ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gi|241932811|gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
          Length = 420

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 160/308 (51%), Gaps = 23/308 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 17  PTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 76

Query: 86  QSSFF--------KKTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSASGFA 130
               F        K+   F D  +        + K++  I + NN PT AGLASSA+G A
Sbjct: 77  LGGRFQSCLREIRKRARDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAAGLASSAAGLA 136

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L ++ ++ E    LS +AR GSGSACRS Y GF +W  G   +G DS AV   ++
Sbjct: 137 CFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAVQLADE 196

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDF 247
             W DL I +  +  ++K+  S   M  +   SP      Q  + + +  +++AI ++DF
Sbjct: 197 THWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPSRVLKMEEAIKNRDF 256

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
               ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T DAGPN
Sbjct: 257 ESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPN 316

Query: 306 LKLLFTHK 313
             L+  ++
Sbjct: 317 AVLIAQNR 324


>gi|156545060|ref|XP_001600914.1| PREDICTED: similar to diphosphomevalonate decarboxylase [Nasonia
           vitripennis]
          Length = 379

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 157/297 (52%), Gaps = 15/297 (5%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS +L         TV  S     + I LNG++ S 
Sbjct: 10  PVNIAVIKYWGKRDEDLILPINDSLSATLDTEHLCAKTTVRASPEFKENKIWLNGREESM 69

Query: 86  QS----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            +    +  K+  +   L +        I + NN PT AGLASSA+G+A L  AL ++Y 
Sbjct: 70  DNPRLQNCLKEIKKRSQLSKDMESWKIHICSENNFPTAAGLASSAAGYACLAAALAKLYR 129

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLL 199
           +      +S +AR GSGSACRS Y GF  W  G+D  G+DS A P    + WPD+RI +L
Sbjct: 130 V---EGDISGIARAGSGSACRSVYGGFVRWYKGSDPTGIDSIAKPIAPASHWPDMRILVL 186

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
            + D +KK+ S   M+ T   S F T   ++ I   +  I++AI+ +DF    E   +++
Sbjct: 187 VVNDSKKKVSSAIGMKRTLLTSEFLTYKAEKIIPQRIEQIQEAILKRDFETFAEHTMRDS 246

Query: 259 LKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            +MHA  +AA PP +Y    +  I  +   +++      + ++ DAGPN  L    K
Sbjct: 247 NEMHAACLAAYPPCIYMNDTSHLIVELMHQYNSTSDRTKVAYSFDAGPNATLFLLEK 303


>gi|325186978|emb|CCA21522.1| diphosphomevalonate decarboxylase putative [Albugo laibachii Nc14]
          Length = 429

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 92/291 (31%), Positives = 152/291 (52%), Gaps = 17/291 (5%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGK +  LN PLN+S+S++L    L   T I V  S  A  + LNG+++S 
Sbjct: 9   PTNIAIIKYWGKENPVLNTPLNSSVSVTLDPTLLYAKTSIAVDQSFSATRMWLNGKELSQ 68

Query: 86  QSSFFKKTTQFCDLFRQFS------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             S   +     +L +  S      K++F I + N+ PT AGLASSA+G+A+L   L +I
Sbjct: 69  LPS---RAIAVIELLKSLSGDPKCRKMHFHIVSENSFPTGAGLASSAAGYASLVYTLAQI 125

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    E LS +AR GSGSACRS + G   W  GTD     +  +     WP+L   + 
Sbjct: 126 LDLHIPLEELSVIARQGSGSACRSLFGGLVRWDKGTDSASSKAIHIADETSWPELCAVIC 185

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEKNA 258
            + ++EK+  S   M++++  S      T +I  + +  ++ A ++++F + G +  +++
Sbjct: 186 VVNEKEKETSSTFGMQLSKRTSALLPFRTSKIVPERIEAMQSAFLEKNFTQFGRILMQDS 245

Query: 259 LKMHATMIAASPPLLYWQKET--IQGMERVWD--ARQQSIPIYFTLDAGPN 305
            + HA  +   PP+ Y    +  I  +   ++  +    I   +T DAGPN
Sbjct: 246 NQFHAICLDTQPPIFYMNATSQHIISLIHAYNNISEDGEIRAAYTFDAGPN 296


>gi|195175589|ref|XP_002028521.1| GL14496 [Drosophila persimilis]
 gi|194104348|gb|EDW26391.1| GL14496 [Drosophila persimilis]
          Length = 406

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 98/325 (30%), Positives = 163/325 (50%), Gaps = 24/325 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
           P NIA+ KYWGKR  +L LP+N+S+S++LG        T+  S+      N   ++ +  
Sbjct: 9   PVNIAIIKYWGKRHEELILPINDSISMTLGTNELCAKTTITASEK--FQHNRMWLNDEEL 66

Query: 89  FFKKTTQFCDLFRQFSKVYFL-------------IETSNNIPTKAGLASSASGFAALTLA 135
            F++ ++     +   ++  +             I + NN PT AGLASSA+G+A L  +
Sbjct: 67  LFEEDSRLMRCLKGVQRLAHINGSQEASLCWKVHIASRNNFPTAAGLASSAAGYACLVYS 126

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R+Y IP  +E L+ +AR GSGSACRS + GF +W  G   +G DS A P  +   WP+
Sbjct: 127 LARLYGIP-LTEELTTIARQGSGSACRSLFGGFVQWHRGVLDDGSDSVAEPVASAQHWPN 185

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGE 252
           + + +L + D  KK  S   M+ +   S        ++  + +A++K+AI  +DF    E
Sbjct: 186 MHVLILVVNDERKKTSSTTGMQRSVTTSQLIQHRVDKLVPERIANLKKAIKARDFQSFAE 245

Query: 253 VAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           +  K++ + HA  +   PP +Y       I      ++    ++   +T DAGPN  +  
Sbjct: 246 ITMKDSNQFHAIALDTYPPCVYMNDVSHAIVNFVHTYNKTTGTVHAAYTFDAGPNACI-- 303

Query: 311 THKIEETIKQFFPEITIIDPLDSPD 335
            + ++E + +    I  + P DS D
Sbjct: 304 -YVLKENVAKLLAAIQKVFPTDSID 327


>gi|94988369|ref|YP_596470.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS9429]
 gi|94992251|ref|YP_600350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS2096]
 gi|94994171|ref|YP_602269.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10750]
 gi|306827526|ref|ZP_07460809.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes ATCC
           10782]
 gi|94541877|gb|ABF31926.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS9429]
 gi|94545759|gb|ABF35806.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS2096]
 gi|94547679|gb|ABF37725.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10750]
 gi|304430324|gb|EFM33350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes ATCC
           10782]
          Length = 314

 Score =  139 bits (349), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 161/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T I+ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSISFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  EEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|239631424|ref|ZP_04674455.1| diphosphomevalonate decarboxylase [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525889|gb|EEQ64890.1| diphosphomevalonate decarboxylase [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 334

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 160/288 (55%), Gaps = 13/288 (4%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSS 88
           +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +  + 
Sbjct: 9   TNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNDDRFMLNGEEQNPVA- 67

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
                ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +    
Sbjct: 68  ----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGLNLSP 123

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-IDRE 205
             LSR+AR GSGSA RS + G   W  G D     SFA P   Q P L + +L + +  E
Sbjct: 124 TELSRLARRGSGSATRSIFGGAVIWHRGHDDTS--SFAEPLAIQ-PSLPLRMLVVTVSAE 180

Query: 206 KK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           KK + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MHA 
Sbjct: 181 KKAVSSRKGMANTVATSPYYDAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMHAA 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T 
Sbjct: 241 IMAEEPPFTYFLPETLRTWQLVQEQRALGIPAFATMDAGPNVKILTTE 288


>gi|6822071|emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis
           thaliana]
          Length = 413

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 100/314 (31%), Positives = 169/314 (53%), Gaps = 33/314 (10%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  + D D + LNG+
Sbjct: 11  TAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGK 70

Query: 82  KISSQSSFFK--------KTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSA 126
           +IS   S ++        +     D+ +        + K+   I + NN PT AGLASSA
Sbjct: 71  EISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV 
Sbjct: 131 AGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAVQ 190

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEIT---RHHSPFFTQWTQQISTDLAHIKQA 241
             ++  W DL I  +  ++     G RE++E +   +H +       + +   +  +++A
Sbjct: 191 LADEKHWDDLVI--IIAVETSSTSGMRESVETSLLLQHRA------KEVVPKRILQMEEA 242

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFT 299
           I ++DF    ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T
Sbjct: 243 IKNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYT 302

Query: 300 LDAGPNLKLLFTHK 313
            DAGPN  L+  ++
Sbjct: 303 FDAGPNAVLIARNR 316


>gi|50914046|ref|YP_060018.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10394]
 gi|50903120|gb|AAT86835.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10394]
          Length = 314

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 161/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++     +
Sbjct: 70  EEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFNTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|224286774|gb|ACN41090.1| unknown [Picea sitchensis]
          Length = 422

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 165/306 (53%), Gaps = 26/306 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQ 81
           +A  P+NIA+ KYWGKRD KL LP+N+S+S +L   HL   T + V  S  +D + LNG+
Sbjct: 13  TARAPTNIAVIKYWGKRDEKLILPINDSISFTLDPDHLSATTTVAVSPSFTSDRMWLNGK 72

Query: 82  KIS-----SQSSFFKKTTQFCDLFRQ----------FSKVYFLIETSNNIPTKAGLASSA 126
           ++S      Q+   +  ++  D+  +          + +++  I + NN PT AGLASSA
Sbjct: 73  EVSLGGERYQNCLREIRSRGNDVVDEKNGIVIRKEDWQRLHLHIASYNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  +L ++  + EK +  L+ +AR GSGSACRS Y G  +W  G + +G DS AV
Sbjct: 133 AGFACLVYSLAKLMDVKEKYQGELTAIARRGSGSACRSLYGGVVKWQMGKETDGSDSIAV 192

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
               +  W +L I +  +  R+K+  S   M  +   S      +Q+ +   +  +++AI
Sbjct: 193 QLATEKHWEELVILVAVVSSRQKETSSTTGMSQSVETSELLRHRSQEVVPKRVLQMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFT 299
            ++DF    ++   ++ + HA  +  SPP+ Y    +   I  +ER W+  + +  + +T
Sbjct: 253 ANRDFGSFAKITCADSNQFHAVCLDTSPPIFYMNDTSHRIINCVER-WNRSEGTPQVAYT 311

Query: 300 LDAGPN 305
            DAGPN
Sbjct: 312 FDAGPN 317


>gi|50252009|dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa
           Japonica Group]
 gi|215769195|dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222622023|gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
          Length = 421

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/313 (32%), Positives = 162/313 (51%), Gaps = 23/313 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 18  PTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 77

Query: 86  QSSFF-------KKTTQFCDLFRQ--------FSKVYFLIETSNNIPTKAGLASSASGFA 130
               F       +K  Q  +  ++        + K++  I + NN PT AGLASSA+G A
Sbjct: 78  SGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPTAAGLASSAAGLA 137

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L ++ ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV   ++
Sbjct: 138 CFVFTLGKLMNVKEDHGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAVQLADE 197

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
             W DL I +  +  ++K+  S   M  +   SP      Q +  + +  +++AI  ++F
Sbjct: 198 AHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPERVLKMEEAIKSRNF 257

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
                +   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T DAGPN
Sbjct: 258 ESFARLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNQSEGTPQVAYTFDAGPN 317

Query: 306 LKLLFTHKIEETI 318
             L+  ++   TI
Sbjct: 318 AVLIAPNRKNATI 330


>gi|71903328|ref|YP_280131.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS6180]
 gi|94990250|ref|YP_598350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10270]
 gi|9937401|gb|AAG02451.1|AF290097_2 mevalonate diphosphate decarboxylase [Streptococcus pyogenes]
 gi|71802423|gb|AAX71776.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS6180]
 gi|94543758|gb|ABF33806.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10270]
          Length = 314

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 160/288 (55%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++      +
Sbjct: 70  EEHTKISTIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQK 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL++ ++ ++    +
Sbjct: 130 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MHAT 
Sbjct: 181 KPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATT 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 241 KTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEK 288


>gi|126304960|ref|XP_001376834.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 398

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 168/323 (52%), Gaps = 29/323 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P+NIA+ KYWGKRD KL LP+N+SLS++L    L T T   +  D   D I LNG++   
Sbjct: 15  PTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKEDRIWLNGKEEDV 74

Query: 86  -----QSSFF--------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                QS           +++    DL     KV+  I + N+ PT AGLASSA+G+A L
Sbjct: 75  GHHRLQSCLREIRRLARKRRSGSDGDLVPLSYKVH--IASVNDFPTAAGLASSAAGYACL 132

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L ++Y +      LS VAR GSGSACRS + GF +W  G   +G DS A  V   + 
Sbjct: 133 VYTLAQLYGV---ESELSEVARQGSGSACRSMFGGFVQWHMGERPDGKDSIAQQVAPESH 189

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP+LR+ +L +    K + S   M+ +   S       + +    +A + + I ++DF  
Sbjct: 190 WPELRVLVLVVSAERKPVSSTSGMQTSVETSSLLKFRAESVVPGRMAEMARCIKERDFEA 249

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
            G++  K++ + HAT +   PP+ Y    + Q +  V  ++A      + +T DAGPN  
Sbjct: 250 FGQLTMKDSNQFHATCLDTFPPICYLNDTSRQIISLVHCFNAYYGKTKVAYTFDAGPN-A 308

Query: 308 LLFTHKIEETIKQFFPEITIIDP 330
           ++FT  +EET+ +F   I  + P
Sbjct: 309 VIFT--LEETVDEFVAVIKQVFP 329


>gi|195478959|ref|XP_002100713.1| GE17215 [Drosophila yakuba]
 gi|194188237|gb|EDX01821.1| GE17215 [Drosophila yakuba]
          Length = 391

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 104/328 (31%), Positives = 161/328 (49%), Gaps = 30/328 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNGQKISS 85
           P NIAL KYWGKR   L LP+N+S+S++L         TV  S+    + + LNG+++  
Sbjct: 9   PVNIALIKYWGKRHEDLILPVNDSISMTLSTDELCAKTTVTASETFERNRMWLNGEEVP- 67

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-------------IETSNNIPTKAGLASSASGFAAL 132
               F++ ++     ++  ++                I + NN PT AGLASSA+G+A L
Sbjct: 68  ----FEEGSRLQRCLKEVHRLAVAKGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYACL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
             +L R+Y IP  +E L+ VAR GSGSACRS Y GF +W  G   +G DS A  +  +  
Sbjct: 124 VYSLSRLYDIP-LNEELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVAKQIAPSAH 182

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WPD+ + +L + D  KK  S   M+ +   S        Q+  D +  +++AI   DF  
Sbjct: 183 WPDMHVLILVVNDARKKTASTRGMQQSVKTSQLIKHRVDQVVPDRINQLREAIASHDFQT 242

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDAGPNLK 307
             E+  K++ + HA  +   PP +Y    + + +  V D  +   S    +T DAGPN  
Sbjct: 243 FAEITMKDSNQFHAVALDTYPPCVYMNDVSHRIVSFVHDYNESMGSYHAAYTFDAGPNAC 302

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPD 335
           L   + + E +      +  + P D  D
Sbjct: 303 L---YVLAENVPHLLSAVQRVFPNDLAD 327


>gi|13539580|emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
          Length = 401

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 107/319 (33%), Positives = 161/319 (50%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S     +    +   +  + + I +QDF  
Sbjct: 193 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESGVPERMKEMTRCIQEQDFQG 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
            G++  K++ + HAT +   PP+ Y     +  IQ + R ++  Q    + +T DAGPN 
Sbjct: 253 FGQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNTHQGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|71667345|ref|XP_820623.1| diphosphomevalonate decarboxylase [Trypanosoma cruzi strain CL
           Brener]
 gi|70885974|gb|EAN98772.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 158/315 (50%), Gaps = 26/315 (8%)

Query: 29  PSNIALCKYWGKR--DSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKI 83
           P NIA  KYWGKR    KL LP N+S S++L      T  +V+   D + D +I+NG+K 
Sbjct: 11  PINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDTLIINGEKS 70

Query: 84  SSQS-----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
             +S     S  +     C    +  +VY + E  NN PT AG+ASSASG+ AL  AL R
Sbjct: 71  DVRSTPRIQSVLEYVRSTCPDELKNKRVYIVSE--NNFPTAAGMASSASGYCALAAALVR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
           +++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F   N WP++++
Sbjct: 129 VFN---STANVSMLARMGSGSACRSTLGGFVIWHKGEKEDGSDCVATQFVDENYWPEMQV 185

Query: 197 GLLKIIDREKK-IGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            L  ++  EKK   S   M+ +   SP    +    +S  +  + +AI  +DF    ++A
Sbjct: 186 -LCAVLQGEKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDFYTFAQIA 244

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              +  + A      P + Y  +++   +   + ++A++    + +T DAG N  L    
Sbjct: 245 MSESDDLQAICATTQPQIQYATEDSYAMIRLVKTYNAKKGHPTLAYTFDAGANCFLFVLE 304

Query: 313 K-IEETIK---QFFP 323
           K + E +    Q FP
Sbjct: 305 KDLPEAVAMLMQHFP 319


>gi|147857960|emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
          Length = 451

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 163/307 (53%), Gaps = 34/307 (11%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V     +D + LNG
Sbjct: 13  TTAQTPTNIAVIKYWGKRDEGLILAVNDSISVTLDPQHLCTTTTVAVSPMFQSDRMWLNG 72

Query: 81  QKIS--------------SQSSFFKKTTQFCDLFRQ-FSKVYFLIETSNNIPTKAGLASS 125
           ++IS              S++S  +   +   + ++ + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS Y GF +W+ G ++NG DS AV
Sbjct: 133 AAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEENGSDSIAV 192

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAI 242
              ++  W +L I +  +  R+K+  S   M  +   S       ++ +   +  +++AI
Sbjct: 193 QLQDEKHWDELVIIIAVVSSRQKETSSTSGMRDSVETSLLLQHRAKEVVPKRIIEMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA 302
            ++DF     +   ++ + HA  +  SPP+ Y    +          RQ    + +T DA
Sbjct: 253 KNRDFPSFARLTCXDSNQFHAVCLDTSPPIFYMNDTS---------HRQ----VAYTFDA 299

Query: 303 GPNLKLL 309
           GPN  L+
Sbjct: 300 GPNAVLI 306


>gi|332846640|ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase isoform 4 [Pan
           troglodytes]
          Length = 400

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 159/318 (50%), Gaps = 27/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDV 74

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             ++ ++  D           + + NN PT AGLASSA+G+A L
Sbjct: 75  GQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPS 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
             ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  
Sbjct: 252 FAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEI 325
           ++FT  +++T+ +F   +
Sbjct: 311 VIFT--LDDTVAEFVAAV 326


>gi|332265764|ref|XP_003281885.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate
           decarboxylase-like [Nomascus leucogenys]
          Length = 370

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 105/322 (32%), Positives = 158/322 (49%), Gaps = 35/322 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG+    
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGR---- 70

Query: 86  QSSFFKKTTQFC-----------------DLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
           +    +   Q C                 D           + + NN PT AGLASSA+G
Sbjct: 71  EEDMGQPRLQACLREIRCLARKRRNSWDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAG 130

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VP 186
           +A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V 
Sbjct: 131 YACLAYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVA 187

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQ 245
             + WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++
Sbjct: 188 PESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIQER 247

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAG 303
           DF    ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAG
Sbjct: 248 DFPSFAQLTMKDSNQFHATCLDTFPPISYLNAMSWRIIHLVHRFNAHHGDTKVAYTFDAG 307

Query: 304 PNLKLLFTHKIEETIKQFFPEI 325
           PN  ++FT  +++T+ +F   +
Sbjct: 308 PN-AVIFT--LDDTVAEFVAAV 326


>gi|115495513|ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 gi|122144236|sp|Q0P570|ERG19_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|112362156|gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 gi|296477937|gb|DAA20052.1| diphosphomevalonate decarboxylase [Bos taurus]
          Length = 400

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 107/325 (32%), Positives = 163/325 (50%), Gaps = 41/325 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D   D I LNG+    
Sbjct: 15  PVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTEDRIWLNGR---- 70

Query: 86  QSSFFKKTTQFCDLFRQFSKVY-------------------FLIETSNNIPTKAGLASSA 126
           +        Q C   R+  ++                      + + NN PT AGLASSA
Sbjct: 71  EEDMGHPRLQAC--LREIRRLARKRRSDGHEDPLPLSLSYKVHVASENNFPTAAGLASSA 128

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  
Sbjct: 129 AGYACLAYTLARVYGV---DSDLSEVARRGSGSACRSLYGGFVEWQMGERPDGKDSVACQ 185

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
           V   + WP+LR+ +L +    K +GS   M+ +   S       +  +   +A + + I 
Sbjct: 186 VAPESHWPELRVLILVVSAERKPMGSTAGMQTSVETSALLKFRAEALVPPRMAEMTRCIR 245

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYW---QKETIQGMERVWDARQQSIPIYFTL 300
           +++F   G++  K++ + HAT +   PP+ Y     +  IQ + R ++A      + +T 
Sbjct: 246 ERNFQAFGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIIQLVHR-FNAHHGQTKVAYTF 304

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEI 325
           DAGPN  ++FT  +++T+ +F   +
Sbjct: 305 DAGPN-AVVFT--LDDTVAEFVAAV 326


>gi|30584105|gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic
           construct]
 gi|61372632|gb|AAX43880.1| mevalonate (diphospho) decarboxylase [synthetic construct]
          Length = 401

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 159/318 (50%), Gaps = 27/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDV 74

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             ++ ++  D           + + NN PT AGLASSA+G+A L
Sbjct: 75  GQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPS 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
             ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  
Sbjct: 252 FAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEI 325
           ++FT  +++T+ +F   +
Sbjct: 311 VIFT--LDDTVAEFVAAV 326


>gi|226504358|ref|NP_001149256.1| LOC100282878 [Zea mays]
 gi|195625824|gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gi|238011262|gb|ACR36666.1| unknown [Zea mays]
          Length = 420

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 158/308 (51%), Gaps = 23/308 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 17  PTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 76

Query: 86  QSSFF--------KKTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASSASGFA 130
               F        K+   F D  +        + K++  I + NN PT AGLASSA+G A
Sbjct: 77  LGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAAGLASSAAGLA 136

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L ++ +  E    LS +AR GSGSACRS Y GF +W  G   +G DS AV   ++
Sbjct: 137 CFVFTLGKLMNAKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAVQLADE 196

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
             W DL I +  +  ++K+  S   M  +   SP      Q +    +  +++AI ++DF
Sbjct: 197 THWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPGRVLKMEEAIKNRDF 256

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPN 305
               ++   ++ + HA  +  SPP+ Y    +  I  +   W+  + +  + +T DAGPN
Sbjct: 257 ESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPN 316

Query: 306 LKLLFTHK 313
             L+  ++
Sbjct: 317 AVLIAQNR 324


>gi|109129490|ref|XP_001089404.1| PREDICTED: diphosphomevalonate decarboxylase [Macaca mulatta]
          Length = 401

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 160/318 (50%), Gaps = 27/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKIS- 84
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDV 74

Query: 85  SQSSFFKKTTQFCDLFRQFSKVY------------FLIETSNNIPTKAGLASSASGFAAL 132
            Q        +   L R+    +              + + NN PT AGLASSA+G+A L
Sbjct: 75  GQPRLQACLREIRRLARKRRNAWDGDPLSSSLSCKVHVASVNNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQTDGKDSVARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAEAVVPARMAEMTRCIRERDFPG 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
             ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  
Sbjct: 252 FAQLTMKDSNQFHATCLDTFPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEI 325
           ++FT  +++T+ +F   +
Sbjct: 311 VIFT--LDDTVAEFVAAV 326


>gi|4505289|ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 gi|1706681|sp|P53602|ERG19_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|218681762|pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate
           Decarboxylase
 gi|218681763|pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate
           Decarboxylase
 gi|1235682|gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gi|12652543|gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gi|30582699|gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gi|60655429|gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|119587196|gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gi|123994097|gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|124126813|gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|261858458|dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
          Length = 400

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 103/318 (32%), Positives = 159/318 (50%), Gaps = 27/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDV 74

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             ++ ++  D           + + NN PT AGLASSA+G+A L
Sbjct: 75  GQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPS 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
             ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  
Sbjct: 252 FAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEI 325
           ++FT  +++T+ +F   +
Sbjct: 311 VIFT--LDDTVAEFVAAV 326


>gi|195384315|ref|XP_002050863.1| GJ19966 [Drosophila virilis]
 gi|194145660|gb|EDW62056.1| GJ19966 [Drosophila virilis]
          Length = 390

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 102/326 (31%), Positives = 167/326 (51%), Gaps = 20/326 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNG 80
           ++   P N+AL KYWGKR+ +L LP+N+S+S++L         T+  S++   + + LNG
Sbjct: 4   ATCVAPVNMALVKYWGKRNEELILPINDSVSMTLDANEMCAKTTITASESFKQNRMWLNG 63

Query: 81  QKISSQSSF-------FKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAAL 132
           + ++ + +          +     +   +FS  + L I + NN PT AGLASSA+G+A L
Sbjct: 64  EVVTFEENARLMRCLAGVQRLALANGAHKFSLSWKLHIASYNNFPTAAGLASSAAGYACL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQ 190
              L R+Y +P  +E L+ VAR GSGSACRS Y GF  W  G+  +G DS AVP    + 
Sbjct: 124 VYTLARLYELP-LNEELTTVARQGSGSACRSLYGGFVHWRRGSSADGSDSIAVPLAPASH 182

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIK 249
           WP++ + +L + D  KK GS   M++    S       ++ +   +  +  AI  +DF  
Sbjct: 183 WPNMHMLILVVNDARKKTGSTRGMQLGVSTSSLIQHRAKEVVPRRVKELMAAIESRDFQA 242

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDAGPNLK 307
             E+  K + ++HA  +   PP +Y    +   +  V D  +   S+   +T DAGPN  
Sbjct: 243 FAEITIKESNQLHAICLDTYPPCVYMNDVSHAIVNFVHDYNETVGSLQAAYTFDAGPNAC 302

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDS 333
           +   + + E + +    I +  P D+
Sbjct: 303 I---YVLAENVPRLLAAIQLAFPNDA 325


>gi|71419541|ref|XP_811200.1| diphosphomevalonate decarboxylase [Trypanosoma cruzi strain CL
           Brener]
 gi|70875837|gb|EAN89349.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 154/314 (49%), Gaps = 24/314 (7%)

Query: 29  PSNIALCKYWGKR--DSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKI 83
           P NIA  KYWGKR    KL LP N+S S++L      T  +V+   D + D +ILNG+K 
Sbjct: 11  PINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDTLILNGEKS 70

Query: 84  SSQS-----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
             +S     S        C    +  +VY + E  NN PT AG+ASSASG+ AL  AL R
Sbjct: 71  DVRSTPRIQSVLDYVRSTCPDELKNKRVYIVSE--NNFPTAAGMASSASGYCALAAALVR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
           +++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F   N WP++++
Sbjct: 129 VFN---STANVSMLARMGSGSACRSTLGGFVIWHKGEKEDGSDCVATQFVDENYWPEMQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
               +   +K   S   M+ +   SP    +    +S  +  + +AI  +DF    ++A 
Sbjct: 186 LCAVLQGGKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDFYTFAQIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  + A      P + Y  +++   +   + ++A++    + +T DAG N  L    K
Sbjct: 246 NESDDLQAICATTQPQIQYATEDSYAMIRLVKTYNAKKGHPTLAYTFDAGANCFLFVLEK 305

Query: 314 -IEETIK---QFFP 323
            + E +    Q FP
Sbjct: 306 DLPEAVAMLMQHFP 319


>gi|254566013|ref|XP_002490117.1| Mevalonate pyrophosphate decarboxylase [Pichia pastoris GS115]
 gi|238029913|emb|CAY67836.1| Mevalonate pyrophosphate decarboxylase [Pichia pastoris GS115]
          Length = 382

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 162/314 (51%), Gaps = 27/314 (8%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKIS 84
           L +N  + KYWGKRD+ LNLP N+S+S++L      T  TV  S   + D + LNG    
Sbjct: 10  LLTNFQVLKYWGKRDTNLNLPTNSSISVTLSQKDLRTLTTVNSSRNFEKDSLYLNG---V 66

Query: 85  SQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLASSASGFA 130
           S S    +TT   +  R              + S+    I + NN PT AGLASSA+GFA
Sbjct: 67  SHSIENDRTTNCLEQLRSLRQQLEEDDPNLPKLSQWKLHIISENNFPTAAGLASSAAGFA 126

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-- 188
           A+  A+ ++Y +P+ +  LSR+AR GSGSACRS + G+  W  G   +G DS AV     
Sbjct: 127 AMVAAISKLYELPQDASELSRIARKGSGSACRSMFGGYVAWEMGEKLDGTDSKAVQIAPP 186

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDF 247
             WP+++  +  + D +K + S   M+ T   S  F  +  Q +    + +  AI ++DF
Sbjct: 187 EHWPNMKAAICIVSDLKKDVSSTSGMQTTVQTSELFQYRVNQVVPPRYSQMVDAIKNRDF 246

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYW---QKETIQGMERVWDARQQSIPIYFTLDAGP 304
              G +  K++   HAT + + PP+ Y     K+ I+ +  + DA  + +  Y T DAGP
Sbjct: 247 ETFGTLTMKDSNSFHATCLDSYPPIFYLTDTSKKIIKLIHTLNDAIGKVVAAY-TFDAGP 305

Query: 305 NLKLLFTHKIEETI 318
           N  + +  + EE +
Sbjct: 306 NAVIYYESENEEVV 319


>gi|149701783|ref|XP_001488083.1| PREDICTED: similar to Diphosphomevalonate decarboxylase (Mevalonate
           pyrophosphate decarboxylase) (Mevalonate
           (diphospho)decarboxylase) [Equus caballus]
          Length = 400

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 161/322 (50%), Gaps = 35/322 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D   D I LNG+    
Sbjct: 15  PVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWLNGR---- 70

Query: 86  QSSFFKKTTQFC-----------------DLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
           +    +   Q C                 DL          + + NN PT AGLASSA+G
Sbjct: 71  EEDVGQPRLQACLREIRRLARKRRSAGDEDLLPLSLSYKVHVASVNNFPTAAGLASSAAG 130

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VP 186
           +A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V 
Sbjct: 131 YACLAYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGQRADGKDSVARQVA 187

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQ 245
               WP+LR+ +L +   +K  GS   M+ +   SP      +  +   +A + + ++++
Sbjct: 188 PELHWPELRVLILVVSAEKKLTGSTVGMQTSVETSPLLRFRAEALVPARMAEMARCVMER 247

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAG 303
           DF   G++  K++ + HAT +   PP+ Y    +  I  +   ++A      + +T DAG
Sbjct: 248 DFQAFGQLTMKDSNQFHATCLDTFPPISYLNDTSRCIIHLVHRFNAHHGQTKVAYTFDAG 307

Query: 304 PNLKLLFTHKIEETIKQFFPEI 325
           PN  ++FT  +++T+ +F   +
Sbjct: 308 PN-AVIFT--LDDTMAEFVAAV 326


>gi|55925435|ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 gi|82179976|sp|Q5U403|ERG19_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|55154472|gb|AAH85325.1| Zgc:100824 [Danio rerio]
          Length = 400

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 114/326 (34%), Positives = 163/326 (50%), Gaps = 29/326 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIIL 78
           E  +   P NIA+ KYWGKRD  L LP+N SLS++L   HL T T I    S   DCI L
Sbjct: 10  EMVTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSRSFHKDCIWL 69

Query: 79  NG--QKISS---QSSFF------KKTTQFCDLFRQFS-KVYFLIETSNNIPTKAGLASSA 126
           NG  Q IS    QS         ++     D     S KV+  I + NN PT AGLASSA
Sbjct: 70  NGKEQDISHPRLQSCLLEIRRLAQRRKNTGDPASDVSNKVH--ICSVNNFPTAAGLASSA 127

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           +G+A L   L +++++      LS VAR GSGSACRS Y GF +W  G   +G DS A  
Sbjct: 128 AGYACLVYTLSQLFNV---EGELSGVARQGSGSACRSLYGGFVQWKLGEQSDGKDSIAEQ 184

Query: 187 FNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAII 243
             ++  WP+LR+ +L +   +K +GS   M  +   S         +    +  + +AI 
Sbjct: 185 VASELYWPELRVLILVVSAEQKSVGSTSGMHTSVETSHLLKYRADAVVPGRMEEMIRAIR 244

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLD 301
            +DF K GE+  K++ + HA  +   PP+ Y    + Q +  V  ++       + +T D
Sbjct: 245 LRDFPKFGELTMKDSNQFHAICLDTYPPIFYLNNISHQIISLVHRYNQYYGETRVAYTFD 304

Query: 302 AGPNLKLL----FTHKIEETIKQFFP 323
           AGPN  +     +  +  E ++ FFP
Sbjct: 305 AGPNAVIYSLQDYLPEFVEVVRHFFP 330


>gi|256985114|ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 gi|160332329|sp|Q99JF5|ERG19_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|74147844|dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gi|148679734|gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
          Length = 401

 Score =  135 bits (340), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 161/319 (50%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S       + +  + +  + + I +QDF  
Sbjct: 193 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQG 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++  Q    + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNTHQGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|159898136|ref|YP_001544383.1| diphosphomevalonate decarboxylase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159891175|gb|ABX04255.1| diphosphomevalonate decarboxylase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 334

 Score =  135 bits (340), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 166/321 (51%), Gaps = 16/321 (4%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV------IDSD 72
           +++  ++A   +NIA  KYWG+ DS+L LP N S+S++L   G +T  TV      +D  
Sbjct: 3   QLSHAATAVACANIAFIKYWGQHDSQLTLPTNGSISMNLD--GCLTETTVQCLPEAVDDS 60

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFA 130
               +  G+++ ++   F++  Q  +  RQ + V   +E  + NN P+ AG+ASSA+ FA
Sbjct: 61  VWLALSGGEEVQAKGRQFERVIQQIERLRQLAGVTERVEVRSRNNFPSDAGIASSAAAFA 120

Query: 131 ALTLALFRIYSIPEKSESLSRVARL-GSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           ALT A    + +      LSR+ RL GSGSACRS   GF EW       G  +  +    
Sbjct: 121 ALTRAAASAFRLELDEAELSRLTRLSGSGSACRSIPAGFVEWYNDGTHAGSYAAQIAPPE 180

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
            W    + ++ +I  E K  +  +       SP+F+   + I   LA ++Q I+++D  +
Sbjct: 181 HWN--LVDIVAVISTEAKHVASTSGHSVATTSPYFSVRLEGIEQRLADVRQGILERDIER 238

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
           LG  +E +A+ MH   + A P  +YW   T+  M+ V  W A Q ++  Y+T+DAGPN+ 
Sbjct: 239 LGRASEADAMSMHVIAMTAQPSTMYWLPGTLAVMQAVQRWRA-QDNLQSYWTIDAGPNVH 297

Query: 308 LLFTHKIEETIKQFFPEITII 328
           ++   K    ++    E+  +
Sbjct: 298 VICEAKDAPEVEARLCELDAV 318


>gi|322818236|gb|EFZ25707.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 153/314 (48%), Gaps = 24/314 (7%)

Query: 29  PSNIALCKYWGKR--DSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKI 83
           P NIA  KYWGKR    KL LP N+S S++L      T  +V+   D + D +ILNG+K 
Sbjct: 11  PINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDTLILNGEKS 70

Query: 84  SSQS-----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
             +S     S        C    +  +VY + E  NN PT AG+ASSASG+ AL  AL R
Sbjct: 71  DVRSTPRIQSVLDYVRSTCPDELKNKRVYIVSE--NNFPTAAGMASSASGYCALAAALVR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
           +++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F   N WP++++
Sbjct: 129 VFN---STANVSMLARMGSGSACRSALGGFVIWHKGEKEDGSDCVATQFVDENYWPEMQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIIDQDFIKLGEVAE 255
                   +K   S   M+ +   SP   +     +S  +  + +AI  +DF    ++A 
Sbjct: 186 LCAVFQGGKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDFYAFAQIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  + A      P + Y  +++   +  V  ++A++    + +T DAG N  L    K
Sbjct: 246 SESDDLQAICATTQPQIQYATEDSYAMIRLVKNYNAKKGHPTLAYTFDAGANCFLFVLEK 305

Query: 314 -IEETIK---QFFP 323
            + E +    Q FP
Sbjct: 306 DLPEAVAMLMQHFP 319


>gi|195456994|ref|XP_002075379.1| GK17667 [Drosophila willistoni]
 gi|194171464|gb|EDW86365.1| GK17667 [Drosophila willistoni]
          Length = 396

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 164/325 (50%), Gaps = 30/325 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS----DADCIILNGQKIS 84
           P NIAL KYWGKR+ +L LP+N+S+S++L +   +   T I S     A+ + LNG++++
Sbjct: 9   PVNIALIKYWGKRNEELILPINDSISMTL-NANEMCAKTTISSWETFKANRMWLNGEEVT 67

Query: 85  SQSSFFKKTTQFCDLFRQFS------------KVYFLIETSNNIPTKAGLASSASGFAAL 132
            + +   +  +  D  R+ +            KV+  I + NN PT AGLASSA+G+A L
Sbjct: 68  FEEN--ARLMRCLDGVRRLAVANGALKVPLNWKVH--IASRNNFPTAAGLASSAAGYACL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L R+Y IP  +E L+ VAR GSGSACRS Y GF  W  G   +G DS A  V   + 
Sbjct: 124 VYTLARLYGIP-INEELTAVARQGSGSACRSLYGGFVRWHSGVLDDGSDSVAKQVVSPDH 182

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIK 249
           WP++ I +L + D  KK  S + M+     S       +  +      + +AI  +DF  
Sbjct: 183 WPNMHILILVVNDARKKTPSTKGMQRAVTTSALIQHRAKVVVPRRTEELTEAIQLRDFNS 242

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLK 307
             E+  K++ + HA  +   PP +Y      +I      ++    S+   +T DAGPN  
Sbjct: 243 FAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVNFVHAYNEAVGSLQAAYTFDAGPNAC 302

Query: 308 LLFTHKIEETIKQFFPEITIIDPLD 332
           L   + +EE + Q    I +  P D
Sbjct: 303 L---YVLEENVPQLLAAIQLAFPND 324


>gi|195026352|ref|XP_001986237.1| GH20637 [Drosophila grimshawi]
 gi|193902237|gb|EDW01104.1| GH20637 [Drosophila grimshawi]
          Length = 393

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/329 (31%), Positives = 164/329 (49%), Gaps = 25/329 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNG 80
           ++   P N+AL KYWGKR+ +L LP+N+S+S++L         TV  S++   + + LNG
Sbjct: 4   ATCVAPVNMALVKYWGKRNEELILPINDSISMTLDANEMCAKTTVAASESFKENRMWLNG 63

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVY-----------FLIETSNNIPTKAGLASSASGF 129
            +   Q++   +  +  D  ++ +  +             I + NN PT AGLASSA+G+
Sbjct: 64  DEQPFQAN--ARLQRCLDGVQRLALAHGGAHRFPLSWKVHIASHNNFPTAAGLASSAAGY 121

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           A L   L R+Y +P   E L+ +AR GSGSACRS Y GF +W  G+  +G DS AV  + 
Sbjct: 122 ACLVYTLARLYDVP-LDEQLTTIARQGSGSACRSLYGGFVQWQRGSSADGSDSIAVQLSP 180

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQD 246
              WP++ + +L + D  KK GS   M+     S     + TQ +      +K AI  +D
Sbjct: 181 ATHWPNMHMLILVVNDARKKTGSTSGMQRAVETSALIQHRATQVVPQRSKELKVAIEKRD 240

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGP 304
           F     +  K + ++HA  +   PP +Y      +I      ++    S+ + +T DAGP
Sbjct: 241 FNAFATITMKESNQLHAIALDTFPPCVYMNDVSHSIVNFVHEYNEEAGSLHVAYTFDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           N  L   + ++E +      I +  P D+
Sbjct: 301 NGCL---YVLDEHVPHLLAAIQLAFPNDA 326


>gi|26354448|dbj|BAC40852.1| unnamed protein product [Mus musculus]
 gi|74191909|dbj|BAE32901.1| unnamed protein product [Mus musculus]
          Length = 401

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 106/319 (33%), Positives = 159/319 (49%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S     Q    +   +  + + I +QDF  
Sbjct: 193 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFQAESVVPERMKEMTRCIQEQDFQG 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + H T +   PP+ Y     +  IQ + R ++  Q    + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHVTCLDTFPPISYLNDTSRRIIQLVHR-FNTHQGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|268532738|ref|XP_002631497.1| Hypothetical protein CBG20661 [Caenorhabditis briggsae]
 gi|187022950|emb|CAP37628.1| hypothetical protein CBG_20661 [Caenorhabditis briggsae AF16]
          Length = 372

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 174/333 (52%), Gaps = 23/333 (6%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII-LNGQKISSQ 86
           +P NIAL KYWGKRD +L LPLN+S+SL++  L   T + +I    +  + +NG+++   
Sbjct: 15  VPMNIALVKYWGKRDEQLILPLNDSISLTVDKLTAETTVRMIQVVGENTVEINGRRVELS 74

Query: 87  SSFFKKTT----------QFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALT 133
           S+   +T           +  DL +  +K    +F + +  N P  AGLASSA+GFAA+ 
Sbjct: 75  SNKRYQTVFDEALRLQRKRKEDLNKNENKCITHHFEVISKTNFPVAAGLASSAAGFAAIA 134

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WP 192
            A+ +I ++ +     +R+AR+GSGSACRS + G   W  G  ++G D  AV   ++ WP
Sbjct: 135 RAIQKILNLNDT--QANRLARIGSGSACRSMFGGLVHWKKGEKEDGSDCVAVKTESENWP 192

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLG 251
           DL   +L   D  KK+GS E M  TR  S       + +  + +  +K+A   ++F  L 
Sbjct: 193 DLYCIILVFNDERKKVGSSEGMRRTRETSTLLKHRIEYVVPERIEQVKKAYESRNFQDLA 252

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF- 310
            V   ++ + HA  + + PP+ Y  + + + +E V    QQ +   +T DAGPN  ++  
Sbjct: 253 RVIMADSNQFHAVCLDSIPPIRYLNESSWRLIELVEKFNQQEVKAAYTFDAGPNACVIVQ 312

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSL 343
            + +   I+    +I I     S DL S ++ L
Sbjct: 313 KYDVPAFIRTLLQDIII----PSEDLKSVEEEL 341


>gi|332376218|gb|AEE63249.1| unknown [Dendroctonus ponderosae]
          Length = 386

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 167/326 (51%), Gaps = 23/326 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQ 81
           +   P NIA+ KYWGKRD  L LP+N+S+S SL         T++ S     +   LNG+
Sbjct: 5   TCVAPVNIAVIKYWGKRDENLILPINDSISASLSTDIMCAKTTIMASPLLKENKFWLNGR 64

Query: 82  KISSQSSFF----KKTTQFCD-LFRQFS-KVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           + +  S  F    K     CD    QF+ K+    E  NN PT AGLASSA+G+A L  A
Sbjct: 65  EQTFDSPRFSNCIKAIRARCDETLPQFNWKISICSE--NNFPTAAGLASSAAGYACLVHA 122

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPD 193
           L ++Y I  K E +S +AR GSGSACRS Y G+ +W  G    G DS A  +   + WP+
Sbjct: 123 LAQLYEI--KGE-ISDIARQGSGSACRSIYGGWVQWHKGDLPTGADSIATQIAPADHWPE 179

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAH-IKQAIIDQDFIKLGE 252
           +RI +L + D  KK  S   M+ T   S       + +    A  +K+AI D+D+    E
Sbjct: 180 MRIIVLVVNDCRKKYSSTSGMKTTTETSTLVKFRAESVVNQRAKAMKKAIEDKDYESFAE 239

Query: 253 VAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPNLKL-L 309
           +  K++ +MHA  +   PP +Y    +  I  +   ++  ++   + +T DAGPN  + L
Sbjct: 240 ITMKDSNQMHAICLDTFPPCVYMNDTSHAIVNLVHSYNEYKKGQKVAYTFDAGPNACIYL 299

Query: 310 FTHKIEE---TIKQFFPEITIIDPLD 332
              ++E+    +   FP+   ID ++
Sbjct: 300 LQSEVEQFISVVNHVFPKPADIDAVE 325


>gi|14250208|gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
          Length = 401

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 160/319 (50%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S       + +  + +  + + I +QDF  
Sbjct: 193 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQG 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++       + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNTHHGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|154335383|ref|XP_001563930.1| diphosphomevalonate decarboxylase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134060961|emb|CAM37978.1| putative mevalonate-diphosphate decarboxylase [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 393

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 161/323 (49%), Gaps = 25/323 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+   KL LP N+S S++L      +  +V    D+  D + LNG+K 
Sbjct: 22  PINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRRDATEDELWLNGKKS 81

Query: 84  SSQSSFFKKTTQFC---DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           + Q +   ++   C   +       +   I + NN PT AG+ASSASG+ AL  AL + Y
Sbjct: 82  NIQETPRIQSVLSCIRANCPSHLKSLKAYIVSENNFPTAAGMASSASGYCALASALVKAY 141

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRIGL 198
           S    +  +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  WPD+++ L
Sbjct: 142 S---ATVDVSMLSRLGSGSACRSAYGGFVIWHRGEKPDGTDCIATQFVDEKYWPDMQV-L 197

Query: 199 LKIIDREKK-IGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             ++  EKK + S   M+ +   SP  + +    +   +  +K+AI  +DF K  E+A  
Sbjct: 198 CAVLKGEKKDVSSTTGMQQSLKTSPMMSDRIASVVPARMKAVKEAIQQRDFNKFAEIAMA 257

Query: 257 NALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           ++  +        P + Y  +++   +   R ++A++    + +T DAG N  +      
Sbjct: 258 DSDDLQEICHTTVPCIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCFMF----- 312

Query: 315 EETIKQFFPEITIIDPLDSPDLW 337
             T+K+  PE+  +     P  W
Sbjct: 313 --TLKKNLPEVVAMLCAHFPTSW 333


>gi|215261394|pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 gi|215261395|pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
          Length = 414

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 160/319 (50%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 29  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 88

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 89  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 148

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 149 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 205

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S       + +  + +  + + I +QDF  
Sbjct: 206 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQG 265

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++       + +T DAGPN 
Sbjct: 266 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNTHHGQTKVAYTFDAGPN- 323

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 324 AVIFT--LEDTVAEFVAAV 340


>gi|51980639|gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gi|149038387|gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
          Length = 401

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 107/319 (33%), Positives = 158/319 (49%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T   D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLARVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LR+ +L +   +K  GS   M+ +   S       + I  + +  + + I +QDF  
Sbjct: 193 WPQLRVLILVVSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMKEMTRCIQEQDFQA 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++A      + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNAHHGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|76798602|ref|ZP_00780830.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 18RS21]
 gi|76586036|gb|EAO62566.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 18RS21]
          Length = 314

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 156/282 (55%), Gaps = 11/282 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T +  DA  D   ++G  +    
Sbjct: 12  ANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYISG--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    +       
Sbjct: 70  HEHDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDFFGTNLSQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L++ A+  SGS+ RSF+     W    D++  D + V  N    DL + +L + D+ K 
Sbjct: 130 QLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTN---LDLAMIMLVLNDKRKP 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL MH+T   
Sbjct: 183 ISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNALAMHSTTKT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L
Sbjct: 243 ATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVL 284


>gi|22537472|ref|NP_688323.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae
           2603V/R]
 gi|77409167|ref|ZP_00785879.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae COH1]
 gi|22534350|gb|AAN00196.1|AE014252_19 diphosphomevalonate decarboxylase [Streptococcus agalactiae
           2603V/R]
 gi|77172213|gb|EAO75370.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae COH1]
          Length = 314

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 156/282 (55%), Gaps = 11/282 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T +  DA  D   ++G  +    
Sbjct: 12  ANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYISG--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    +       
Sbjct: 70  HEHDKMSAILDRFRQNRSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDFFGTNLSQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L++ A+  SGS+ RSF+     W    D++  D + V  N    DL + +L + D+ K 
Sbjct: 130 QLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTN---LDLAMIMLVLNDKRKP 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL MH+T   
Sbjct: 183 ISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNALAMHSTTKT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L
Sbjct: 243 ATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVL 284


>gi|47230341|emb|CAF99534.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 393

 Score =  132 bits (333), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 113/324 (34%), Positives = 169/324 (52%), Gaps = 36/324 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS----DADCIILNGQK-- 82
           P NIA+ KYWGKR+ +L LP+N+SLS++L H   +   T + +    + D I LNG++  
Sbjct: 11  PVNIAVIKYWGKRNEELILPINSSLSVTL-HQDQLKTTTTVVTSKSFEEDRIWLNGKEED 69

Query: 83  ISSQ--SSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGF 129
           IS     S  K+  +     R              KV+  I + NN PT AGLASSA+GF
Sbjct: 70  ISHPRLQSCLKEIRRLARKRRNDENPSLESPVWSHKVH--ICSINNFPTAAGLASSAAGF 127

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPF 187
           A L   L R++ +      LS +AR GSGSACRS Y GF +WI G  ++G DS A  V  
Sbjct: 128 ACLVYTLARVFGV---EGELSAIARQGSGSACRSMYGGFVQWIMGQREDGKDSIALQVEP 184

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQD 246
           ++ WP+LRI +L     +K +GS   M+ +   S       + +    LA + QA+  +D
Sbjct: 185 DSHWPELRILVLVASAEKKPVGSTAGMQTSVETSCLLKYRAESVVPGRLAEMIQAVRRRD 244

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGP 304
           F    E+  K++ + HAT +   PP+ Y    + Q +  V  ++     + + +T DAGP
Sbjct: 245 FATFAELTMKDSNQFHATCLDTYPPIFYLSSVSQQVINLVHRYNRHYGEMRVSYTFDAGP 304

Query: 305 NLKLLFT---HKIE--ETIKQFFP 323
           N  ++FT   H  E  + ++ FFP
Sbjct: 305 N-AVIFTLEQHVSEFLQVVQHFFP 327


>gi|213514480|ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gi|209156004|gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
          Length = 402

 Score =  132 bits (333), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 160/331 (48%), Gaps = 44/331 (13%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L    L T T +    S   D I LNG+    
Sbjct: 17  PVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQEDRIWLNGK---- 72

Query: 86  QSSFFKKTTQFC-------------------DLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           +    +   Q C                   D      KV+  I + NN PT AGLASSA
Sbjct: 73  EEDITQPRLQSCLREIRCLSRKRRSDGEADVDAAGLSHKVH--ICSVNNFPTAAGLASSA 130

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +G+A L   L R+  +      LS V+R GSGSACRS Y GF +W+ G   +G DS A  
Sbjct: 131 AGYACLVYTLSRVMGV---EGELSAVSRQGSGSACRSMYGGFVQWLMGQQGDGKDSLAQQ 187

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
           V     WP+LR+ +L +    K +GS   M+ +   S          +   +  + +A+ 
Sbjct: 188 VEPETHWPELRVLVLVVSAERKPVGSTSGMQTSVETSILLKHRADSVVPARMKEMIEAVH 247

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTL 300
            +DF    E+  K++ + HAT +   PP+ Y     +  I  + R ++   +   + +T 
Sbjct: 248 KRDFTAFAELTMKDSNQFHATCLDTYPPIFYLNDVSRRVINLVHR-YNRHYRETKVAYTF 306

Query: 301 DAGPNLKLLFT--HKIEE---TIKQFFPEIT 326
           DAGPN  +++T    +EE    +K FFP  T
Sbjct: 307 DAGPN-AVIYTLQQNVEEFVQVVKHFFPPET 336


>gi|13592005|ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 gi|2498339|sp|Q62967|ERG19_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|1322245|gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
          Length = 401

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 107/319 (33%), Positives = 157/319 (49%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N SLS++L    L T T   +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T   D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLARVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LR+ +L +   +K  GS   M+ +   S       + I  + +  + + I +QDF  
Sbjct: 193 WPQLRVLILVVSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMKEMTRCIQEQDFQA 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++A      + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNAHHGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|74218080|dbj|BAE42019.1| unnamed protein product [Mus musculus]
          Length = 401

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 105/319 (32%), Positives = 160/319 (50%), Gaps = 29/319 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG++   
Sbjct: 16  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGREEDV 75

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             +++T+  D           + + NN PT AGLASSA+G+A L
Sbjct: 76  GQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGYACL 135

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     +  
Sbjct: 136 AYTLAQVYGV---EGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAPEWH 192

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP LRI +L +   +K+ GS   M+ +   S       + +  + +  + + I +QDF  
Sbjct: 193 WPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQDFQG 252

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             ++  K++ + HAT +   PP+ Y     +  IQ + R ++       + +T DAGPN 
Sbjct: 253 FAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHR-FNTHLGQTKVAYTFDAGPN- 310

Query: 307 KLLFTHKIEETIKQFFPEI 325
            ++FT  +E+T+ +F   +
Sbjct: 311 AVIFT--LEDTVAEFVAAV 327


>gi|228478303|ref|ZP_04062911.1| diphosphomevalonate decarboxylase [Streptococcus salivarius SK126]
 gi|228249982|gb|EEK09252.1| diphosphomevalonate decarboxylase [Streptococcus salivarius SK126]
          Length = 314

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 162/288 (56%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADAERMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  DLFR  S  +  IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDLFRNNSNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVE-----TDLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|296231782|ref|XP_002761300.1| PREDICTED: diphosphomevalonate decarboxylase [Callithrix jacchus]
          Length = 400

 Score =  132 bits (332), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 104/318 (32%), Positives = 160/318 (50%), Gaps = 27/318 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D   D + LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAAISKDFTEDRVWLNGREEDV 74

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
                             ++ T   DL          + + NN PT AGLASSA+G+A L
Sbjct: 75  GQPRLQACLQEIRRLARKRRNTWDGDLPPSSLNCKVHVASENNFPTAAGLASSAAGYACL 134

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L  +Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + 
Sbjct: 135 AYTLACVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESH 191

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +   +K +GS   M+ +   SP    +    +   +A + + I ++DF  
Sbjct: 192 WPELRVLILVVSAEKKLMGSTVGMQASVKTSPLLRFRAESVVPARMAEMTRCIQERDFRG 251

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLK 307
             ++  +++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  
Sbjct: 252 FAQLTMQDSNQFHATCLDTFPPISYLSHISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-A 310

Query: 308 LLFTHKIEETIKQFFPEI 325
           ++FT  +E+T+  F   +
Sbjct: 311 VIFT--LEDTMADFVAAV 326


>gi|262341122|ref|YP_003283977.1| diphosphomevalonate decarboxylase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272459|gb|ACY40367.1| diphosphomevalonate decarboxylase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 353

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 168/321 (52%), Gaps = 29/321 (9%)

Query: 11  RYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID 70
           +Y  E N  I +KS     SNIAL KYWGK  +K+ +PLN+S+S SLG + T+T +   +
Sbjct: 12  KYSIEPNGVITKKSH----SNIALIKYWGKHKNKIQIPLNSSISYSLGRVYTVTRLIYQE 67

Query: 71  SDADC----IILNGQKISS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGL 122
                    I L+G++ +S       FF + + +C   R F+   F+IET N  P  +G+
Sbjct: 68  KKKRNLSIKIFLSGKEKTSFLPKILEFFHRISFYCSYLRDFN---FIIETYNTFPHSSGI 124

Query: 123 ASSASGFAALTLALFRI-----YSIPEKS--ESLSRVARLGSGSACRSFYRGFCEWICGT 175
           ASSAS  +AL L +  I     +S+ +    +  S +ARLGSGSACRS Y G   W    
Sbjct: 125 ASSASSMSALALCIMEIEKKLVFSLKKDFFLKKASFLARLGSGSACRSIYPGLVVWGSHK 184

Query: 176 DQNGM-DSFAVPFNNQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ 230
              G  D +A+P+  +    +  +   +L I ++ KKI S +   +   H P+     Q 
Sbjct: 185 SIKGSNDLYAIPYPYKVHPIFKKMVNTILIIDEKPKKILSSKGHLLMNKH-PYARVRFQC 243

Query: 231 ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR 290
            + ++  +   +   DF + GE+ E  AL +HA ++ + P  L+ +  T+  +  VWD R
Sbjct: 244 ANQNMDRLISILKIGDFQEFGELIEHEALTLHAMIMTSRPYFLWMKPNTLNVLHTVWDFR 303

Query: 291 QQSIP-IYFTLDAGPNLKLLF 310
            QS   IYFTLDAG N+ LL+
Sbjct: 304 IQSKKNIYFTLDAGANVHLLY 324


>gi|118586911|ref|ZP_01544344.1| diphosphomevalonate decarboxylase [Oenococcus oeni ATCC BAA-1163]
 gi|118432638|gb|EAV39371.1| diphosphomevalonate decarboxylase [Oenococcus oeni ATCC BAA-1163]
          Length = 314

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 160/304 (52%), Gaps = 22/304 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISSQSS 88
           +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+I     
Sbjct: 8   TNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQIEG--- 64

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++  +  R    +K +  + + N++PT AGLASSAS FAALT A  + + +   +
Sbjct: 65  --PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAASQAFGLELDN 122

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA------VPFNNQWPDLRIGLLK 200
             LS++AR+GSGSA RS + GF  W  G  QN  DSFA      V F     D+R+  + 
Sbjct: 123 RELSKIARIGSGSASRSIFGGFSIWHKG--QNKDDSFAESILDPVDF-----DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M++ +  SP +  W ++    +  + +AI D D  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQLAQ-TSPNYDSWLKKNDRQIDEMLKAISDHDLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPE 324
              E
Sbjct: 295 VLKE 298


>gi|116491121|ref|YP_810665.1| diphosphomevalonate decarboxylase [Oenococcus oeni PSU-1]
 gi|116091846|gb|ABJ57000.1| diphosphomevalonate decarboxylase [Oenococcus oeni PSU-1]
          Length = 314

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 160/304 (52%), Gaps = 22/304 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISSQSS 88
           +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+I     
Sbjct: 8   TNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQIEG--- 64

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++  +  R    +K +  + + N++PT AGLASSAS FAALT A  + + +   +
Sbjct: 65  --PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAANQAFGLELDN 122

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA------VPFNNQWPDLRIGLLK 200
             LS++AR+GSGSA RS + GF  W  G  QN  DSFA      V F     D+R+  + 
Sbjct: 123 RELSKIARIGSGSASRSIFGGFSIWHKG--QNKDDSFAESILDPVDF-----DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M++ +  SP +  W ++    +  + +AI D D  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQLAQ-TSPNYDSWLKKNDRQIDEMLKAISDHDLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPE 324
              E
Sbjct: 295 VLKE 298


>gi|316966922|gb|EFV51437.1| diphosphomevalonate decarboxylase [Trichinella spiralis]
          Length = 366

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 156/292 (53%), Gaps = 18/292 (6%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI-SSQS 87
           P N+AL KYWGKRD +  LPLN+SLS+++  L   T +T+ D   D ++LNG++I   Q 
Sbjct: 14  PVNLALVKYWGKRDEREMLPLNDSLSMNINELFVDTRVTISDGSNDRVVLNGKEIVGVQF 73

Query: 88  SFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           S FK+     D  R+    K  F++++ +  P  AGLASS++GFAA+  A+ ++ +    
Sbjct: 74  SRFKRCF---DEARRIGGIKQCFVVQSESLFPVSAGLASSSAGFAAIAFAIGKMLNW--D 128

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQ-----NGMDSFAVPFNNQWPDLRIGLLK 200
            +++S VARLGSGSACR  Y GF  W+    Q     N  +  A+P    WP+L + +L 
Sbjct: 129 VDTMSHVARLGSGSACRGVYPGFVHWMAELAQSNDTRNKCEVVALP--EHWPELTVIVLI 186

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
             D  K+  S + M  +   S       +  +   +  +++AI  +DF KL     +++ 
Sbjct: 187 GSDEAKRWSSTDGMRRSVATSKLLKYRAECCVPERIEKVRRAIQARDFAKLAVEVMRDSC 246

Query: 260 KMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLL 309
           ++HA  +   PPLLY  + + Q M  V  ++       + ++ DAG N  LL
Sbjct: 247 QLHAICLDTYPPLLYLTEFSRQVMLMVHHYNDVCGRPKVAYSFDAGSNCFLL 298


>gi|25011437|ref|NP_735832.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae NEM316]
 gi|76787545|ref|YP_329966.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae A909]
 gi|77406855|ref|ZP_00783883.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae H36B]
 gi|77411154|ref|ZP_00787506.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae CJB111]
 gi|77414083|ref|ZP_00790252.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 515]
 gi|24412975|emb|CAD47054.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562602|gb|ABA45186.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae A909]
 gi|77159881|gb|EAO71023.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 515]
 gi|77162772|gb|EAO73731.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae CJB111]
 gi|77174528|gb|EAO77369.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae H36B]
          Length = 314

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 156/282 (55%), Gaps = 11/282 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T +  DA  D   ++G  +    
Sbjct: 12  ANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTTLGKDAKKDEFYISG--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    +       
Sbjct: 70  HEHDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDFFGTNLSQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L++ A+  SGS+ RSF+     W    D++  D + V  +    DL + +L + D+ K 
Sbjct: 130 QLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTD---LDLAMIMLVLNDKRKP 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL MH+T   
Sbjct: 183 ISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNALAMHSTTKT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L
Sbjct: 243 ATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVL 284


>gi|319745283|gb|EFV97601.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae ATCC
           13813]
          Length = 314

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 156/282 (55%), Gaps = 11/282 (3%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T +  DA  D   ++G  +    
Sbjct: 12  ANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYISG--VLQND 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    +       
Sbjct: 70  HEHDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDFFGTNLSQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L++ A+  SGS+ RSF+     W    D++  D + V  +    DL + +L + D+ K 
Sbjct: 130 QLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTD---LDLAMIMLVLNDKRKP 182

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL MH+T   
Sbjct: 183 ISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNALAMHSTTKT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L
Sbjct: 243 ATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVL 284


>gi|322498235|emb|CBZ33309.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 383

 Score =  130 bits (327), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 96/322 (29%), Positives = 156/322 (48%), Gaps = 23/322 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+   KL LP N+S S++L      +  +V    D+  D + LNG+K 
Sbjct: 12  PINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRKDAAEDELWLNGKKS 71

Query: 84  SSQSSFFKKTTQFC---DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           + Q +   ++   C   +       +   I + NN PT AG+ASSASG+ AL  AL + Y
Sbjct: 72  NIQETPRIQSVLSCIRDNCPGSMKDLKAYIVSDNNFPTAAGMASSASGYCALAAALVKAY 131

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRIGL 198
                +  +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  WP++++  
Sbjct: 132 ---RATVDVSMLSRLGSGSACRSAYGGFVIWHKGEKPDGTDCIATQFVDEKYWPEVQVMC 188

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKN 257
             +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF K   +A  +
Sbjct: 189 AVLKGEKKDVPSTAGMQQSLKTSPMMQERIASIVPARMNAVKEAIRHRDFNKFAAIAMAD 248

Query: 258 ALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +  +        P + Y  +++   +   R ++A++    + +T DAG N  +       
Sbjct: 249 SDDLQEICRTTEPRIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCFMF------ 302

Query: 316 ETIKQFFPEITIIDPLDSPDLW 337
            T+KQ  PE+ ++     P  W
Sbjct: 303 -TLKQDLPEVVVMLRAHFPTSW 323


>gi|146083741|ref|XP_001464819.1| diphosphomevalonate decarboxylase [Leishmania infantum JPCM5]
 gi|134068914|emb|CAM67055.1| putative mevalonate-diphosphate decarboxylase [Leishmania infantum
           JPCM5]
          Length = 383

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 96/322 (29%), Positives = 156/322 (48%), Gaps = 23/322 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+   KL LP N+S S++L      +  +V    D+  D + LNG+K 
Sbjct: 12  PINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRKDAAEDELWLNGKKS 71

Query: 84  SSQSSFFKKTTQFC---DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           + Q +   ++   C   +       +   I + NN PT AG+ASSASG+ AL  AL + Y
Sbjct: 72  NIQETPRIQSVLSCIRDNCPGSMKDLKAYIVSDNNFPTAAGMASSASGYCALAAALVKAY 131

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRIGL 198
                +  +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  WP++++  
Sbjct: 132 ---RATVDVSMLSRLGSGSACRSAYGGFVIWHKGEKPDGTDCIATQFVDEKYWPEVQVMC 188

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKN 257
             +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF K   +A  +
Sbjct: 189 AVLKGEKKDVPSTAGMQQSLKTSPMMQERIASIVPARMNAVKEAIRHRDFNKFAAIAMAD 248

Query: 258 ALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +  +        P + Y  +++   +   R ++A++    + +T DAG N  +       
Sbjct: 249 SDDLQEICRTTEPRIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCFMF------ 302

Query: 316 ETIKQFFPEITIIDPLDSPDLW 337
            T+KQ  PE+ ++     P  W
Sbjct: 303 -TLKQDLPEVVVMLRAHFPTSW 323


>gi|290973123|ref|XP_002669299.1| mevalonate decarboxylase [Naegleria gruberi]
 gi|284082844|gb|EFC36555.1| mevalonate decarboxylase [Naegleria gruberi]
          Length = 391

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 101/326 (30%), Positives = 160/326 (49%), Gaps = 36/326 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILNGQKISS 85
           P NIA+ KYWGK +   ++PLN+SLS +L      T  TV  S     D +ILNG+K   
Sbjct: 13  PVNIAVIKYWGKENEAEHIPLNSSLSATLNQDDLKTTTTVQASTEFPCDELILNGKKEDV 72

Query: 86  QSS-----FFKKTTQ------FCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           Q S      F++  +      + +   +  ++Y  I+++NN PT AGLASSASG+  L  
Sbjct: 73  QGSKRIQRVFQEIRKAATAKWYTERPNKDQEIYVHIDSTNNFPTAAGLASSASGYCCLVF 132

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL 194
           AL +++ +  KS+ LS +ARLGSGSACRS Y G+  W  G D     S A+   ++  D 
Sbjct: 133 ALGQLFEV--KSD-LSIIARLGSGSACRSLYGGYVAWEKGHDHET--SKAIQVLDEHDDF 187

Query: 195 ----RIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDLAHIKQAIIDQDFIK 249
                I +  + DR+K   S   M+ +   S     + ++ +   +  + +A+  +DF  
Sbjct: 188 SKQTNIVVCVVSDRQKHTPSTSGMQQSVITSKLLKVRASEIVPQRMIEMDKALKTKDFNL 247

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-------QSIPIYFTLDA 302
              +   ++  MHA      P + Y  + + Q ++ V D          +++ + +T DA
Sbjct: 248 FATLTMDDSDNMHACCADTEPAIYYMNETSNQIVQLVKDFNAFDDGNGVENLKVAYTFDA 307

Query: 303 GPNLKLLF-----THKIEETIKQFFP 323
           GPN  L F     T+K    +  FFP
Sbjct: 308 GPNAVLFFPNKEVTNKFLAILHAFFP 333


>gi|290890629|ref|ZP_06553700.1| hypothetical protein AWRIB429_1090 [Oenococcus oeni AWRIB429]
 gi|290479757|gb|EFD88410.1| hypothetical protein AWRIB429_1090 [Oenococcus oeni AWRIB429]
          Length = 314

 Score =  130 bits (326), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 160/304 (52%), Gaps = 22/304 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISSQSS 88
           +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+I     
Sbjct: 8   TNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQIEG--- 64

Query: 89  FFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              K ++  +  R    +K +  + + N++PT AGLASSAS FAALT A  + + +   +
Sbjct: 65  --PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAASQAFGLELDN 122

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA------VPFNNQWPDLRIGLLK 200
             LS++AR+GSGSA RS + GF  W  G  QN  DSFA      V F     D+R+  + 
Sbjct: 123 RELSKIARIGSGSASRSIFGGFSIWHKG--QNKDDSFAESILDPVDF-----DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M++ +  SP +  W ++    +  + +AI D +  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQLAQ-TSPNYDSWLKKNDRQIDEMLKAISDHNLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPE 324
              E
Sbjct: 295 VLKE 298


>gi|157867709|ref|XP_001682408.1| diphosphomevalonate decarboxylase [Leishmania major strain
           Friedlin]
 gi|68125862|emb|CAJ03409.1| putative mevalonate-diphosphate decarboxylase [Leishmania major
           strain Friedlin]
          Length = 383

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 155/324 (47%), Gaps = 27/324 (8%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D+  D + LNG+K 
Sbjct: 12  PINIAFIKYWGKREGGETLILPTNDSFSITLSTKPFRSKTSVELRSDASEDELWLNGKKS 71

Query: 84  SSQS-----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           + Q      S        C    +  K Y + E  NN PT AG+ASSASG+ AL  AL +
Sbjct: 72  NIQETPRIQSVLSCIRDNCPDNTKNLKAYIVSE--NNFPTAAGMASSASGYCALAAALVK 129

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            Y     +  +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  WP++++
Sbjct: 130 AYG---ATVDVSMLSRLGSGSACRSVYGGFVIWHKGEKPDGTDCIATQFLDEKYWPEVQV 186

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAE 255
               +   +K + S   M+ +   S    +  + I    ++ +K+AI  +DF +   +A 
Sbjct: 187 MCAVLKGEKKDVSSTSGMQQSLKTSSMMRERIESIVPARMSAVKEAIQQRDFNQFAAIAM 246

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            ++  +        PP+ Y   ++   +   R ++A++    + +T DAG N  +     
Sbjct: 247 ADSDDLQEICRTTKPPIQYATDDSYAMIRLIRAFNAKKGYNVMAYTFDAGANCFMF---- 302

Query: 314 IEETIKQFFPEITIIDPLDSPDLW 337
              T+KQ  PE+ ++     P  W
Sbjct: 303 ---TLKQDLPEVVVMLRAHFPTSW 323


>gi|225708030|gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
          Length = 398

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 158/315 (50%), Gaps = 31/315 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L    L T T +    S + D I LNG+    
Sbjct: 17  PVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLRTTTTVACSRSFEEDRIWLNGR---- 72

Query: 86  QSSFFKKTTQFC--DLFRQFSKVY-----------FLIETSNNIPTKAGLASSASGFAAL 132
           +        Q C  ++ R   K +           F I + NN PT AGLASSA+G+A L
Sbjct: 73  EEDITLPRLQSCLREVRRLARKRHSDGDPAGLSHKFHICSVNNFPTAAGLASSAAGYACL 132

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
             +L R+  +      LS VAR GSGSACRS Y GF +W  G  ++G DS A  V     
Sbjct: 133 VYSLARVLGV---EGELSVVARQGSGSACRSMYGGFVQWTMGQREDGKDSIAQQVAPETN 189

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIK 249
           WP+LR+ +L +    K +GS   M+ +   S       +  +   +  + +A+  +DF  
Sbjct: 190 WPELRVLVLVVSAERKLVGSTSGMQTSVETSSLLKHRAECVVPGRMEQMIRAVKKRDFAT 249

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLK 307
             E+  K++ + HAT +   PP+ Y       I  +   ++       + ++ DAGPN  
Sbjct: 250 FAELTMKDSNQFHATCLDTYPPVFYLNDVSRRIINLVHRYNRHCGETRVAYSFDAGPN-A 308

Query: 308 LLFTHKIEETIKQFF 322
           ++FT  ++E   +FF
Sbjct: 309 VIFT--LQEHTAEFF 321


>gi|260890995|ref|ZP_05902258.1| diphosphomevalonate decarboxylase [Leptotrichia hofstadii F0254]
 gi|260859022|gb|EEX73522.1| diphosphomevalonate decarboxylase [Leptotrichia hofstadii F0254]
          Length = 327

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 99/319 (31%), Positives = 170/319 (53%), Gaps = 35/319 (10%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD----------------- 72
           +NIA+ KYWGK+D++  +P  +S+SL+L  + T T +  I+ +                 
Sbjct: 8   ANIAIIKYWGKKDAEKMIPSTSSISLTLNDMFTETELEFINDEDIKIAVEKEIKSENCKD 67

Query: 73  -----ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSAS 127
                AD   LNG+     +   +K ++  DLFR+       I T+NN+PT AGL+SS+S
Sbjct: 68  KYSDMADLFYLNGE--LQDNVHTEKISKVVDLFRENRSQKVKISTTNNMPTAAGLSSSSS 125

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           G +A+  A   ++        L+++++ GSGS+ RSF+     W    D++  + + V  
Sbjct: 126 GLSAVIKACNELFEKNYTQSELAQISKFGSGSSSRSFFGPVAAW----DKDTGEIYEVR- 180

Query: 188 NNQWPDLRIGLLKII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
                DL++ ++ ++  + +K+I SR  ME+    S +F +W +Q   D  ++K+ + + 
Sbjct: 181 ----TDLKLAMIVLVLNENKKEISSRNGMELCAKTSTYFDEWVKQSEIDFVNMKKYLAEN 236

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF K+G + E+NAL+MH T   A+PP  Y+ ++T + M+ V   R      YFT+DAGPN
Sbjct: 237 DFEKVGILTEENALRMHKTTETANPPFTYFNEKTYEAMDFVKKLRNNGKKCYFTMDAGPN 296

Query: 306 LKLLFTHKIEETIKQFFPE 324
           +K+L   +  E +   F E
Sbjct: 297 VKVLCLEEDLEKLAGIFEE 315


>gi|146304339|ref|YP_001191655.1| diphosphomevalonate decarboxylase [Metallosphaera sedula DSM 5348]
 gi|145702589|gb|ABP95731.1| diphosphomevalonate decarboxylase [Metallosphaera sedula DSM 5348]
          Length = 323

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 174/310 (56%), Gaps = 14/310 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           ++ A  PSNIA+ KYWGKRD +LNLPLN+SLS+SL  L   + +   +S D D +I+NG+
Sbjct: 4   EAEAVAPSNIAIVKYWGKRDRELNLPLNSSLSISLDSLWVRSRVIFDESLDKDEVIINGK 63

Query: 82  KISS---QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           ++S    +    +   +F DL+ +  +++  +E++ N P+ AGLASSA+G AALT A   
Sbjct: 64  RLSENEVREYAGRVLRRFRDLYGK--ELFARVESTTNFPSSAGLASSAAGIAALTYASNA 121

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
              +   +  LS++AR+GSGSACRS + GF +W  G  ++G DSF       + WPDL +
Sbjct: 122 ALGLGLSNRELSKIARVGSGSACRSMFGGFVKWNRGELESGDDSFCEEIFPPDHWPDL-V 180

Query: 197 GLLKIIDRE-KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
            ++ I   E KK+ SR  ME T   S       Q I      +  AI  ++  K  ++  
Sbjct: 181 DIIPIFGEEKKKVSSRTGMENTATSSALMRCRLQFIEETFNEVIDAIRTKNAGKFFQLTM 240

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + PP+ Y  +++ + ME V +  + +    +T DAGPN  +    K  
Sbjct: 241 RHSNSMHAVILDSWPPMNYLNEKSFRVMEWVVEFGKAA----YTFDAGPNPHIFVLEKDV 296

Query: 316 ETIKQFFPEI 325
           + + +F  EI
Sbjct: 297 DEVLKFLNEI 306


>gi|301625700|ref|XP_002942038.1| PREDICTED: diphosphomevalonate decarboxylase [Xenopus (Silurana)
           tropicalis]
          Length = 394

 Score =  129 bits (324), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 164/327 (50%), Gaps = 28/327 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIIL 78
           +K +   P NIA+ KYWGKR+ +L LP+N+SLS++L    L T T      +   D I L
Sbjct: 2   KKVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWL 61

Query: 79  NGQK--ISSQ--SSFFKKTTQFCDLFRQ------FSKVY---FLIETSNNIPTKAGLASS 125
           NG++  IS     S  ++  +     R        S++      I + NN PT AGLASS
Sbjct: 62  NGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSRILNDKVHICSVNNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+G+A L   L ++Y +      LS +AR GSGSACRS Y GF +W+ G   +G DS A 
Sbjct: 122 AAGYACLVYTLAKLYGV---EGELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK 178

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAI 242
            V   + WP+LR+ +L     +K +GS   M+ +   SP        +  + +  + ++I
Sbjct: 179 QVEPESHWPELRVLILVATAEKKHVGSTAGMQTSVETSPLLKLRADLVVPERMEAMIESI 238

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             +DF   GE+  K++ + HAT +   PP+ Y    + + +  V  ++       + ++ 
Sbjct: 239 RKKDFKAFGELTMKDSNQFHATCLDTYPPIFYLNSVSQRVISVVHQYNTYYGQTKVAYSF 298

Query: 301 DAGPNLKLLF----THKIEETIKQFFP 323
           DAGPN  +       ++  E +K  FP
Sbjct: 299 DAGPNAVIFMLEPTVNEFVEVVKHCFP 325


>gi|312863780|ref|ZP_07724018.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis
           F0396]
 gi|322517210|ref|ZP_08070092.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis ATCC
           49124]
 gi|311101316|gb|EFQ59521.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis
           F0396]
 gi|322124197|gb|EFX95721.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis ATCC
           49124]
          Length = 314

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 161/288 (55%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADAERMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  DLFR     +  IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDLFRTNPNQHVKIETCNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLSAW----DKDSGEVYQVE-----TDLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSEQDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y  + + + M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTEASYRAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|307179520|gb|EFN67834.1| Diphosphomevalonate decarboxylase [Camponotus floridanus]
          Length = 373

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 157/308 (50%), Gaps = 27/308 (8%)

Query: 39  GKRDSKLNLPLNNSLS--LSLGHLGTITHITV-IDSDADCIILNGQ-------KISSQSS 88
           GKRD  L LP N+S+S  L +  L   T + + +D   D I LNG+       ++ +   
Sbjct: 5   GKRDESLILPTNDSISATLDIDQLHAKTSVMISLDFKEDHIWLNGREQDIKNPRLQNCLK 64

Query: 89  FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
             KK +Q       + K++  I + NN PT AGLASSA+G+A L  AL ++Y +      
Sbjct: 65  EIKKRSQLPGYMNDW-KIH--ICSKNNFPTAAGLASSAAGYACLATALAKLYKV---EGD 118

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA---VPFNNQWPDLRIGLLKIIDRE 205
           +S +AR GSGSACRS + GF  W  G D+NG DS A   VP  + WP++RI +L + D +
Sbjct: 119 ISVIARSGSGSACRSIFGGFVRWHMGVDKNGADSIAKQIVPA-SHWPEMRILILVVTDEQ 177

Query: 206 KKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           KKI S   M+ +   S F   + +  +      ++QAII++DF    E+  K++ +MHA 
Sbjct: 178 KKIPSAIGMKRSMETSQFLQYRISHTVPERTNKMQQAIIEKDFKTFAELTMKDSNQMHAV 237

Query: 265 MIAASPPLLYWQK--ETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI---- 318
            +   PP +Y      +I  +   ++     + + +T DAG N  L    K   T+    
Sbjct: 238 CLDTYPPCVYMNNISNSIMNLIHSYNDAVNDVKVAYTFDAGTNATLYLLEKDVPTVMGVL 297

Query: 319 KQFFPEIT 326
             FFP + 
Sbjct: 298 NYFFPPVA 305


>gi|322372484|ref|ZP_08047020.1| diphosphomevalonate decarboxylase [Streptococcus sp. C150]
 gi|321277526|gb|EFX54595.1| diphosphomevalonate decarboxylase [Streptococcus sp. C150]
          Length = 314

 Score =  129 bits (323), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 159/288 (55%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADTKRMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  D FR     +  IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDFFRTNPNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYQVE-----TDLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSVLDYKDMLAYLKTNDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y    + Q M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTDASYQAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|324513471|gb|ADY45535.1| Diphosphomevalonate decarboxylase [Ascaris suum]
          Length = 400

 Score =  129 bits (323), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 96/313 (30%), Positives = 154/313 (49%), Gaps = 35/313 (11%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +   P NIA+ KYWGKRD  L LPLN+S+S+++  L   T + V    + D + +NG+ +
Sbjct: 21  TVIAPINIAIIKYWGKRDEDLVLPLNDSISVNINELYAKTRVRVGPQIEKDTVSINGKVV 80

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY--------------------FLIETSNNIPTKAGLA 123
                   K  +F   F +  ++Y                    F + ++ N PT AGLA
Sbjct: 81  D-----LSKLNRFRRCFAEIRRMYRKRTMEDSEDNKKNFGCFDKFEVVSTTNFPTDAGLA 135

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAA+  A+ R+Y++ +  + + R+ARLGSGS+CRS   GF  W  GT  +G D  
Sbjct: 136 SSAAGFAAIAFAMGRLYNLSK--DEIERIARLGSGSSCRSLLGGFVHWKAGTCADGSDCC 193

Query: 184 --AVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQ 240
              V     W  LR  +L   +  K +GS + M  +   S   +   ++ +   ++ + +
Sbjct: 194 CEVVAPTEHWSTLRAMILVTSNNSKDVGSTDGMRKSTQTSELLSHRVKEVVPKRVSRLLE 253

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP---IY 297
           AI  ++F     +    + ++HA  +   PPL Y  K +   + R+ +A   SI    + 
Sbjct: 254 AIKSRNFEDFATITMAESNQLHAICMDTMPPLRYMNKNSWH-LLRIMEALNTSIGSKCVA 312

Query: 298 FTLDAGPNLKLLF 310
           +T DAGPN  L F
Sbjct: 313 YTFDAGPNCCLFF 325


>gi|55822530|ref|YP_140971.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           CNRZ1066]
 gi|55738515|gb|AAV62156.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           CNRZ1066]
          Length = 314

 Score =  129 bits (323), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 160/288 (55%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPKDATSDVMYIGDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  D+FR     +  IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDIFRTNPNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVE-----TDLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|195122128|ref|XP_002005564.1| GI19000 [Drosophila mojavensis]
 gi|193910632|gb|EDW09499.1| GI19000 [Drosophila mojavensis]
          Length = 379

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 155/323 (47%), Gaps = 30/323 (9%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA---DCIILNGQKISSQSS 88
           +AL KYWGKR+ +L LP+N+S+S++L         T+  S++   + + LNG+ +     
Sbjct: 1   MALVKYWGKRNEELILPINDSVSMTLDANEMCAKTTISASESFKQNRMWLNGEVVP---- 56

Query: 89  FFKKTTQFCDLFRQFSKVYFL-------------IETSNNIPTKAGLASSASGFAALTLA 135
            F++  +         ++                I + NN PT AGLASSA+G+A L   
Sbjct: 57  -FEENARLMRCVEGIHRLALANGAHKFPLSWKVHIASYNNFPTAAGLASSAAGYACLVYT 115

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPD 193
           L R+Y +P  +E L+ +AR GSGSACRS Y GF  W  GT  +G DS AV       WP+
Sbjct: 116 LARLYDLP-MNEELTTIARQGSGSACRSLYGGFVHWQRGTSADGSDSIAVQLAPAEHWPN 174

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID-QDFIKLGE 252
           + + +L + D  KK GS + M++    S       +++         A ID +DF    E
Sbjct: 175 MHMLILVVNDARKKTGSTKGMQLGVQTSALIQHRAKEVVPQRVKDLIAAIDARDFESFAE 234

Query: 253 VAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
           +  K + ++HA  +   PP +Y       I      ++    S+   +T DAGPN  L  
Sbjct: 235 ITMKESNQLHAICLDTYPPCVYMNDVSHAIANFVHDYNETVGSVQAAYTFDAGPNACL-- 292

Query: 311 THKIEETIKQFFPEITIIDPLDS 333
            + + E + +    I +  P D+
Sbjct: 293 -YVLAENVPRLLAAIQLAFPNDA 314


>gi|313635476|gb|EFS01717.1| diphosphomevalonate decarboxylase [Listeria seeligeri FSL N1-067]
          Length = 160

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 83/125 (66%)

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           + D+EKK+ SR+ M +T   SPFF  W     TDL  +KQAI+ +DFIK+GE+ E+N +K
Sbjct: 16  VSDKEKKVSSRDGMRLTVETSPFFKDWVAAAETDLEEMKQAILAEDFIKVGEITERNGMK 75

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHAT + A PP  Y+Q  +++ M+ V   R++ IP YFT+DAGPN+K++   K E+ + +
Sbjct: 76  MHATTLGAEPPFTYFQPLSLEIMDAVRALREEGIPAYFTMDAGPNVKVICERKNEKIVAE 135

Query: 321 FFPEI 325
              E+
Sbjct: 136 KLSEL 140


>gi|187918542|ref|YP_001884105.1| diphosphomevalonate decarboxylase [Borrelia hermsii DAH]
 gi|119861390|gb|AAX17185.1| diphosphomevalonate decarboxylase [Borrelia hermsii DAH]
          Length = 312

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 152/291 (52%), Gaps = 16/291 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           ++AL KYWGKRD  LN+P  +S+++S+    +I+ + +  S  D IILN + I  Q    
Sbjct: 10  SLALIKYWGKRDKFLNIPATSSIAVSVDKFYSISELEL--SCKDEIILNSRAIVLQ---- 63

Query: 91  KKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           ++   F +  R+      V F + + NN PT AGLASS+SGFA++   + R ++     +
Sbjct: 64  EREINFFNYARKILNEPNVGFRVISENNFPTAAGLASSSSGFASIAACILRYFN-QYSHQ 122

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
             S++AR+GS SA R+ Y GF        +    +F +   N + DL I    +  R+K 
Sbjct: 123 KASQLARIGSASAARAIYGGF----TFLKEGARSAFQLNNFNYFNDLCIIFAIVDSRKKD 178

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           + SR AMEI +    ++  W +            ++  DF + G    K+   M A M++
Sbjct: 179 MSSRAAMEICKQEKFYWDAWIKSSRNIFKEALFFLLKGDFNEFGLKIVKSYQCMFALMLS 238

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +S  ++Y++  TI+ ++ +   R + I ++ T+DAGP +K+L   K  E +
Sbjct: 239 SS--IIYFKSNTIELIKYIAALRSRGISVFETMDAGPQVKVLCLKKDLELV 287


>gi|171778296|ref|ZP_02919502.1| hypothetical protein STRINF_00344 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282996|gb|EDT48420.1| hypothetical protein STRINF_00344 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 311

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 159/304 (52%), Gaps = 16/304 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAAKMIPATSSISLTLENMFTTTSVSFLPDSASHDEFYING--VLQDD 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     Y  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGQRSEYVKVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLTRA 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPLAAW----DKDSGEVYPVQ-----TDLKLAMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   + + DF ++GE+ E+NAL MH T 
Sbjct: 181 KSISSREGMKRCVETSTTFADWVKQSEQDYKDMLGYLKNNDFERVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQFFPE 324
             A+PP  Y  +E+ + ME V   R +    YFT+DAGPN+K+L     +E   K+F   
Sbjct: 241 THANPPFNYLTEESYKAMEFVKQLRSEGEKCYFTMDAGPNVKVLCLEEDLERLTKRFEEN 300

Query: 325 ITII 328
             +I
Sbjct: 301 YRVI 304


>gi|170590582|ref|XP_001900051.1| diphosphomevalonate decarboxylase family protein [Brugia malayi]
 gi|158592683|gb|EDP31281.1| diphosphomevalonate decarboxylase family protein [Brugia malayi]
          Length = 430

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 98/328 (29%), Positives = 145/328 (44%), Gaps = 50/328 (15%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI--SS 85
           P NIAL KYWGKR+  L LPLN+S+SLS+  +   T + +  S   D + +NG  +  S 
Sbjct: 19  PINIALVKYWGKRNEDLMLPLNDSISLSINDMCAKTRVRIGASVKKDSVSINGSNVCLSK 78

Query: 86  QSSFFKKTTQFCDLFRQ----------------FSKVYFLIETSNNIPTKAGLASSASGF 129
              F +   +   L R+                FSK   + ET  N P +AGLASSA+GF
Sbjct: 79  HPGFLRCFKEVRRLIRKRSIISETAGKSEKHDYFSKFEVVSET--NFPIEAGLASSAAGF 136

Query: 130 AALTLALFRIYSIPEKSESLSRVARL-----------------------GSGSACRSFYR 166
           AA+   L +IY +      + RVAR+                       GSGSACRS   
Sbjct: 137 AAIAYGLGQIYQL--NISDIIRVARMGKHAVAIVILKCSQNELRLDNYSGSGSACRSILS 194

Query: 167 GFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF 224
           G   W  GT ++G D     V   + WP LR  +L      KK+ S   M+ T   S   
Sbjct: 195 GLVHWKAGTAEDGTDCICETVFPEDYWPTLRSLILVTSHGTKKVSSSNGMQSTVKTSKLL 254

Query: 225 TQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
                 +   +  ++ A  D++F +L +V   ++ ++HA  +   P L Y    +   M+
Sbjct: 255 QARMDIVPEQITKLRNAFRDRNFEQLAKVIMSDSGQLHALCMDTMPSLRYLNDNSWYLMQ 314

Query: 285 RV--WDARQQSIPIYFTLDAGPNLKLLF 310
            +   +   +   + +T DAGPN  L  
Sbjct: 315 LIHALNRHCKDTKVAYTFDAGPNCCLFL 342


>gi|39645379|gb|AAH63907.1| mvd-prov protein [Xenopus (Silurana) tropicalis]
          Length = 402

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 164/327 (50%), Gaps = 28/327 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIIL 78
           +K +   P NIA+ KYWGK++ +L LP+N+SLS++L    L T T      +   D I L
Sbjct: 10  KKVTCTAPVNIAVIKYWGKQNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWL 69

Query: 79  NGQK--ISSQ--SSFFKKTTQFCDLFRQ------FSKVY---FLIETSNNIPTKAGLASS 125
           NG++  IS     S  ++  +     R        S++      I + NN PT AGLASS
Sbjct: 70  NGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSRILNDKVHICSVNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+G+A L   L ++Y +      LS +AR GSGSACRS Y GF +W+ G   +G DS A 
Sbjct: 130 AAGYACLVYTLAKLYGV---EGELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK 186

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAI 242
            V   + WP+LR+ +L     +K +GS   M+ +   SP        +  + +  + ++I
Sbjct: 187 QVEPESHWPELRVLILVATAEKKHVGSTAGMQTSVETSPLLKLRADLVVPERMEAMIESI 246

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             +DF   GE+  K++ + HAT +   PP+ Y    + + +  V  ++       + ++ 
Sbjct: 247 RKKDFKAFGELTMKDSNQFHATCLDTYPPIFYLNSVSQRVISVVHQYNTYYGQTKVAYSF 306

Query: 301 DAGPNLKLLF----THKIEETIKQFFP 323
           DAGPN  +       ++  E +K  FP
Sbjct: 307 DAGPNAVIFMLEPTVNEFVEVVKHCFP 333


>gi|312277964|gb|ADQ62621.1| Diphosphomevalonate decarboxylase, putative [Streptococcus
           thermophilus ND03]
          Length = 314

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 159/288 (55%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPEDATSDVMYIGDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  D+FR        IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDIFRTDPNQPVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVE-----TDLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|55820639|ref|YP_139081.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMG 18311]
 gi|116627444|ref|YP_820063.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMD-9]
 gi|55736624|gb|AAV60266.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMG 18311]
 gi|116100721|gb|ABJ65867.1| diphosphomevalonate decarboxylase [Streptococcus thermophilus
           LMD-9]
          Length = 314

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/288 (32%), Positives = 159/288 (55%), Gaps = 23/288 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII------LNGQKI 83
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +  DA   +      L G+K 
Sbjct: 12  ANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPKDATSDVMYIGDELQGEKE 71

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++++S      +  D+FR        IET NN+PT AGL+SS+SG +AL  A   ++ + 
Sbjct: 72  TTKAS------KVLDIFRTDPNQPVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQVG 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII- 202
           +    L+++A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++ 
Sbjct: 126 KTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVET-----DLKLAMIMLVL 176

Query: 203 -DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVL 284


>gi|322490250|emb|CBZ25510.1| putative diphosphomevalonate decarboxylase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 383

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 96/312 (30%), Positives = 151/312 (48%), Gaps = 25/312 (8%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLG----HLGTITHITVIDSDADCIILNGQK 82
           P NIA  KYWGKR+   KL LP N+S S++L        T   +  + ++ D + LNG K
Sbjct: 12  PINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRSVAAE-DELWLNGAK 70

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFL---IETSNNIPTKAGLASSASGFAALTLALFRI 139
            + Q +   ++   C      S V  L   I + NN PT AG+ASSASG+ AL  AL + 
Sbjct: 71  SNIQETPRIQSVLSCIRDNCPSDVKNLKAYIVSENNFPTAAGMASSASGYCALAAALVKA 130

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIG 197
           Y     +  +S ++RLGSGSACRS Y GF  W  G   +G D  A  F   N WP++++ 
Sbjct: 131 Y---RATVDVSMLSRLGSGSACRSTYGGFVIWNKGEKPDGTDCIATQFVDENYWPEMQVM 187

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEK 256
              +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF +  E+   
Sbjct: 188 CAVLKGDKKDVSSTAGMQQSLKTSPMMQERIASIVPARMKAVKEAIQQRDFNRFAEITMA 247

Query: 257 NALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           ++  +        P + Y  +++   +   R ++A++    + +T DAG N  +      
Sbjct: 248 DSDDLQEICRTTEPCIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCFMF----- 302

Query: 315 EETIKQFFPEIT 326
             T+KQ  PE+ 
Sbjct: 303 --TLKQDLPEVV 312


>gi|224534456|ref|ZP_03675032.1| diphosphomevalonate decarboxylase [Borrelia spielmanii A14S]
 gi|224514133|gb|EEF84451.1| diphosphomevalonate decarboxylase [Borrelia spielmanii A14S]
          Length = 312

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 160/295 (54%), Gaps = 22/295 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +  SD D IILN + +  Q+  
Sbjct: 9   ASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELEL--SDRDEIILNSKPVILQN-- 64

Query: 90  FKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
             +   F +  R+      V F I++ NN PT AGLASS+SGFA++   + + ++     
Sbjct: 65  --REKVFFNYARKILGEPNVRFKIKSENNFPTSAGLASSSSGFASIAACILKYFN-KYSF 121

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREK 206
            S+S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK
Sbjct: 122 NSVSNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDESYFNDLRIIFAIIDSNEK 177

Query: 207 KIGSREAMEITRHHSPFFTQW---TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
           ++ SR AM I +HH  ++  W   +++I  D  +     + +DFI  G    K+   M A
Sbjct: 178 ELSSRAAMNICKHHGFYYDAWIASSKKIFKDALYF---FLKKDFIHFGANVVKSYQNMFA 234

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            M A+S  + Y++  TI  ++   + R + I ++ T+DAGP +K +   K   TI
Sbjct: 235 LMFASS--IFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFICLEKNLNTI 287


>gi|126662475|ref|ZP_01733474.1| mevalonate diphosphate decarboxylase [Flavobacteria bacterium
           BAL38]
 gi|126625854|gb|EAZ96543.1| mevalonate diphosphate decarboxylase [Flavobacteria bacterium
           BAL38]
          Length = 361

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 97/314 (30%), Positives = 166/314 (52%), Gaps = 27/314 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-----IDSDADCIILNGQKI 83
           PSNIAL KYWGK+++++  P N S+S +L +  TIT + V     I+S +  ++  G+  
Sbjct: 25  PSNIALVKYWGKKENQI--PANPSISFTLNNCKTITKLEVVKKLDINSFSFDLLFEGKPK 82

Query: 84  SS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
                    FF++  Q+C   +++   +F I+T N  P  +G+ASSASG AAL + +  +
Sbjct: 83  EDFKPKIQKFFERIEQYCPFLKEY---HFKIDTQNTFPHSSGIASSASGMAALAMNIMSL 139

Query: 140 YSI--PEKSESL-----SRVARLGSGSACRSFYRGFCEWICGTDQNGM-DSFAVPFNNQW 191
                P  S+       S +ARLGSGSACRS       W   T+ NG  D F V F+   
Sbjct: 140 EKAINPTISDEYFYSKASFLARLGSGSACRSIKGEVVVWGNHTEINGSSDLFGVEFSEIH 199

Query: 192 PDLR--IGLLKIIDR-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
            D +     + ++D+ EK++ S    ++  +H P+  +   Q   +L+ IK  +   +  
Sbjct: 200 QDFKNYQDTILLVDKGEKQVSSTVGHDLMHNH-PYAERRFTQAHENLSKIKAILTTGNIE 258

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLK 307
           +  ++ E  AL +HA M+ + P  +  +  T++ + ++W  R ++ IP+ FTLDAG N+ 
Sbjct: 259 EFIKIVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWKFRNETQIPVCFTLDAGANVH 318

Query: 308 LLFTHKIEETIKQF 321
           +L+   ++  + QF
Sbjct: 319 VLYPENVKHKVLQF 332


>gi|309799713|ref|ZP_07693930.1| diphosphomevalonate decarboxylase [Streptococcus infantis SK1302]
 gi|308116669|gb|EFO54128.1| diphosphomevalonate decarboxylase [Streptococcus infantis SK1302]
          Length = 290

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 152/280 (54%), Gaps = 15/280 (5%)

Query: 47  LPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
           +P  +S+SL+L ++ T T ++ + +DA  D   +NGQ + +++   K  ++  D +R   
Sbjct: 2   VPATSSISLTLENMFTETTLSPLPADASSDAFYINGQ-LQNEAEHVK-MSKIIDRYRPEG 59

Query: 105 KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSF 164
             +  I+T NN+PT AGL+SS+SG +AL  A    + +    + L+  A+  SGS+ RSF
Sbjct: 60  AGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRKDLALEAKFASGSSSRSF 119

Query: 165 YRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKKIGSREAMEITRHHSP 222
           Y     W    D++  + + V       DL++G++ ++  D++K I SR+ M++    S 
Sbjct: 120 YGPLAAW----DKDSGEIYPVD-----TDLKLGMIMLVLEDQKKPISSRDGMKLCVETST 170

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
            F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   A+P   Y    + + 
Sbjct: 171 TFEDWVRQSEQDYKDMLVYLKESDFKKVGELTEKNALAMHATTKTATPSFSYLTDASYEA 230

Query: 283 MERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           M+ V   R+Q    YFT+DAGPN+K+L   K  E + +  
Sbjct: 231 MDFVRQLREQGESCYFTMDAGPNVKVLCLEKDLEHLSELL 270


>gi|218189885|gb|EEC72312.1| hypothetical protein OsI_05503 [Oryza sativa Indica Group]
          Length = 311

 Score =  125 bits (315), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 118/228 (51%), Gaps = 23/228 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 18  PTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 77

Query: 86  QSSFF-------KKTTQFCDLFRQ--------FSKVYFLIETSNNIPTKAGLASSASGFA 130
               F       +K  Q  +  ++        + K++  I + NN PT AGLASS +G  
Sbjct: 78  SGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLASSVAGLV 137

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L  + ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV   ++
Sbjct: 138 CFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAVQLADE 197

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF---TQWTQQIST 233
             W DL I +  +  ++K+  S   M  +   SP      QW  +  T
Sbjct: 198 AHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQWAAEAET 245


>gi|149642204|ref|XP_001509372.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 412

 Score =  125 bits (315), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 106/332 (31%), Positives = 161/332 (48%), Gaps = 41/332 (12%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDAD 74
           PK++  +      ++    YWGKRD +L LP+N+SLS++L    L T T   +  D   D
Sbjct: 16  PKVHSLAHCGQGLDLPTLLYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFKED 75

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSKVY-------------------FLIETSNN 115
            I LN    S +        Q C   R+  ++                      I + NN
Sbjct: 76  RIWLN----SKEEDVGHPRLQTC--LREIRRLARKRRSGRDGDSASLSLSYKVHIASVNN 129

Query: 116 IPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT 175
            PT AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW+ G 
Sbjct: 130 FPTAAGLASSAAGYACLVYTLARLYGV---EGELSEVARQGSGSACRSMYGGFVEWLMGE 186

Query: 176 DQNGMDSFA---VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS 232
             +G DS A   VP    WP+LR+ +L +   +K +GS   M+ +   SP      + + 
Sbjct: 187 RPDGKDSIAQQLVP-ETHWPELRVLILVVSAEKKSVGSTAGMQTSVETSPLLKFRAESVV 245

Query: 233 TD-LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDA 289
              +A +++ I ++DF   G +  K++ + HAT +   PP+ Y    +  I  +   ++A
Sbjct: 246 PGRMAEMRRCIQEKDFQGFGLLTMKDSNQFHATCLDTFPPICYLNDTSRHIISLVHRFNA 305

Query: 290 RQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
                 + +T DAGPN  ++FT  ++ T+  F
Sbjct: 306 HFGKTRVAYTFDAGPN-AVIFT--LDNTVDDF 334


>gi|332075233|gb|EGI85703.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA17570]
          Length = 298

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 152/288 (52%), Gaps = 15/288 (5%)

Query: 39  GKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQSSFFKKTTQF 96
           GK   K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +       K ++ 
Sbjct: 2   GKEKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE--HAKMSKI 59

Query: 97  CDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLG 156
            D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +      L++ A+  
Sbjct: 60  IDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFA 119

Query: 157 SGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKKIGSREAM 214
           SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++K I SR+ M
Sbjct: 120 SGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKKKPISSRDGM 170

Query: 215 EITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
           ++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   ASP   Y
Sbjct: 171 KLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATTKTASPAFSY 230

Query: 275 WQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
               + + M+ V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 231 LTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 278


>gi|225711458|gb|ACO11575.1| Diphosphomevalonate decarboxylase [Caligus rogercresseyi]
          Length = 390

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/340 (30%), Positives = 167/340 (49%), Gaps = 21/340 (6%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+S SL+L         T++ S   + D I LN ++ S 
Sbjct: 11  PVNIAVIKYWGKRDEELILPINDSFSLTLDTKEMRAKTTIMTSPEFEKDQIWLNDKEESM 70

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
           ++   ++         Q S   + I   + NN PT AGLASSA+G+A L  AL +I+ I 
Sbjct: 71  ENPRLQRCLGEIRKRSQASHKNWKIRICSENNFPTAAGLASSAAGYACLVYALSKIFEI- 129

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKI 201
             +  +S +ARLGSGSACRS   GF  W  G+   G DSF+     ++ W D+++ +  +
Sbjct: 130 --NGDISALARLGSGSACRSTLGGFVRWHMGSSPEGTDSFSESLFSSDHWNDIKVLICVV 187

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
            D  +K+ S E M      S       ++ +   +  I +A+ ++DF    E+  K++ +
Sbjct: 188 SDSREKVPSSEGMRNGVKTSSLLKYRAEEDVPRRMETIIEAVKNKDFESFAEIVMKDSNQ 247

Query: 261 MHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----I 314
            HA  +   PP  Y    +  I  +    +A+ +   + +T DAGPN  L         +
Sbjct: 248 FHAICMDTYPPNPYLNDTSHAISSLVHEINAKYRKNMVCYTYDAGPNACLFMPSSSLDLL 307

Query: 315 EETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
              ++ FFP      P  S + +    SLS +N  E  ++
Sbjct: 308 AGYLQHFFPR----SPDSSDEAFFLGKSLSPRNLTETDLN 343


>gi|320546918|ref|ZP_08041220.1| diphosphomevalonate decarboxylase [Streptococcus equinus ATCC 9812]
 gi|320448436|gb|EFW89177.1| diphosphomevalonate decarboxylase [Streptococcus equinus ATCC 9812]
          Length = 316

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 159/299 (53%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +   A  D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAAKMIPATSSISLTLENMFTTTSVSFLPDTATHDEFYING--VLQDE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGQRTEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLTQA 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  + + V       DL++G++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPLAAW----DKDTGEVYQVE-----TDLKLGMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   + + DF ++GE+ E+NAL MH T 
Sbjct: 181 KPISSREGMKRCVETSTTFENWVKQSEQDYKDMLGYLKNNDFERVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             A+PP  Y  +E+ + M+ V   R +    YFT+DAGPN+K+L   +  E + + F E
Sbjct: 241 THANPPFNYLTEESYKAMDFVKQLRAEGEKCYFTMDAGPNVKVLCLEEDLERLTKRFEE 299


>gi|288905466|ref|YP_003430688.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           UCN34]
 gi|288732192|emb|CBI13757.1| putative diphosphomevalonate decarboxylase [Streptococcus
           gallolyticus UCN34]
          Length = 316

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 154/299 (51%), Gaps = 15/299 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYING--VLQDE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLNQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQ-----TDLKLAMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL MH T 
Sbjct: 181 KPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L   +  E + + F E
Sbjct: 241 THANPPFNYLTDETYAAMDFVKSLRTQGEKCYFTMDAGPNVKVLCLEEDLECLTKRFEE 299


>gi|257124948|ref|YP_003163062.1| diphosphomevalonate decarboxylase [Leptotrichia buccalis C-1013-b]
 gi|257048887|gb|ACV38071.1| diphosphomevalonate decarboxylase [Leptotrichia buccalis C-1013-b]
          Length = 327

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 168/319 (52%), Gaps = 35/319 (10%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSD---------------- 72
           +NIA+ KYWGK++++  +P  +S+SL+L  + T T +  I DSD                
Sbjct: 8   ANIAIVKYWGKKNAEKMIPSTSSISLTLNDMFTETEMEFINDSDIKIAVEKEIKSENYKD 67

Query: 73  -----ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSAS 127
                 D   LNG+     S   +K ++  DLFR        I T+NN+PT AGL+SS+S
Sbjct: 68  KYSDMTDLFYLNGE--LQDSVHTEKISKVVDLFRGNRSQKVKISTTNNMPTAAGLSSSSS 125

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           G +A+  A   ++        L+++++ GSGS+ RSF+     W    D++  + + V  
Sbjct: 126 GLSAVIKACNELFGKNYTQSELAQISKFGSGSSSRSFFGPVAAW----DKDTGEIYEVK- 180

Query: 188 NNQWPDLRIGLLKII--DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
                DL++ ++ ++  + +K+I SR  ME+    S +F +W +Q   D  ++K+ + + 
Sbjct: 181 ----TDLKLAMIVLVLNENKKEISSRNGMELCAKTSTYFDEWVKQSEIDFVNMKKYLAEN 236

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           D  K+G + E+NAL+MH T   A+PP  Y+ ++T + M+ V + R      YFT+DAGPN
Sbjct: 237 DLEKVGILTEENALRMHKTTETANPPFSYFNEKTYEAMDFVKNLRNNGEKCYFTMDAGPN 296

Query: 306 LKLLFTHKIEETIKQFFPE 324
           +K+L      E +   F E
Sbjct: 297 VKVLCLEDDLEKLAGIFEE 315


>gi|306831548|ref|ZP_07464706.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|304426333|gb|EFM29447.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
          Length = 316

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 155/304 (50%), Gaps = 16/304 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYING--VLQDE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLNQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQ-----TDLKLAMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL MH T 
Sbjct: 181 KPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQFFPE 324
             A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L     +E   K+F   
Sbjct: 241 THANPPFNYLTDETYAAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEENLERLTKRFEEN 300

Query: 325 ITII 328
             +I
Sbjct: 301 YRVI 304


>gi|109158018|pdb|2GS8|A Chain A, Structure Of Mevalonate Pyrophosphate Decarboxylase From
           Streptococcus Pyogenes
          Length = 317

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 150/288 (52%), Gaps = 15/288 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK +    +P  +S+SL+L +  T T ++ +   A  D   +NG  I    
Sbjct: 15  ANIAIIKYWGKENQAKXIPSTSSISLTLENXFTTTSVSFLPDTATSDQFYING--ILQND 72

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D FRQ  + +   ET NN PT AGL+SS+SG +AL  A  +++      +
Sbjct: 73  EEHTKISAIIDQFRQPGQAFVKXETQNNXPTAAGLSSSSSGLSALVKACDQLFDTQLDQK 132

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
           +L++ A+  SGS+ RSF+     W    D++    + V       DL+   + ++    +
Sbjct: 133 ALAQKAKFASGSSSRSFFGPVAAW----DKDSGAIYKVE-----TDLKXAXIXLVLNAAK 183

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE  ++ R  S  F QW +Q + D  H    +   +F K+G++ E NAL  HAT 
Sbjct: 184 KPISSREGXKLCRDTSTTFDQWVEQSAIDYQHXLTYLKTNNFEKVGQLTEANALAXHATT 243

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             A+PP  Y  KE+ Q  E V + RQ+    YFT DAGPN+K+L   K
Sbjct: 244 KTANPPFSYLTKESYQAXEAVKELRQEGFACYFTXDAGPNVKVLCLEK 291


>gi|308493647|ref|XP_003109013.1| hypothetical protein CRE_11683 [Caenorhabditis remanei]
 gi|308247570|gb|EFO91522.1| hypothetical protein CRE_11683 [Caenorhabditis remanei]
          Length = 382

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 155/303 (51%), Gaps = 20/303 (6%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQ 86
           +P NIAL KYWGKRD KL LPLN+S+SL++  L   T I +I       + +N +K+   
Sbjct: 15  VPMNIALVKYWGKRDEKLILPLNDSISLTVDKLTARTTIRMIQGVGKHTVEINDEKV-EL 73

Query: 87  SSFFKKTTQFCDLFRQFSKV--------------YFLIETSNNIPTKAGLASSASGFAAL 132
           SS  +  T F +  R   K               +F + ++ N P  AGLASSA+GFAA+
Sbjct: 74  SSNKRYQTVFDEALRLQRKRKEDSNGNENRSVSHHFEVISTTNFPVAAGLASSAAGFAAI 133

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQW 191
            LA+ ++ ++ +     +R+AR+GSGSACRS   G   W  G   +G D  AV   ++ W
Sbjct: 134 ALAIQQLLNLDDI--QANRLARIGSGSACRSMSGGLVHWKKGEKDDGSDCVAVKTKDDNW 191

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKL 250
            DL   +L   D  KK+GS E M  TR  S       +++  + +  IK+A   ++F  L
Sbjct: 192 TDLYCVILVFNDGRKKVGSSEGMRWTRETSTLLKHRIEKVVPERIDLIKKAYATRNFEDL 251

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF 310
             V   ++ + HA  +   PP+ Y  + + Q +E V    Q  I   +T DAGPN  ++ 
Sbjct: 252 ARVIMADSNQFHAVCLDTIPPIRYLNESSWQLIETVEKFNQPEIKAAYTFDAGPNACVIV 311

Query: 311 THK 313
             K
Sbjct: 312 QKK 314


>gi|312868395|ref|ZP_07728595.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis
           F0405]
 gi|311096140|gb|EFQ54384.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis
           F0405]
          Length = 316

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 165/301 (54%), Gaps = 23/301 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC--IILNG--QKISS 85
           +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ + +DA      ++G  Q  + 
Sbjct: 12  ANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETRLSPLPADATAHEFYIDGEFQNPAE 71

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
           Q+    K     D  +   +  F+ ++TSNN+PT AGL+SS+SG +AL  A  R Y +  
Sbjct: 72  QA----KIGAVIDGLKPADEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNRYYDLGL 127

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII-- 202
             E L++ A+  SGS+ RSF+     W    D+   + + V       DL++ ++ ++  
Sbjct: 128 SQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVK-----TDLKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKSVSSREGMKRCMETSTNFKEWVEESRQDYKDMLDYLAANDFERVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L    +EE + Q  
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRAAGHACYFTMDAGPNVKVLC---LEEDLDQLV 295

Query: 323 P 323
           P
Sbjct: 296 P 296


>gi|125580503|gb|EAZ21434.1| hypothetical protein OsJ_05037 [Oryza sativa Japonica Group]
          Length = 493

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 116/222 (52%), Gaps = 20/222 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 271 PTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 330

Query: 86  QSSFF-------KKTTQFCDLFRQ--------FSKVYFLIETSNNIPTKAGLASSASGFA 130
               F       +K  Q  +  ++        + K++  I + NN PT AGLASS +G  
Sbjct: 331 SGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLASSVAGLV 390

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
                L  + ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV   ++
Sbjct: 391 CFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAVQLADE 450

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ 230
             W DL I +  +  ++K+  S   M  +   SP      Q+
Sbjct: 451 AHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQR 492


>gi|242023989|ref|XP_002432413.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus
           corporis]
 gi|212517836|gb|EEB19675.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus
           corporis]
          Length = 401

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 160/317 (50%), Gaps = 40/317 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISS 85
           P NIA  KYWGKRD  L LPLN+S+S+++         T+  S     D I LNG+    
Sbjct: 9   PVNIAAIKYWGKRDETLILPLNDSISVTINTNFMRAKTTIAASPHFKNDRIWLNGR---- 64

Query: 86  QSSFFKKTTQFC---DLFRQFSKVYFL----------------IETSNNIPTKAGLASSA 126
           +  F       C     +RQ S +  +                I + NN PT AGLASSA
Sbjct: 65  EEDFTNPRLMACVNESKYRQHSNIKSMQGNAIIIEKAANWKIHIASENNFPTAAGLASSA 124

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +G+A L  AL R+  I      LS +AR GSGSACRS + GF  W  G +++G DS A  
Sbjct: 125 AGYACLVYALSRLMGI---DGDLSSIARKGSGSACRSMHGGFVMWKMGKEKDGSDSVAEQ 181

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           +  ++ W ++R+ +L +   +K IGS   ME +   S F   +  Q+   ++ +++AI++
Sbjct: 182 IAPSSHWKEMRMLILIVNGCKKTIGSSAGMERSVKTSDFLKNF--QLDQRVSALRKAILN 239

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLD 301
           +DF+   E+  K++ ++H+  +   PP+ Y    +   IQ +  + D   +   + ++ D
Sbjct: 240 KDFVTFAEITMKDSNRLHSICLDTYPPIQYLNDTSHYIIQLVHFLNDHFGKP-KVAYSYD 298

Query: 302 AGPNLKLLFTHKIEETI 318
           AGPN  L     +EE +
Sbjct: 299 AGPNACLFL---LEENV 312


>gi|332204404|gb|EGJ18469.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA47901]
          Length = 298

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 151/288 (52%), Gaps = 15/288 (5%)

Query: 39  GKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQSSFFKKTTQF 96
           GK   K  +P  +S+SL+L ++ T T ++ + ++  AD   +NGQ  +       K ++ 
Sbjct: 2   GKEKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE--HAKMSKI 59

Query: 97  CDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLG 156
            D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +      L++ A+  
Sbjct: 60  IDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFA 119

Query: 157 SGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKKIGSREAM 214
           SGS+ RSFY     W    D++  + + V       DL++ ++ ++  D++K I SR+ M
Sbjct: 120 SGSSSRSFYGPLGAW----DKDSGEIYPVE-----TDLKLAMIMLVLEDKKKPISSRDGM 170

Query: 215 EITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
           ++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   ASP   Y
Sbjct: 171 KLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATTKTASPAFSY 230

Query: 275 WQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
               + + M  V   R++    YFT+DAGPN+K+    K  E + + F
Sbjct: 231 LTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIF 278


>gi|306833699|ref|ZP_07466826.1| diphosphomevalonate decarboxylase [Streptococcus bovis ATCC 700338]
 gi|304424469|gb|EFM27608.1| diphosphomevalonate decarboxylase [Streptococcus bovis ATCC 700338]
          Length = 316

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 155/304 (50%), Gaps = 16/304 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAIKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYING--VLQDE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLNQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQ-----TDLKLAMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL MH T 
Sbjct: 181 KPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLEANDFEKVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQFFPE 324
             A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L     +E   K+F   
Sbjct: 241 THANPPFNYLTNETYTAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEEDLERLTKRFEEN 300

Query: 325 ITII 328
             +I
Sbjct: 301 YRVI 304


>gi|307192094|gb|EFN75436.1| Diphosphomevalonate decarboxylase [Harpegnathos saltator]
          Length = 411

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 147/303 (48%), Gaps = 24/303 (7%)

Query: 39  GKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILNGQKISSQSSFFKKTTQ 95
           GKRD  L LP+N+S+S +L         TV+ S     DCI LN +K   ++   +    
Sbjct: 44  GKRDESLILPVNDSISATLDTEQLHAKTTVMISQHFKEDCIWLNERKEDIKNPRLQNCLN 103

Query: 96  FCDLFRQFS------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
                 Q S      K++  I + NN PT AGLASSA+G+A LT AL ++Y +      +
Sbjct: 104 EIRSRSQLSGHMNDWKIH--ICSKNNFPTAAGLASSAAGYACLTAALTKLYKV---EGDI 158

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA---VPFNNQWPDLRIGLLKIIDREK 206
           S +AR GSGSACRS   GF  W  G D+ GMDS A   VP  + WP++RI L+ +   +K
Sbjct: 159 SLIARSGSGSACRSIMGGFVRWHMGMDKYGMDSLAKQIVP-ASHWPEMRILLIVVNSEQK 217

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           K+ S   M+ +   S F       +      ++ AII ++F    E+  K++ +MHA   
Sbjct: 218 KVSSTIGMKRSMETSEFMQHRIANVPEKADKMQCAIIQKNFKTFAELTMKDSNQMHAVCQ 277

Query: 267 AASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK----IEETIKQ 320
              PP +Y      +I      ++     I + +T DAGPN  L    K    I   +  
Sbjct: 278 DTYPPCVYMNDVSHSIVNFIHSYNDAMNDIKVAYTYDAGPNATLYLMEKDVPGIIGVLDY 337

Query: 321 FFP 323
           FFP
Sbjct: 338 FFP 340


>gi|68473922|ref|XP_719064.1| hypothetical protein CaO19.6105 [Candida albicans SC5314]
 gi|68474127|ref|XP_718960.1| hypothetical protein CaO19.13524 [Candida albicans SC5314]
 gi|46440756|gb|EAL00059.1| hypothetical protein CaO19.13524 [Candida albicans SC5314]
 gi|46440864|gb|EAL00166.1| hypothetical protein CaO19.6105 [Candida albicans SC5314]
          Length = 264

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 112/204 (54%), Gaps = 3/204 (1%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFC 169
           I + NN PT AGLASSA+GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF 
Sbjct: 5   IVSENNFPTAAGLASSAAGFAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLFGGFV 64

Query: 170 EWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
            W  GT  +G DS AV       WP LR  +L + D +K   S   M+ T   S  F   
Sbjct: 65  AWEMGTLPDGQDSKAVEIAPLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDLFAHR 124

Query: 228 TQQISTD-LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV 286
             ++       +K+AI+D+DF K  E+  K++   HA  + + PP+ Y    + + ++ V
Sbjct: 125 IAEVVPQRFEAMKKAILDKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKMV 184

Query: 287 WDARQQSIPIYFTLDAGPNLKLLF 310
               QQ +   +T DAGPN  + +
Sbjct: 185 ETINQQEVVAAYTFDAGPNAVIYY 208


>gi|261749367|ref|YP_003257052.1| mevalonate diphosphate decarboxylase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497459|gb|ACX83909.1| mevalonate diphosphate decarboxylase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 353

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 162/303 (53%), Gaps = 25/303 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGT----ITHITVIDSDADCIILNGQKIS 84
           PSNIAL KYWGK+ +K+ +P N+S+S SL  + T    I H+      +  I  +G++ +
Sbjct: 26  PSNIALIKYWGKQKNKIQIPSNSSISYSLEKVYTETRLIYHLREKKKRSIKIFFSGKENT 85

Query: 85  S----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           S       FF + + +C   R F+   F+IET N  P  +G+ASSAS  +AL L +  I 
Sbjct: 86  SFLPKILEFFHRISLYCSYLRDFN---FVIETKNTFPHSSGIASSASSMSALALCIMEIE 142

Query: 141 -----SIPEKS--ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS-FAVPFNNQWP 192
                S+ E       S +AR GSGSACRS Y G   W       G ++ +A+P+  +  
Sbjct: 143 KKLVSSLEEDFFLRKASFLARFGSGSACRSIYPGLVVWGGHKSIKGSNNLYAIPYPYKIH 202

Query: 193 DL--RIG--LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
            +  ++G  +L I +  KKI S +  ++   H+P+  +  +  + ++  +   +   D  
Sbjct: 203 PIFTKMGDTILVIDEYPKKILSSKGHQLMI-HNPYAKERFKCANKNMDRLISILKMGDLQ 261

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP-IYFTLDAGPNLK 307
           + GE+ E  AL +HA ++ + P  L+ +  T+  + +VWD R+QS   IYFTLDAG N+ 
Sbjct: 262 EFGELIEHEALTLHAMIMTSHPYFLWMKPNTLHVLYKVWDFRKQSKKNIYFTLDAGANVH 321

Query: 308 LLF 310
           LL+
Sbjct: 322 LLY 324


>gi|301097882|ref|XP_002898035.1| diphosphomevalonate decarboxylase [Phytophthora infestans T30-4]
 gi|262106480|gb|EEY64532.1| diphosphomevalonate decarboxylase [Phytophthora infestans T30-4]
          Length = 422

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 161/327 (49%), Gaps = 33/327 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC----IILNGQKIS 84
           P+NIA+ KYWGK D  LN P+N+S+S++L H   +   T +   ++     + LNGQ   
Sbjct: 9   PTNIAVIKYWGKDDVALNTPINSSVSVTL-HQNQLRTTTSVAGGSELQSTRLWLNGQ--- 64

Query: 85  SQSSFFKKTTQFCDLFRQFSK--------VYFLIETSNNIPTKAGLASSASGFAALTLAL 136
            +    K+ T      +Q ++         +  I ++N+ PT AGLASSA+G+A L  AL
Sbjct: 65  -EQPINKRVTVVLREMQQLAQRVHGESDPQHLHIVSTNSFPTAAGLASSAAGYACLVAAL 123

Query: 137 FRIYSIPEKSES----LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
              Y + +  E     LS +AR GSGSACRS   GF  W  G   +G DS AV   ++  
Sbjct: 124 AEFYGVSKADEEFTGQLSAIARQGSGSACRSLDGGFVAWQKGERPDGHDSIAVQVADELH 183

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIK 249
           WP+L   +  + D +K   S   M+ ++  S       + +  + +  ++QAI+ +DF  
Sbjct: 184 WPELCAVVCVVNDAQKDTSSTTGMQTSKATSSLLAYRAKHLVPERMQTMEQAILARDFEA 243

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDAGPNLK 307
            G +  +++   HAT +  +PP+ Y    + Q +  V    +Q+  +   +T DAGPN  
Sbjct: 244 FGTLTMQDSNHFHATCLDTTPPIFYLNDVSRQIIHLVHRYNKQAGRVQAAYTFDAGPNAV 303

Query: 308 LLF----THKIEETIKQFFP---EITI 327
           +        ++   +   FP   E+TI
Sbjct: 304 IFVEEQHVQEVVSLVHHCFPTSSEMTI 330


>gi|296875769|ref|ZP_06899832.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           15912]
 gi|296433234|gb|EFH19018.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           15912]
          Length = 316

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 166/301 (55%), Gaps = 23/301 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC--IILNG--QKISS 85
           +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ + +DA      ++G  Q  + 
Sbjct: 12  ANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETSLSPLPADATAHEFYIDGEFQNPAE 71

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
           Q+    K     D  +  ++  F+ ++TSNN+PT AGL+SS+SG +AL  A  R Y +  
Sbjct: 72  QA----KIGAVIDGLKPVNEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNRYYDLGL 127

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII-- 202
             E L++ A+  SGS+ RSF+     W    D+   + + V       DL++ ++ ++  
Sbjct: 128 TQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVK-----TDLKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKPVSSREGMKRCMETSTNFKEWIEESRQDYKDMLDYLAGNDFEQVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L    +EE + Q  
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRVAGHACYFTMDAGPNVKVLC---LEEDLDQLM 295

Query: 323 P 323
           P
Sbjct: 296 P 296


>gi|325067067|ref|ZP_08125740.1| diphosphomevalonate decarboxylase [Actinomyces oris K20]
          Length = 207

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 7/184 (3%)

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
           +LSR+AR GSGSA RS + G   W  G D     S+A P   +  DL + ++ +  R K 
Sbjct: 10  ALSRLARRGSGSATRSVFGGLVLWNAGHDD--ASSYAEPVACEM-DLAMVVVVLSQRYKP 66

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S  AM  T   SP F  W +    DL     A+   D  +LGEV E NAL MHATMIA
Sbjct: 67  ISSTRAMRATMATSPLFPAWVEASRGDLQVALDAVRTGDLERLGEVVEGNALGMHATMIA 126

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFP 323
             P ++YW  +T+  +  +   R++ +P++ T+DAGPN+K+L       ++   ++   P
Sbjct: 127 TRPGIVYWLPQTVAALHAIRAMREEGLPVWATIDAGPNVKVLTEGARAEEVAAALRDRLP 186

Query: 324 EITI 327
             T+
Sbjct: 187 GTTV 190


>gi|325978456|ref|YP_004288172.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325178384|emb|CBZ48428.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 316

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 155/304 (50%), Gaps = 16/304 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQS 87
           +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG  +    
Sbjct: 12  ANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYING--VLQDE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
               K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++       
Sbjct: 70  KEHAKISAIIDQYRGGRSEFVRVETSNNMPTAAGLSSSSSGLSALVKACNELFETGLNQS 129

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DRE 205
            L++ A+  SGS+ RSF+     W    D++  D + V       DL++ ++ ++  D +
Sbjct: 130 ELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQ-----TDLKLAMIMLVLSDSK 180

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL MH T 
Sbjct: 181 KPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAMHDTN 240

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL-FTHKIEETIKQFFPE 324
             A+PP  Y   +T   M+ V   R Q    YFT+DAGPN+K+L     +E   K+F   
Sbjct: 241 THANPPFNYLTDKTYAAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEEDLERLTKRFEEN 300

Query: 325 ITII 328
             +I
Sbjct: 301 YRVI 304


>gi|305666246|ref|YP_003862533.1| diphosphomevalonate decarboxylase [Maribacter sp. HTCC2170]
 gi|88708237|gb|EAR00474.1| diphosphomevalonate decarboxylase [Maribacter sp. HTCC2170]
          Length = 360

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 101/316 (31%), Positives = 164/316 (51%), Gaps = 29/316 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADC----IILNGQK 82
           PSNIAL KYWGK++ ++  P N S+S +L    T T I+   +  +A      ++  G+ 
Sbjct: 25  PSNIALVKYWGKKEDQI--PANPSISFTLDACATTTTISYSKLKEEAKSFSFELLFEGKS 82

Query: 83  ISSQS----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
             S      +FF++  ++    R +   +  I TSN+ P  +G+ASSASG +A+ L L  
Sbjct: 83  KESFKPKIRTFFERIAKYMPFLRDY---HLKIVTSNSFPHSSGIASSASGMSAMALCLMH 139

Query: 139 IYSI--PE-KSESLSR----VARLGSGSACRSFYRGFCEWIC-GTDQNGMDSFAV--PFN 188
           I S   PE   E  +R    +ARLGSGSACRS      +W   G  +   D FA+  P+N
Sbjct: 140 IESELNPEIDKEYFNRKASFLARLGSGSACRSIEGDLIQWGSHGPTKGSSDLFAIKYPYN 199

Query: 189 --NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
             N +      +L +   +K++ S    ++   H PF  Q   Q + +L+ +K      D
Sbjct: 200 VHNIFQKYHDTILLVDKGQKQVSSTIGHDLMHGH-PFAEQRFTQANDNLSKLKNVFASGD 258

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPN 305
            ++  ++ E  AL +HA M+A+ P  +  +  T+Q + ++W+ R+ S   + FTLDAG N
Sbjct: 259 LVEFIKIVESEALTLHAMMMASMPYFILMKPNTLQIINKIWEFRKTSNTHVCFTLDAGAN 318

Query: 306 LKLLFTHKIEETIKQF 321
           + +L+    +ET+ QF
Sbjct: 319 VHVLYPENEKETVYQF 334


>gi|320582344|gb|EFW96561.1| diphosphomevalonate decarboxylase [Pichia angusta DL-1]
          Length = 283

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 125/219 (57%), Gaps = 7/219 (3%)

Query: 106 VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFY 165
           ++  I + NN PT AGLASSA+GFAAL  A+ ++Y +P+ +  LS++AR GSGSACRS +
Sbjct: 1   MHLHIVSENNFPTAAGLASSAAGFAALISAIAKLYELPQTASDLSKIARKGSGSACRSLF 60

Query: 166 RGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
            G+  W  G  +NG DS AV     + WPD++  +L + D +K + S   M++T   SP 
Sbjct: 61  GGYVAWEMGELENGEDSKAVEVAPLSHWPDMKACILVVSDDKKDVPSTSGMQLTVKTSPL 120

Query: 224 FTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KET 279
           F    +++       +K++I++++F    E+  K++   HAT + + PP+ Y     K  
Sbjct: 121 FQHRIEKVVPQRFEEMKKSIVEKNFPLFAELTMKDSNSFHATCLDSYPPIFYLNDTSKRI 180

Query: 280 IQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           I+ +  + D+  + I  Y T DAGPN  + +  K E  +
Sbjct: 181 IKLINLLNDSVGEIIAAY-TYDAGPNAVIYYEQKNESRV 218


>gi|118096575|ref|XP_423130.2| PREDICTED: hypothetical protein, partial [Gallus gallus]
          Length = 366

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 96/314 (30%), Positives = 154/314 (49%), Gaps = 25/314 (7%)

Query: 39  GKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISSQSSFFK---- 91
           GKRD+ L LP+N+SLS++L       T T     D   D + LNG+++ +     +    
Sbjct: 56  GKRDTDLILPINSSLSVTLHQDQLRTTTTAAACRDFTEDRLWLNGEEVDAAQPRLQACLR 115

Query: 92  ------KTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
                 +  +  D     S  Y + + + NN PT AGLASSA+G+A L  AL R+Y +  
Sbjct: 116 EVRRLARKRRGDDAAAPLSLSYKVHVASENNFPTAAGLASSAAGYACLVSALARLYGV-- 173

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKII 202
               LS VAR GSGSACRS   GF +W  G   +G DS A  +     WP+L + +L + 
Sbjct: 174 -EGELSEVARRGSGSACRSMLGGFVQWHRGERPDGRDSVAQQLAPETHWPELSVLVLVVS 232

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEKNALKM 261
             +K +GS   M+ +   SP      + +  + +  + + I D+DF   G++  +++ + 
Sbjct: 233 GEKKAVGSTAGMQTSVDTSPLLKYRAEVVVPERMTRMARCIRDRDFEAFGQLTMQDSNQF 292

Query: 262 HATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           HAT +   PP+ Y     + I  +   ++A      + +T DAGPN  +     +E+T+ 
Sbjct: 293 HATCLDTFPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVVFM---LEDTVD 349

Query: 320 QFFPEITIIDPLDS 333
           +F   +    P DS
Sbjct: 350 EFVEVVRRSFPPDS 363


>gi|312385830|gb|EFR30235.1| hypothetical protein AND_00303 [Anopheles darlingi]
          Length = 427

 Score =  122 bits (306), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 115/226 (50%), Gaps = 14/226 (6%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFC 169
           +E+ NN PT AGLASSASG+A     L  +Y I  + E LS +AR+GSGSACRS + G+ 
Sbjct: 149 VESENNFPTAAGLASSASGYACFVYTLATLYGI--EGEELSGIARMGSGSACRSLHSGYV 206

Query: 170 EWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-Q 226
           +W+ G   +G DS AV       WP++ + +L + DR+K   S   M  +   S     +
Sbjct: 207 QWVKGDRADGADSIAVQLAPATAWPEMHVLILVVNDRKKATASTHGMATSVKTSDLLRYR 266

Query: 227 WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGME 284
            +  +   +  +K+A+ ++DF   G +A K++ + HA  +   PP  Y      +I  + 
Sbjct: 267 ASTCVPERVDQLKKALEERDFDTFGRIAMKDSNQFHAVCLDTYPPCFYMNDVSRSIIRLV 326

Query: 285 RVWDAR---QQSIPIYFTLDAGPNLKLLFTHK----IEETIKQFFP 323
              + R      + + ++ DAGPN  L    +    +   +++ FP
Sbjct: 327 HAINGRAGVDAPVKVAYSYDAGPNACLFLQERDVAEVSAIVRRVFP 372


>gi|322390283|ref|ZP_08063812.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           903]
 gi|321143014|gb|EFX38463.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           903]
          Length = 316

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 165/301 (54%), Gaps = 23/301 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC--IILNG--QKISS 85
           +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ + +DA      ++G  Q  + 
Sbjct: 12  ANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETSLSPLPADATAHEFYIDGEFQNPAE 71

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
           Q+    K     D  +   +  F+ ++TSNN+PT AGL+SS+SG +AL  A  + Y +  
Sbjct: 72  QA----KIGAVIDSLKPADEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNQYYDLGL 127

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII-- 202
             E L++ A+  SGS+ RSF+     W    D+   + + V       DL++ ++ ++  
Sbjct: 128 SQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVK-----TDLKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKPVSSREGMKRCMETSTNFKEWIEESRQDYKDMLDYLAGNDFERVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L    +EE + Q  
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRAAGHACYFTMDAGPNVKVLC---LEEDLDQLV 295

Query: 323 P 323
           P
Sbjct: 296 P 296


>gi|162452482|ref|YP_001614849.1| diphosphomevalonate decarboxylase [Sorangium cellulosum 'So ce 56']
 gi|161163064|emb|CAN94369.1| Diphosphomevalonate decarboxylase [Sorangium cellulosum 'So ce 56']
          Length = 335

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 107/300 (35%), Positives = 155/300 (51%), Gaps = 13/300 (4%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIIL 78
           +  +++A    NIAL KYWGKR    NLP   SLS++L  + T T +    S D D + L
Sbjct: 3   VVSRATAIAHPNIALAKYWGKRADGHNLPAVPSLSVTLAGMATTTEVAFDASLDRDELHL 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
            G  +   +   ++     D  R  S  +    + + N+ PT AGLASSAS FAAL LA 
Sbjct: 63  GGAALPPDAEATRRVAGLLDRVRAASGRRERARVVSRNDFPTAAGLASSASAFAALALAA 122

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV-PF--NNQWPD 193
                +P     +S +AR  S SA RS + GF E   G  + G ++ A  P    + WP 
Sbjct: 123 SAAAGLPTAPALVSDLARKTSVSAARSAFGGFVELRAG--RPGDEALAATPLAPEDHWP- 179

Query: 194 LRIGLLKIIDRE--KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
             + ++  + RE  K +GS + M  T   SP+F  W     +    ++ A++ +D   LG
Sbjct: 180 --LAVVIAVTREGPKDVGSSDGMRHTAMTSPYFPAWVDAAPSLFDAVRAAVLARDLAALG 237

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
             AE +AL MHA+ IAASP LLYW   T++ +  V   R Q  P +FT+DAGP++K+  T
Sbjct: 238 AAAEASALCMHASSIAASPGLLYWTGATVEVIAAVRRLRAQGTPAFFTIDAGPHVKVFTT 297


>gi|326927540|ref|XP_003209950.1| PREDICTED: diphosphomevalonate decarboxylase-like [Meleagris
           gallopavo]
          Length = 332

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 93/302 (30%), Positives = 150/302 (49%), Gaps = 25/302 (8%)

Query: 39  GKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS---------- 85
           GKRD+ L LP+N+SLS++L       T T     D   D + LNG+++ +          
Sbjct: 21  GKRDTDLILPINSSLSVTLHQDQLRTTTTAAACRDFTEDRLWLNGEEVDAGQPRLQACLR 80

Query: 86  QSSFFKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
           +     +  +  D     S  Y + + + NN PT AGLASSA+G+A L  AL R+Y +  
Sbjct: 81  EVRRLARKRRGDDAAAPLSLSYKVHVASENNFPTAAGLASSAAGYACLVSALARLYGVEG 140

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKII 202
           +   LS VAR GSGSACRS   GF +W  G   +G DS A        WP+L + +L + 
Sbjct: 141 E---LSEVARRGSGSACRSMLGGFVQWHRGERPDGKDSVAQQLAPETHWPELSVLVLVVS 197

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEKNALKM 261
             +K +GS   M+ +   SP      + +  + +  + + I D+DF   G++  +++ + 
Sbjct: 198 GEKKAVGSTAGMQTSVDTSPLLKYRAEMVVPERMTRMARCIQDRDFEAFGQLTMQDSNQF 257

Query: 262 HATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           HAT +   PP+ Y     + I  +   ++A      + +T DAGPN  +     +E+T+ 
Sbjct: 258 HATCLDTFPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVIFM---LEDTVD 314

Query: 320 QF 321
           +F
Sbjct: 315 EF 316


>gi|326334928|ref|ZP_08201129.1| mevalonate diphosphate decarboxylase [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325692965|gb|EGD34903.1| mevalonate diphosphate decarboxylase [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 354

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 154/317 (48%), Gaps = 32/317 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-------DADCIILNGQ 81
           PSNIAL KYWGK++ +L  P+N S+S +L H  T T I +            D       
Sbjct: 25  PSNIALVKYWGKKEGQL--PMNPSISFTLTHSYTETVIEIAPRTDFTTSFQIDFYFDETP 82

Query: 82  K---ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           K   +    +FF +   +    R +   YF++ T N+ P  +G+ASSASG AAL + L +
Sbjct: 83  KDNFLPKIETFFTRIRNYLPFLRDY---YFIVRTHNSFPHSSGIASSASGMAALAMCLMK 139

Query: 139 IYSI--PEKS-----ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS---FAVPFN 188
           I  +  PE S     E  S +ARLGSGSACRS       W  G      DS   + VP  
Sbjct: 140 IERLFSPEMSELYFYEKASFLARLGSGSACRSITGSVVIW--GEHPAVADSSDFYGVPIG 197

Query: 189 N--QWPDLRIGLLKIIDR-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
           +  +  D     + +ID+ +K + S     + + H P+      Q    +A +K  + + 
Sbjct: 198 DVHEVFDTYQDAILLIDKGQKPVSSSMGHRLMQGH-PYAEARFVQARQHIAQLKDILREG 256

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGP 304
           D +    + E  AL +HA M+ + P  L  +  T+  +E++W  R  + +P+ FTLDAG 
Sbjct: 257 DLLAFTSLVESEALSLHAMMMTSDPYYLLMRPNTLAAIEQIWYYRMSTQVPVCFTLDAGA 316

Query: 305 NLKLLFTHKIEETIKQF 321
           N+ LL+ H   + ++ F
Sbjct: 317 NIHLLYPHSYHKEVENF 333


>gi|17537201|ref|NP_496966.1| hypothetical protein Y48B6A.13 [Caenorhabditis elegans]
 gi|5824811|emb|CAB54454.1| C. elegans protein Y48B6A.13b, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 377

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 168/348 (48%), Gaps = 30/348 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++  +P NIAL KYWGKRD  L LPLN+S+SL++  L   T I ++       + +NG+
Sbjct: 11  EATVRVPMNIALVKYWGKRDDLLILPLNDSISLTVDRLTAETTIRMVPGVGKHTVEINGK 70

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--------------------VYFLIETSNNIPTKAG 121
            +   SS  +  T F +  R   K                     +F + ++ N P  AG
Sbjct: 71  SV-ELSSNKRYQTVFDEALRLQRKRKEAEASSADSNGNDPPPIFYHFHVTSTTNFPVAAG 129

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAA+ LA+ RI  + +     +R+AR+GSGSACRS Y G   W  G   +G D
Sbjct: 130 LASSAAGFAAIALAIQRILRLDDS--QANRLARIGSGSACRSMYGGLVHWRKGEMDDGSD 187

Query: 182 SFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHI 238
             AV       W DL   +L   D  KK+GS E M  +R  S       + I    +  I
Sbjct: 188 CLAVRTEAAANWEDLYCIILVFDDGRKKVGSSEGMRRSRETSQLLKHRIESIVPQRIQQI 247

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYF 298
           ++A   ++F +L  V   ++ + HA  + ++PP+ Y  + + Q ++ V +     I   +
Sbjct: 248 QEAYTSRNFEQLARVIMADSNQFHAVCMDSTPPIRYLNEASWQLIDTVEEFNIGGIRAAY 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           T DAGPN  ++     +E   QF   +     + S DL      L+++
Sbjct: 308 TFDAGPNACVIVQ---KENASQFLKAVLQTIQVPSEDLQVIGKELAEQ 352


>gi|320170681|gb|EFW47580.1| diphosphomevalonate decarboxylase [Capsaspora owczarzaki ATCC
           30864]
          Length = 398

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 150/313 (47%), Gaps = 34/313 (10%)

Query: 39  GKRDSKLNLPLNNSLS--LSLGHLGTITHITV-IDSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD +L LP+N+SLS  LS   L   T +    D  +D I LNG+    Q S      Q
Sbjct: 23  GKRDEELILPINSSLSGTLSQDQLHARTSVMARADFASDAIWLNGK----QESIENPRLQ 78

Query: 96  FCDLFRQFSKVYFLIETS----------------NNIPTKAGLASSASGFAALTLALFRI 139
            C   R+  K+    +T                 NN PT AGLASSA+G+A L  AL ++
Sbjct: 79  NC--LREIRKLAAAKQTHQQGAPLPTDKVHICSVNNFPTAAGLASSAAGYACLVYALAQL 136

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIG 197
           Y + +    ++++AR+GSGSACRS Y G+  W+ G   +G DS A  V   + WP++ + 
Sbjct: 137 YKVGDSLAEVTKLARVGSGSACRSIYGGWVRWVMGEAADGSDSIAEQVVDEHHWPEIEVL 196

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKLGEVAEK 256
           +L + D +K   S   M+ T   S        ++    +  I+ AI  +DF   G +  +
Sbjct: 197 ILVVSDHKKTTSSTAGMQTTVETSSLVKHRADKVVPQRMEDIQNAIRARDFETFGRITMQ 256

Query: 257 NALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLF---- 310
           ++ + HA  +   PP+ Y       I  M   ++A +  I   +T DAGPN  +      
Sbjct: 257 DSNQFHAVCLDTYPPITYLNDVSRGIIDMLTKYNAHKGKIQAAYTFDAGPNAVIYLPREN 316

Query: 311 THKIEETIKQFFP 323
            +++   ++ FFP
Sbjct: 317 VNEVVNLVRHFFP 329


>gi|150024415|ref|YP_001295241.1| diphosphomevalonate decarboxylase [Flavobacterium psychrophilum
           JIP02/86]
 gi|149770956|emb|CAL42423.1| Diphosphomevalonate decarboxylase [Flavobacterium psychrophilum
           JIP02/86]
          Length = 360

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 160/315 (50%), Gaps = 28/315 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------DCIILNGQK 82
           PSNIAL KYWGK+++++  P N S+S +L +  TIT ++    D       D +     K
Sbjct: 26  PSNIALVKYWGKKENQI--PANPSISFTLNNCKTITKLSFAKKDNHDDFSFDLLFEGKPK 83

Query: 83  ISSQS---SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
              ++   +FF++   +C   + +   +F I+T N  P  +G+ASSASG AAL + +  +
Sbjct: 84  EEFKTKIQNFFERIAMYCPFLKDY---HFTIDTQNTFPHSSGIASSASGMAALAMNIMSL 140

Query: 140 YSIPEKS-------ESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMDSFAVPF 187
                 S       +  S +ARLGSGSACRS       W     + G+       F+   
Sbjct: 141 EKALNPSMNDDYFYKKASFLARLGSGSACRSVKGSIVVWGENDSVAGSSNLFGVEFSSTI 200

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDF 247
           +  + + +  +L +   EK++ S    ++  +H P+  +  +Q   +L+ IK  + + + 
Sbjct: 201 HQNFKNYQDTILLVDKGEKQVSSTVGHDLMHNH-PYANRRFEQAHENLSKIKTVLENGNL 259

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIPIYFTLDAGPNL 306
            +  ++ E  AL +HA M+ + P  +  +  T++ + ++W  R + +IP+ FTLDAG N+
Sbjct: 260 DEFIKIVENEALTLHAMMMTSMPYFILMKPNTLEIINKIWKFRNENNIPVCFTLDAGANV 319

Query: 307 KLLFTHKIEETIKQF 321
            +L+    +E I QF
Sbjct: 320 HVLYPENKKEIILQF 334


>gi|332022473|gb|EGI62780.1| Diphosphomevalonate decarboxylase [Acromyrmex echinatior]
          Length = 420

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 152/308 (49%), Gaps = 21/308 (6%)

Query: 39  GKRDSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKISSQSSFFKKTTQ 95
           GKR+  L LP N+S+S +L         TV+   D   D I LNG++    ++  +   +
Sbjct: 54  GKRNESLILPTNDSISATLDTAQLHAKTTVMLSSDFKEDRIWLNGKEEDINNTRLQNCLK 113

Query: 96  FCDLFRQFSKVY----FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSR 151
                 Q S         I + NN PT AGLASSA+G+A LT AL ++Y I      +S 
Sbjct: 114 EIRKRSQLSGYTNDWKIRICSKNNFPTAAGLASSAAGYACLTAALAKLYKI---EGDISI 170

Query: 152 VARLGSGSACRSFYRGFCEWICGTDQNGMDSFA---VPFNNQWPDLRIGLLKIIDREKKI 208
           +AR GSGSACRS   GF  W  G+D+NG DS A   VP  + W ++RI +L + D +KK+
Sbjct: 171 IARSGSGSACRSVMGGFVRWYMGSDKNGTDSLAKQIVPA-SHWSEMRILVLVVSDEQKKV 229

Query: 209 GSREAMEITRHHSPFFTQWTQQISTDLAH-IKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
            S   M+ +   S         +  + A+ ++QAI+++DF    E+  K++ + HA  + 
Sbjct: 230 PSAIGMKRSIETSQLLQHRIMHVVPERANKMQQAIVEKDFKNFAELTMKDSNQFHAVCLD 289

Query: 268 ASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLFTHK----IEETIKQF 321
             PP +Y    +   M  V  ++     + + +T DAGPN  L    K    +   +  F
Sbjct: 290 TYPPCIYMNNISNNIMNLVHSYNDAVNDVKVAYTYDAGPNATLYLLEKDVSAVIGVLDHF 349

Query: 322 FPEITIID 329
           FP    I+
Sbjct: 350 FPPENAIE 357


>gi|19074299|ref|NP_585805.1| MEVALONATE PYROPHOSPHATE DECARBOXYLASE [Encephalitozoon cuniculi
           GB-M1]
 gi|19068941|emb|CAD25409.1| MEVALONATE PYROPHOSPHATE DECARBOXYLASE [Encephalitozoon cuniculi
           GB-M1]
          Length = 303

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 144/300 (48%), Gaps = 16/300 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIA+ KYWGK D+  N+P + S+S  L +  T T +     + D   LNG+ +       
Sbjct: 14  NIAVIKYWGKADTINNMPSSRSISFPLTNFLTET-VVEHSLEEDRFYLNGKMLP----IG 68

Query: 91  KKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
           +K  +  ++FR+ S       I + +N P   GLASSASG AAL LAL   Y +    E 
Sbjct: 69  EKMGRAVEIFRKKSGDDRPVCIRSFSNFPHSCGLASSASGLAALVLALNDFYGLDMPEEE 128

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKI 208
           L   AR+GSGSA RS   G   +      +GM    +P    W ++RI  + +    KK 
Sbjct: 129 LCIAARIGSGSAGRSISTGIHLF------DGMSVERLP---SWKEVRILSIILSGDCKKT 179

Query: 209 GSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
           GS E M  T+  S F+ +   +I   +  + Q I  +DF     +  + + ++HA ++  
Sbjct: 180 GSTEGMIRTKETSNFYQERLARIERKIKAMVQYISQKDFDGFAHLTMRESNELHAILMET 239

Query: 269 SPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITII 328
            PP+ Y + +  + +E   +  +    + +T DAGPN  L+   +    ++ FF    ++
Sbjct: 240 YPPIRYIRDDGFKVIEMCHEFNRDRTRVAYTFDAGPNPFLITLEQHLHAVEDFFKAYELV 299


>gi|21910132|ref|NP_664400.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes
           MGAS315]
 gi|28896169|ref|NP_802519.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes
           SSI-1]
 gi|21904324|gb|AAM79203.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes
           MGAS315]
 gi|28811419|dbj|BAC64352.1| putative mevalonate pyrophosphate decarboxylase [Streptococcus
           pyogenes SSI-1]
          Length = 287

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 149/271 (54%), Gaps = 15/271 (5%)

Query: 47  LPLNNSLSLSLGHLGTITHITVIDSDA--DCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
           +P  +S+SL+L ++ T T ++ +   A  D   +NG  +        K +   D FRQ  
Sbjct: 2   IPSTSSISLTLENMFTTTSVSFLPDTATSDQFYING--VLQNDEEHTKISTIIDQFRQPG 59

Query: 105 KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSF 164
           + +  +ET NN+PT AGL+SS+SG +AL  A  +++      ++L++ A+  SGS+ RSF
Sbjct: 60  QAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQKALAQKAKFASGSSSRSF 119

Query: 165 YRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREKKIGSREAMEITRHHSP 222
           +     W    D++    + V       DL++ ++ ++    +K I SRE M++ R  S 
Sbjct: 120 FGPVAAW----DKDSGAIYKVE-----TDLKMAMIMLVLNAAKKPISSREGMKLCRDTST 170

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
            F +W +Q + D  H+   +   +F K+G++ E NAL MHAT   A+PP  Y  KE+ Q 
Sbjct: 171 TFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMHATTKTANPPFSYLTKESYQA 230

Query: 283 MERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           ME V + RQ+    YFT+DAGPN+K+L   K
Sbjct: 231 MEAVKELRQEGFACYFTMDAGPNVKVLCLEK 261


>gi|149241991|pdb|2HKE|A Chain A, Mevalonate Diphosphate Decarboxylase From Trypanosoma
           Brucei
 gi|149241992|pdb|2HKE|B Chain B, Mevalonate Diphosphate Decarboxylase From Trypanosoma
           Brucei
          Length = 380

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 145/300 (48%), Gaps = 21/300 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D + LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEV 70

Query: 84  S-----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                    S        C    +  KV  + E  NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DVGKTPRVQSMLLHLRSTCPEELKNKKVNIVSE--NNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +   + + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AF---KSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +   +   +   I  +AI  +DF    E+A 
Sbjct: 186 MCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +   + ++A++    + +T DAG N   LF  K
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANC-FLFVLK 304


>gi|71749002|ref|XP_827840.1| diphosphomevalonate decarboxylase [Trypanosoma brucei TREU927]
 gi|70833224|gb|EAN78728.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei]
          Length = 382

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 145/300 (48%), Gaps = 21/300 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D + LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEV 70

Query: 84  S-----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                    S        C    +  KV  + E  NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSE--NNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +   + + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AF---KSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +   +   +   I  +AI  +DF    E+A 
Sbjct: 186 MCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +   + ++A++    + +T DAG N   LF  K
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANC-FLFVLK 304


>gi|71749102|ref|XP_827890.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70833274|gb|EAN78778.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 382

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 145/300 (48%), Gaps = 21/300 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D + LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEV 70

Query: 84  S-----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                    S        C    +  KV  + E  NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSE--NNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +   + + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AF---KSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +   +   +   I  +AI  +DF    E+A 
Sbjct: 186 MCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +   + ++A++    + +T DAG N   LF  K
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANC-FLFVLK 304


>gi|241735356|ref|XP_002413928.1| diphosphomevalonate decarboxylase, putative [Ixodes scapularis]
 gi|215507782|gb|EEC17236.1| diphosphomevalonate decarboxylase, putative [Ixodes scapularis]
          Length = 357

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 160/310 (51%), Gaps = 30/310 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITV-IDSDADCIILNG 80
           ++A  P NIA+ KYWGK + +L +P N+SLSL+L   HL   T + V  D   D I LNG
Sbjct: 14  ATARAPVNIAVVKYWGKTNEELIIPANDSLSLTLHIDHLCAKTTVAVGRDFKEDRIWLNG 73

Query: 81  --QKISSQS-----SFFKKTTQFCDLFR----QFSKVYFLIETSNNIPTKAGLASSASGF 129
             ++++++         K++ +F  +       +S  +  I + NN PT AGLASSA+G+
Sbjct: 74  KEERVTTRIQNCLLEIRKRSREFMHMHNTGLPDYSDWHLHICSVNNFPTAAGLASSAAGY 133

Query: 130 AALTLALFRI----YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A L  A F +    Y++     +L  +   GSGSACRS Y GF  W+ G  Q+G DS A 
Sbjct: 134 ACLEWAYFMLLRHKYNV---MRTLHYIPLRGSGSACRSMYGGFVAWLKGLRQDGKDSVAK 190

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAI 242
            +   N WP++R       D +K  GS + ME++   S     + T+ +   +  I +AI
Sbjct: 191 QIAPENHWPEMR----XXFDVKKDTGSTQGMELSMLTSSLLEYRATKVVPQRMKDITEAI 246

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET--IQGMERVWDARQQSIPIYFTL 300
           ++++F K  E+  + + ++HA  +   PP+ Y    +  I  +   ++    +  + ++ 
Sbjct: 247 VNRNFHKFAEITMQESNQLHAVCLDTYPPIRYMNLVSWDIVHLVHRYNRYYGTNKLAYSF 306

Query: 301 DAGPNLKLLF 310
           DAGPN  L  
Sbjct: 307 DAGPNACLFM 316


>gi|300776785|ref|ZP_07086643.1| mevalonate diphosphate decarboxylase [Chryseobacterium gleum ATCC
           35910]
 gi|300502295|gb|EFK33435.1| mevalonate diphosphate decarboxylase [Chryseobacterium gleum ATCC
           35910]
          Length = 352

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 106/337 (31%), Positives = 175/337 (51%), Gaps = 34/337 (10%)

Query: 10  HRYIGECNPKINEKS-SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV 68
             +IG+ N  I+ ++ S   PSNIAL KYWGK   ++  P N S+S +L H  T T +  
Sbjct: 4   QEFIGKENFTIHTQTVSESCPSNIALIKYWGKYADQI--PANPSISYTLNHCKTNTSMEF 61

Query: 69  IDSDADCI--ILNGQKISSQSSFFKKTTQFCDLFRQFS----KVYFLIETSNNIPTKAGL 122
           + ++   +   L G +   +  F +K  ++     Q+     K  ++I T N  P  +G+
Sbjct: 62  VANEPFSVQTFLAGNE---EVKFAEKIEKYFRNIEQYLPWILKGKYIIRTENTFPHSSGI 118

Query: 123 ASSASGFAALTLALFRI-YSIPEKS---ESLSR---VARLGSGSACRSFYRGFCEWICGT 175
           ASSASGF A+   L  +  S  EK+   ESL +   +ARLGSGSACRS Y G   W   T
Sbjct: 119 ASSASGFGAIAKCLMALDASFTEKTSEEESLRKASFLARLGSGSACRSLYNGLVVW-GET 177

Query: 176 DQNGMDSFAVPFNNQWPDLRIG---------LLKIIDREKKIGSREAMEITRHHSPFFTQ 226
           D+  ++  +  F  Q+PD  I          +L I + +K + S     + +  +P+  +
Sbjct: 178 DE--VEESSDLFGVQYPDTEIHEIFKNFNDWVLLIHEGQKSVSSTVGHGLMKT-NPYAER 234

Query: 227 WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV 286
             Q+   +   +K+ + + D  +  ++ E  AL +HA M+ + P  +  +  T++ + ++
Sbjct: 235 RFQEARENFVPMKEILKNGDMERFIKLVEHEALTLHAMMMMSDPAFILMKTGTLEVINKI 294

Query: 287 WDARQQS-IPIYFTLDAGPNLKLLF-THKIEETIKQF 321
           WD R+++  P++FTLDAG N+ LLF  +  EE IK F
Sbjct: 295 WDFRRETGSPLFFTLDAGANVHLLFPNNGSEEQIKAF 331


>gi|261333547|emb|CBH16542.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 382

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 144/300 (48%), Gaps = 21/300 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D   LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTFRLNGTEV 70

Query: 84  S-----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                    S        C    +  KV  + E  NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSE--NNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +   + + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AF---KSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +   +   +   I  +AI  +DF    E+A 
Sbjct: 186 MCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +   + ++A++    + +T DAG N   LF  K
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANC-FLFVLK 304


>gi|319946225|ref|ZP_08020465.1| diphosphomevalonate decarboxylase [Streptococcus australis ATCC
           700641]
 gi|319747607|gb|EFV99860.1| diphosphomevalonate decarboxylase [Streptococcus australis ATCC
           700641]
          Length = 316

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 159/297 (53%), Gaps = 15/297 (5%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSF 89
           +NIA+ KYWGK +S+  +P  +S+SL+L ++ T T ++ +  +A         +    + 
Sbjct: 12  ANIAIIKYWGKENSEAMVPSTSSISLTLENMYTETRLSPLGPEAKSHAFFIDGVFQNEAE 71

Query: 90  FKKTTQFCDLFRQFSKVYFL-IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSES 148
             K     D F+   +  F+ ++TSNN+PT AGL+SS+SG +AL  A    Y +      
Sbjct: 72  QAKIGAVIDRFKPEGETGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNCYYQLGMTQAE 131

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII--DREK 206
            ++ A+  SGS+ RSF+     W    D++  + + V       DL++ ++ ++  D++K
Sbjct: 132 QAQAAKFASGSSSRSFFGPLAAW----DKDTGEIYQVE-----TDLKLAMIMLVLNDQQK 182

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
            + SRE M+     S  F +W +Q + D   +   + D DF K+GE+ E+NAL MH+T  
Sbjct: 183 ILSSREGMKRCTETSSNFQEWIRQSAQDYQDMLAYLKDNDFEKVGELTERNALLMHSTTK 242

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
            ASP   Y   ++ + ME V   R +    YFT+DAGPN+K+L    +EE + Q  P
Sbjct: 243 TASPAFSYLTDKSYEAMEFVRSLRNEGKRCYFTMDAGPNVKVLC---LEEDLDQLVP 296


>gi|326469867|gb|EGD93876.1| diphosphomevalonate decarboxylase [Trichophyton tonsurans CBS
           112818]
          Length = 380

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/326 (31%), Positives = 153/326 (46%), Gaps = 45/326 (13%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS------DADCI 76
           ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L       + T   S      D D +
Sbjct: 11  RASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSAKYPPADGDSL 70

Query: 77  ILNGQKISSQSSFFKKTTQFCDL--FRQF-----------SKVYFLIETSNNIPTKAGLA 123
            LN +  S Q S  +      DL   RQ            S     I + NN PT AGLA
Sbjct: 71  TLNNKPHSIQGSP-RTLACLADLRSLRQLIESSDPSLPKLSTYPLRIVSENNFPTAAGLA 129

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+      +  +G    
Sbjct: 130 SSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYPLARDASSYSG---- 185

Query: 184 AVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAI 242
                 QW              K++ S E M++T   S  F    Q I  + +  I+++I
Sbjct: 186 -----GQW-----------CHRKEVPSSECMQLTVATSTLFPSRAQSIVPERMTAIEKSI 229

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD---ARQQSIPIYFT 299
            +++F    E+  +++   HAT +   PP  Y    +   +  V D   A  +S+  Y T
Sbjct: 230 QERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDLNRAAGRSVCAY-T 288

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEI 325
            DAGPN  + +  K  + +   F  I
Sbjct: 289 FDAGPNAVIYYLEKDADCVLGAFKSI 314


>gi|261333631|emb|CBH16626.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 382

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/300 (29%), Positives = 145/300 (48%), Gaps = 21/300 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D + LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEV 70

Query: 84  S-----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                    S        C    +  KV  + E  NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DVGKTPRVQSMLLHLRITCPEDLKNKKVNIVSE--NNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +   + + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AF---KSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI-KQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +   +   +   I  +AI  +DF    E+A 
Sbjct: 186 MCAILKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGME--RVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +   + ++A++    + +T DAG N   LF  K
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANC-FLFVLK 304


>gi|325954729|ref|YP_004238389.1| diphosphomevalonate decarboxylase [Weeksella virosa DSM 16922]
 gi|323437347|gb|ADX67811.1| diphosphomevalonate decarboxylase [Weeksella virosa DSM 16922]
          Length = 354

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 162/317 (51%), Gaps = 32/317 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV---IDSDADCIILNGQKISS 85
           PSNIAL KYWGKR++++  P N S+S +L +  T T +       +D D  +   + + +
Sbjct: 25  PSNIALIKYWGKRENQI--PTNASISYTLTNSYTETELKFEPKSGNDFDVKVFLDKNLQT 82

Query: 86  QSS-----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
             +     FF++   +    R+F    F + T N+ P  +G+ASSASG +A+   L ++ 
Sbjct: 83  NFAPKIIQFFERIEAYMPFLRRFR---FEVHTHNSFPHSSGIASSASGMSAMANCLIKME 139

Query: 141 SI-------PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ---NGMDSFAVPFNNQ 190
            +        +     S +ARLGSGSACRS Y+G   W  G ++   N  + +A+ + NQ
Sbjct: 140 KLLGSSLNEEQAHRKASFLARLGSGSACRSTYKGLVVW--GENKALPNSSNLYAIKYPNQ 197

Query: 191 -----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
                +      +L I + EK + S    ++   H P+  +   + + +L  +   + + 
Sbjct: 198 QIHSVFIHFHDTILLIHEGEKSVSSTVGHQLMDRH-PYAEKRFIEANKNLEKLLPILKNG 256

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGP 304
           D    G++ E  AL +HA M+ + P  +  + +T+  ++ +W  R+++  P++FTLDAG 
Sbjct: 257 DVFAFGKMVEHEALTLHAMMMTSDPAFMLMKPQTVAAIDSIWAYRKKTGNPLFFTLDAGA 316

Query: 305 NLKLLFTHKIEETIKQF 321
           N+ LL+   I + + +F
Sbjct: 317 NIHLLYPDDIAKEVHEF 333


>gi|332519093|ref|ZP_08395560.1| GHMP kinase [Lacinutrix algicola 5H-3-7-4]
 gi|332044941|gb|EGI81134.1| GHMP kinase [Lacinutrix algicola 5H-3-7-4]
          Length = 360

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 160/316 (50%), Gaps = 29/316 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT------VIDSDADCIILNGQK 82
           PSNIAL KYWGK++ ++  P N S+S +L    TIT +         +S    + L+G++
Sbjct: 25  PSNIALVKYWGKKEHQI--PENQSISFTLSDCKTITKLKYEAKAKTTNSFDFQVYLDGER 82

Query: 83  ISSQSSFFKKTTQFCDLFRQF----SKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  F  K   F +  +Q+      + F IET N  P  +G+ASSASG +AL L L  
Sbjct: 83  ---KPDFEPKIEVFFNRIQQYFPFLKTLKFTIETENTFPHSSGIASSASGMSALALCLMS 139

Query: 139 IYSI--PEKSESL-----SRVARLGSGSACRSFYRGFCEWICGTD-QNGMDSFAVPF--- 187
           I     PE +ES      S +ARLGSGSACRS       W    + +N  D + V +   
Sbjct: 140 IEKQLNPEITESYFNKKASFIARLGSGSACRSIQGDLVVWGAHNEIENSSDLYGVKYPYQ 199

Query: 188 -NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
            ++ + + +  +L +   EK++ S     +   H PF  Q  +Q + +++ IK  +   D
Sbjct: 200 VHDNFKNYQDTILLVDKGEKQVSSTVGHNLMHGH-PFAKQRFKQANNNISEIKNILKSGD 258

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPN 305
                 + E  AL +HA M+ + P  +  +  T++ + ++W  R+ + + I FTLDAG N
Sbjct: 259 LKAFIALVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWSFRKATNLNICFTLDAGAN 318

Query: 306 LKLLFTHKIEETIKQF 321
           + +L+  K +E I +F
Sbjct: 319 VHILYPEKEKEQILEF 334


>gi|298709542|emb|CBJ48557.1| Diphosphomevalonate decarboxylase [Ectocarpus siliculosus]
          Length = 433

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 152/303 (50%), Gaps = 26/303 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNG--QKI 83
           P+NIA+ KYWGK    LN P+N+S S++L    L  IT +    D + D + LNG  + +
Sbjct: 16  PTNIAVIKYWGKDSVALNTPINSSASVTLSQDDLRAITTVAASKDFEKDQLWLNGTEEDV 75

Query: 84  SSQSSFFKKTTQFCDLFRQ---------------FSKVYFLIETSNNIPTKAGLASSASG 128
           S    F     Q   L  +               + +    I + N  PT AGLASSA+G
Sbjct: 76  SKNKRFQAVIRQVRALATEKRDEATGEVVVAEGDWDQYRVRIASRNTFPTAAGLASSAAG 135

Query: 129 FAALTLALFRIYSIPEKSES-LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
            A LT +L ++++  E  +  LS +AR GSGSACRS Y GF +W  G  ++  DS AV  
Sbjct: 136 LACLTFSLAKLFNAKESFDGELSSIARQGSGSACRSLYGGFVKWQKGVREDARDSIAVQV 195

Query: 188 NNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIID 244
            ++  WP++R  +L +   +K   S   M  +   SP    +  + +   LA I++A ++
Sbjct: 196 ADEHHWPEMRALILVVSADKKDTSSTSGMSTSVQTSPLLGFRAKEVVEPRLAEIEKAYLE 255

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQ--KETIQGMERVWDARQQSIPIYFTLDA 302
           +DF   G++  +++ + HAT +   PP+ Y      ++  +   ++A    I   +T DA
Sbjct: 256 KDFATFGKITMQDSNQFHATCLDTYPPIFYMNDVSRSVIRIVHAYNAFHGEIRAAYTFDA 315

Query: 303 GPN 305
           GPN
Sbjct: 316 GPN 318


>gi|223994695|ref|XP_002287031.1| mevalonate disphosphate decarboxylase-like protein [Thalassiosira
           pseudonana CCMP1335]
 gi|220978346|gb|EED96672.1| mevalonate disphosphate decarboxylase-like protein [Thalassiosira
           pseudonana CCMP1335]
          Length = 346

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 161/339 (47%), Gaps = 37/339 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA  KYWGK  SK N P+N+SLSL+L    L  +T      S   D + LNG +   
Sbjct: 9   PTNIACIKYWGKASSKYNTPINSSLSLTLDQSDLRAVTTAAASTSFTKDRLWLNGSE--E 66

Query: 86  QSSFFKKTTQFC-DLFR-------------------QFSKVYFLIETSNNIPTKAGLASS 125
            ++F  K  + C D  R                   Q+  ++  + + N  PT AGLASS
Sbjct: 67  ANAFTSKRFRACIDGLRALATDKVDPTTNEVIVSKSQWQSMHVHVASYNTFPTAAGLASS 126

Query: 126 ASGFAALTLALFRIYSIPEKSES-LSRVARLGSGSACRSFYRGFCEWIC-GTDQNGMDSF 183
           A+G+AAL  +L  +Y+  E      + +AR GSGSACRS Y GF  W   G  ++  DS 
Sbjct: 127 AAGYAALVASLVELYNAKESYPGEFTAIARQGSGSACRSLYGGFVAWRAGGMKEDWSDSI 186

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQ 240
           A  V     W ++R  +L + D +K+  S   ME +   S       ++I    +  I+ 
Sbjct: 187 AEQVADEMHWKEMRAVILVVSDAKKETSSTVGMETSVATSELLAHRAKEIVPKRMKIIED 246

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIY 297
           AI  +DF   G+V   ++ + HAT +   PP+ Y     +  IQ + R ++     I   
Sbjct: 247 AIQAKDFEAFGKVTMMDSNQFHATCLDTYPPIFYMNDVSRSVIQMVTR-YNEWAGEIRAA 305

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           +T DAGPN  L   + +++ + +    +    P  SP+L
Sbjct: 306 YTFDAGPNAVL---YTLDKYVVELLALVLKHYPAQSPEL 341


>gi|163787351|ref|ZP_02181798.1| hypothetical protein FBALC1_02392 [Flavobacteriales bacterium
           ALC-1]
 gi|159877239|gb|EDP71296.1| hypothetical protein FBALC1_02392 [Flavobacteriales bacterium
           ALC-1]
          Length = 364

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 156/318 (49%), Gaps = 31/318 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC----IILNGQKIS 84
           PSNIAL KYWGK++ +  +P N S+S +L +  TIT +T      +     +   G+K  
Sbjct: 25  PSNIALVKYWGKKEHQ--IPENPSISFTLSNCKTITEVTYTKKVGEGFSFDVYFEGEKNE 82

Query: 85  S----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +      +FF++   +    R +   +F IETSN  P  +G+ASSASG +A+ L L  I 
Sbjct: 83  AFKPKIQTFFERIEVYVPFLRDY---HFKIETSNTFPHSSGIASSASGMSAIALCLMSIE 139

Query: 141 ---------SIPEKS---ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
                    S  EKS   +  S +ARLGSGSACRS       W         D F V + 
Sbjct: 140 QKLSDTVISSAAEKSHFNQKASFLARLGSGSACRSIEGELVVWGKNESTESSDLFGVKYE 199

Query: 189 NQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            +    + + +  +L +   EK++ S    ++   H PF  +   Q   +LA +K  +  
Sbjct: 200 GEVHTNFKNYQDTILLVDKGEKQVSSTVGHKLMFGH-PFAKERFAQAHDNLAKLKSILTS 258

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP-IYFTLDAG 303
            D     ++ E  AL +HA M+ + P  +  +  T++ + ++W  R+++   + FTLDAG
Sbjct: 259 GDLKAFVKIVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWKFREENDSNVCFTLDAG 318

Query: 304 PNLKLLFTHKIEETIKQF 321
            N+ +L+    ++T+  F
Sbjct: 319 ANVHVLYPENEKQTVLDF 336


>gi|322790718|gb|EFZ15462.1| hypothetical protein SINV_01729 [Solenopsis invicta]
          Length = 339

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 140/271 (51%), Gaps = 24/271 (8%)

Query: 70  DSDADCIILNGQK-----ISSQSSF--FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGL 122
           D   DCI LNG++     I  Q+     +K +Q  D    + K++  I + NN PT AGL
Sbjct: 5   DFKEDCIWLNGREEDIKNIRLQNCLKEIRKRSQLSDYINDW-KIH--ICSKNNFPTAAGL 61

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+G+A LT AL ++Y I      +S +AR GSGSACRS   GF  W  G+D+ G DS
Sbjct: 62  ASSAAGYACLTAALAKLYKI---EGDISIIARSGSGSACRSVMGGFVRWQMGSDKYGTDS 118

Query: 183 FA---VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAH-I 238
            A   VP  + WP++RI +L + D +KK+ S   M  +   S       + +  + A+ +
Sbjct: 119 LAKQIVP-TSYWPEMRILILVVNDEQKKVPSAIGMRRSIETSELLKYRIKHVVPERANKM 177

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK--ETIQGMERVWDARQQSIPI 296
           +QAII++DF    E+  K++ + HA  +   PP +Y      +I  +   ++     + I
Sbjct: 178 QQAIIEKDFKSFAELTMKDSNQFHAVCLDTYPPCIYTNDISNSIMNLVHSYNDAVNDVKI 237

Query: 297 YFTLDAGPNLKLLFTHK----IEETIKQFFP 323
            +T DAGPN  L    K    +   +  FFP
Sbjct: 238 AYTYDAGPNATLYLLEKDVPAVIGVLDYFFP 268


>gi|91078238|ref|XP_970108.1| PREDICTED: similar to diphosphomevalonate decarboxylase [Tribolium
           castaneum]
 gi|270003930|gb|EFA00378.1| hypothetical protein TcasGA2_TC003224 [Tribolium castaneum]
          Length = 385

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 100/322 (31%), Positives = 154/322 (47%), Gaps = 26/322 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQ 81
           +   P NIA+ KYWGKRD  L LP+N+SLS +L         T++ S         LNG+
Sbjct: 5   TGIAPVNIAVVKYWGKRDEDLILPINDSLSCTLSTDFMCAKTTIMASPTFPTHRFWLNGK 64

Query: 82  KI--------SSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           +         +  +   K+    C     +      I + NN PT AGLASSA+G+AAL 
Sbjct: 65  ESDFNNERLNNCLTEIRKRANPKCGDLLNWK---LHICSENNFPTAAGLASSAAGYAALV 121

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQW 191
             L  +Y++      +S +AR GSGSACRS Y GF  W  G    G DS A  +   + W
Sbjct: 122 STLSALYNV---EGDISAIARRGSGSACRSIYGGFVRWNKGAKPGGEDSIACQIASASHW 178

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDFIKL 250
           P++R+ +L + D +KK  S   M+ +   S       ++I    +  I +AI  ++F   
Sbjct: 179 PEMRVLILVVSDDQKKYSSTSGMKQSVLTSELLKHRAEKIVPGRVDEIIKAIKLKNFEAF 238

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKL 308
            ++  +++ + HA  +   PP  Y    +   +E V  ++  Q +  + +T DAGPN  L
Sbjct: 239 AKITMQDSNQFHAICLDTYPPCFYMNDVSRMIIELVHAYNDYQGATKVAYTFDAGPNACL 298

Query: 309 -LFTHKIEET---IKQFFPEIT 326
            L  + ++E    I   FP  T
Sbjct: 299 YLLQNDVDEVASLINDIFPSNT 320


>gi|190345161|gb|EDK36997.2| hypothetical protein PGUG_01095 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 297

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 140/264 (53%), Gaps = 13/264 (4%)

Query: 102 QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSAC 161
           Q SK    I + NN PT AGLASSA+GFAAL +A+ +++ +P+    +S++AR GSGSAC
Sbjct: 10  QLSKWKLHIVSENNFPTAAGLASSAAGFAALVVAIAKLFKLPQDMSEISKIARKGSGSAC 69

Query: 162 RSFYRGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRH 219
           RS + G+  W  G  +NG DS AV     + WP ++  +L + D +K   S   M+ T  
Sbjct: 70  RSLFGGYVAWEMGDLENGEDSKAVEVAPVSHWPTMKAAILVVSDDKKDTPSTSGMQTTVA 129

Query: 220 HSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW--- 275
            S  F    +  +      +K++I D++F   G++  +++   HA  + + PP+ Y    
Sbjct: 130 TSDLFEHRIKNVVPARFEEMKKSIHDKNFEVFGKLTMQDSNSFHAVCLDSYPPIFYLTDT 189

Query: 276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET----IKQFFPEITIIDPL 331
            K+ I+ + ++ DA  + I  Y T DAGPN  + +  + E      I + F  I   D +
Sbjct: 190 SKKIIKLVHQLNDAEGKIIAAY-TFDAGPNAVIYYEQQNESKVLGLIHKHFSSIPGWDKV 248

Query: 332 DSPDLWSTKDSLSQKNSIELGISK 355
           D+  L  T D  + +N I  G+SK
Sbjct: 249 DTSKL-ETVDIAADEN-IHKGVSK 270


>gi|325285752|ref|YP_004261542.1| diphosphomevalonate decarboxylase [Cellulophaga lytica DSM 7489]
 gi|324321206|gb|ADY28671.1| diphosphomevalonate decarboxylase [Cellulophaga lytica DSM 7489]
          Length = 360

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 156/316 (49%), Gaps = 29/316 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADC----IILNGQK 82
           PSNIAL KYWGK+++++  P N S+S +L    T T +T   +DS AD     +   G+ 
Sbjct: 25  PSNIALVKYWGKKENQI--PANPSISFTLDACATTTSVTYKKLDSKADNFSFDLFFEGK- 81

Query: 83  ISSQSSFFKKTTQF---CDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  F  K   F    + +  F K Y F IETSN+ P  +G+ASSASG +AL L L  
Sbjct: 82  --PKEDFKPKIETFLTRIEAYLPFIKEYHFKIETSNSFPHSSGIASSASGMSALALCLMS 139

Query: 139 IYSIPEKS-------ESLSRVARLGSGSACRSFYRGFCEWICGTDQNG-MDSFAVPFNNQ 190
           +      S          S +ARLGSGSACRS      +W    +  G  D F + + N+
Sbjct: 140 VEKELNPSITTAFFNNKASFLARLGSGSACRSIEGPLVQWGNHANTKGSTDLFGIKYPNE 199

Query: 191 ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
               + +    +L +   +K++ S     +  +H PF  +   Q  T+L  ++    + +
Sbjct: 200 VHSVFKNYHDTILLVDKGQKQVSSTVGHNLMHNH-PFAKERFAQAHTNLDELQTVFKEGN 258

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-QSIPIYFTLDAGPN 305
             +  E+ E  AL +HA M+ + P  +  +  T+Q + ++W+ R      I FTLDAG N
Sbjct: 259 LKRFVEIVESEALTLHAMMMTSMPYFILMKPNTLQIINKIWEFRAINKSNICFTLDAGAN 318

Query: 306 LKLLFTHKIEETIKQF 321
           + +L+    +E + QF
Sbjct: 319 VHVLYPENEKEVVYQF 334


>gi|258544713|ref|ZP_05704947.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Cardiobacterium hominis ATCC 15826]
 gi|258520032|gb|EEV88891.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Cardiobacterium hominis ATCC 15826]
          Length = 126

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (67%), Gaps = 2/109 (1%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG 80
            E  +A+ P+NIAL KYWGKRD  LNLPLN SLS+SLG LG  TH TV  +  D I LNG
Sbjct: 20  GESGAAYAPANIALAKYWGKRDRALNLPLNGSLSISLGALG--THTTVRAAANDRITLNG 77

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGF 129
              ++ S+  ++T  + DL+R+ +     +ET+N IPT AGLASSASGF
Sbjct: 78  TDAAADSTLHRRTFAYIDLWRRGAAQPLHVETTNTIPTAAGLASSASGF 126


>gi|146423582|ref|XP_001487718.1| hypothetical protein PGUG_01095 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 297

 Score =  115 bits (289), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 140/264 (53%), Gaps = 13/264 (4%)

Query: 102 QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSAC 161
           Q SK    I + NN PT AGLASSA+GFAAL +A+ +++ +P+    +S++AR GSGSAC
Sbjct: 10  QLSKWKLHIVSENNFPTAAGLASSAAGFAALVVAIAKLFKLPQDMSEISKIARKGSGSAC 69

Query: 162 RSFYRGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRH 219
           RS + G+  W  G  +NG DS AV     + WP ++  +L + D +K   S   M+ T  
Sbjct: 70  RSLFGGYVAWEMGDLENGEDSKAVEVAPVSHWPTMKAAILVVSDDKKDTPSTSGMQTTVA 129

Query: 220 HSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW--- 275
            S  F    +  +      +K++I D++F   G++  +++   HA  + + PP+ Y    
Sbjct: 130 TSDLFEHRIKNVVPARFEEMKKSIHDKNFEVFGKLTMQDSNSFHAVCLDSYPPIFYLTDT 189

Query: 276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET----IKQFFPEITIIDPL 331
            K+ I+ + ++ DA  + I  Y T DAGPN  + +  + E      I + F  I   D +
Sbjct: 190 SKKIIKLVHQLNDAEGKIIAAY-TFDAGPNAVIYYEQQNESKVLGLIHKHFSLIPGWDKV 248

Query: 332 DSPDLWSTKDSLSQKNSIELGISK 355
           D+  L  T D  + +N I  G+SK
Sbjct: 249 DTSKL-ETVDIAADEN-IHKGVSK 270


>gi|74692165|sp|Q751D8|MVD1_ASHGO RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
          Length = 372

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 100/327 (30%), Positives = 155/327 (47%), Gaps = 36/327 (11%)

Query: 45  LNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNGQKISSQSSFFKKTTQFC---- 97
           LNLP N+S+S++L    L T+T   T  +   D + LNG+      S     TQ C    
Sbjct: 2   LNLPTNSSISVTLSQEDLRTLTSAATGPELAEDRLWLNGKP----ESLGNARTQQCLADL 57

Query: 98  ------------DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
                       DL R  S+    I + NN PT AGLASSA+GFAAL +A+ ++Y +P+ 
Sbjct: 58  RALRRALETEEPDLPR-MSEWKLHIVSENNFPTAAGLASSAAGFAALVVAVAKLYGLPQD 116

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIID 203
              +S++AR GSGSACRS Y G+  W  G + +G DS AV   +   WP++R  +L +  
Sbjct: 117 YSEISKIARKGSGSACRSLYGGYVAWEMGAEADGSDSRAVQIADVEHWPEMRAAILVVSA 176

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             K   S   M+ T H S  F +     +      +  AI  +DF     +  +++   H
Sbjct: 177 DRKDTPSTSGMQQTVHTSDLFKERVATVVPRRYGEMAAAIRARDFATFARLTMQDSNSFH 236

Query: 263 ATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           AT + + PP+ Y     +  ++    + +   ++I + +T DAGPN  L +  + E  + 
Sbjct: 237 ATCLDSFPPIFYMNDTSRRIVKLCHLINEFYNETI-VAYTFDAGPNAVLYYLAENEARLC 295

Query: 320 QFFPEITIIDPLDSPDLWSTKDSLSQK 346
            F   +       + D W T  S  Q+
Sbjct: 296 GFLSAV-----FGANDGWETTFSTEQR 317


>gi|226487404|emb|CAX74572.1| putative Diphosphomevalonate decarboxylase [Schistosoma japonicum]
 gi|226487406|emb|CAX74573.1| putative Diphosphomevalonate decarboxylase [Schistosoma japonicum]
          Length = 391

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 110/355 (30%), Positives = 170/355 (47%), Gaps = 46/355 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDSDADCIILNGQKISSQ 86
           P NIAL KYWGK D     PL +S+SL+L   H+G+ T +            NG K  SQ
Sbjct: 8   PVNIALLKYWGKVDELNIFPLTSSISLTLNQSHVGSRTTV---------FTKNGLK-QSQ 57

Query: 87  SSFFKKTTQF----CDLF-----------RQFSKVYFLIETSNNIPTKAGLASSASGFAA 131
                + TQF     D+            +  +  +  +ET NN PT AGLASSASG AA
Sbjct: 58  FKLNGRVTQFPPRLLDVLIIAQLRSRLHGKHIASPFICVETENNFPTAAGLASSASGTAA 117

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NN 189
              AL ++YS+       +  +R GSGS+CRS   GF  W          SF      ++
Sbjct: 118 FAFALGKMYSL---DGDYTSFSRRGSGSSCRSLSGGFVLWSSNRGDYLHPSFVQQLFPSS 174

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII---DQD 246
            WP+L++ +  + +  K IGS +AM    + S  F   + ++ +   H KQAI    ++D
Sbjct: 175 HWPELKVLICVVNEHSKHIGSTDAMLNCVNTSDLFR--SGRVLSAKIHEKQAISALRERD 232

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME---RVWDARQQSIPIYFTLDAG 303
           F  L EV  + + ++HA  +   PP ++    +   M+   R+    ++S+ + +T DAG
Sbjct: 233 FSALAEVTMRESNQLHAVCLDTWPPCVFLNHLSYSIMDFVHRINKYFKKSV-VAYTFDAG 291

Query: 304 PNLKLLF-THKIEETIKQ----FFPEITIIDPLDSPDLWSTKDSLSQKNSIELGI 353
           PN  LL  +H IE  +K     F   + + D +++ D ++ +   S K    +GI
Sbjct: 292 PNAFLLTESHNIENILKYLVECFGRTVGVGDSMNTTDKFTVQCRDSNKYLKVIGI 346


>gi|146299149|ref|YP_001193740.1| GHMP kinase [Flavobacterium johnsoniae UW101]
 gi|146153567|gb|ABQ04421.1| GHMP kinase [Flavobacterium johnsoniae UW101]
          Length = 368

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 165/329 (50%), Gaps = 36/329 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC-----------II 77
           PSNIAL KYWGK+++++  P N S+S +L +  TIT ++    DA             ++
Sbjct: 26  PSNIALVKYWGKKENQI--PANPSVSFTLNNCKTITKLSFSKKDASTSLNVTNSFSFDLL 83

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLAL 136
             G+         +K  +  +++  F K Y F I+T N  P  +G+ASSASG AAL +  
Sbjct: 84  FEGKPKEDFKPKIQKFLERVEVYLPFLKEYHFTIDTQNTFPHSSGIASSASGMAALAMNF 143

Query: 137 FRIYSI--PEKSESL-----SRVARLGSGSACRSFYRGFCEWICGTDQNG-MDSFAVPF- 187
             +     PE ++       S +ARLGSGSACRS       W    +  G  D F V F 
Sbjct: 144 MSLERKLNPEMADDYFYQKASFLARLGSGSACRSVKGNVVVWGNQANIEGSTDLFGVEFP 203

Query: 188 ---NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF----FTQWTQQISTDLAHIKQ 240
              +  + + +  +L +   EK++ S    ++  +H P+    F Q  + +   +A  ++
Sbjct: 204 YTIHENFKNYQDTILLVDKGEKQVSSTVGHDLMHNH-PYAERRFAQAHENLDKLIAIFEK 262

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
             +++ FIK   V E  AL +HA M+ + P  +  +  T+Q +  +W  R ++ IP+ FT
Sbjct: 263 GNLNE-FIK---VVESEALTLHAMMMTSMPYFILMKPNTLQIINAIWKFRNETQIPVCFT 318

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITII 328
           LDAG N+ +L+   ++E + QF  +  ++
Sbjct: 319 LDAGANVHVLYPENVKEKVLQFIQDELVV 347


>gi|91215117|ref|ZP_01252089.1| hypothetical protein P700755_12507 [Psychroflexus torquis ATCC
           700755]
 gi|91186722|gb|EAS73093.1| hypothetical protein P700755_12507 [Psychroflexus torquis ATCC
           700755]
          Length = 355

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 106/335 (31%), Positives = 163/335 (48%), Gaps = 31/335 (9%)

Query: 12  YIGECNPKINE--KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV- 68
           +I +  P + E  K S+  PSNIAL KYWGK   +L  P N S+S +L    T T + + 
Sbjct: 6   FIYKVTPVLPELGKYSSEAPSNIALVKYWGKYGEQL--PKNTSISYTLEDCKTKTEVVLK 63

Query: 69  --IDSDADC---IILNGQKISS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTK 119
             I +D      +   G++ +S      +F K+   +    + F    F I T N  P  
Sbjct: 64  KKIKADDQFHFEVFFEGKRKASFEPKIETFLKRIETYVPFLKSFE---FEIHTENTFPHS 120

Query: 120 AGLASSASGFAALTLALFRI-YSI-PEKS-----ESLSRVARLGSGSACRSFYRGFCEWI 172
           +G+ASSASG AAL     +I  S+ PE S        S +ARLGSGSACRS       W 
Sbjct: 121 SGIASSASGMAALAKCFMKIEVSVSPEISNLYLEHKTSFLARLGSGSACRSTGGKLVVWG 180

Query: 173 CGTDQNGMDSFA---VPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
              +  G  SF     P++    +   R  +L I + +K++ S     +  +H PF  Q 
Sbjct: 181 EHKEIEGSSSFYGIDYPYDVHPNFRSFRDSILLIDEGQKQVSSSLGHNLMHNH-PFAEQR 239

Query: 228 TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW 287
            QQ   ++  +K  +I  D+     + E  AL +HA M+ +SP  +  Q  T+Q +E++ 
Sbjct: 240 FQQADENILKLKSILISGDYEAFFALVESEALSLHAMMMTSSPYFILMQPNTLQVIEKIC 299

Query: 288 DAR-QQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
             R ++++ + FTLDAG N+ LL+    E  ++ F
Sbjct: 300 KFRKEENVYLGFTLDAGANVHLLYPESSETMVRPF 334


>gi|86142061|ref|ZP_01060585.1| diphosphomevalonate decarboxylase [Leeuwenhoekiella blandensis
           MED217]
 gi|85831624|gb|EAQ50080.1| diphosphomevalonate decarboxylase [Leeuwenhoekiella blandensis
           MED217]
          Length = 360

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 101/320 (31%), Positives = 162/320 (50%), Gaps = 37/320 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI-----TVIDSDADC-IILNGQK 82
           PSNIAL KYWGK    + +P N S+S +L +  T T +     T  D   D  +IL+G+ 
Sbjct: 25  PSNIALIKYWGKHG--VQIPKNPSISFTLNNCKTTTKLSFEKRTNFDEAYDLKVILDGKH 82

Query: 83  ISSQSSFFKKTTQF---CDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  F  K  QF    D +  F K Y F I+T+N+ P  +G+ASSASG +AL L L  
Sbjct: 83  ---KPGFEPKIHQFFGRIDEYLPFIKEYRFTIDTTNSFPHSSGIASSASGLSALALCLME 139

Query: 139 IYSIPEKSESLSR-------VARLGSGSACRSFYRGFCEWICGTDQNG-MDSFAVPFNNQ 190
           +        SL R       +ARLGSGS CRS       W    D  G  D + V    Q
Sbjct: 140 MEREMHPEMSLKRFNQKASFIARLGSGSGCRSLEGPLVVWGEHADIEGSSDVYGV----Q 195

Query: 191 WP-------DLRIGLLKIIDR-EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAI 242
           +P       D     + ++D+ EK + S     +  +H+   +++ Q +  +LA +   +
Sbjct: 196 YPYEVHSVFDHYQDTILLVDKGEKPVSSTVGHNLMHNHAYAASRFDQAVE-NLALLVPIL 254

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLD 301
            + +  +   + E  AL +HA M+ + P  +  +  T++ ++++W+ R+  SIP+ FTLD
Sbjct: 255 KEGNLDEFVSLVESEALTLHAMMLTSKPYFILMKPNTLKIIDKIWEYRRDTSIPVCFTLD 314

Query: 302 AGPNLKLLFTHKIEETIKQF 321
           AG N+ +L+  K +E +++F
Sbjct: 315 AGANVHVLYPKKDKEAVQEF 334


>gi|313206136|ref|YP_004045313.1| ghmp kinase [Riemerella anatipestifer DSM 15868]
 gi|312445452|gb|ADQ81807.1| GHMP kinase [Riemerella anatipestifer DSM 15868]
 gi|315022943|gb|EFT35966.1| diphosphomevalonate decarboxylase [Riemerella anatipestifer RA-YM]
 gi|325336419|gb|ADZ12693.1| diphosphomevalonate decarboxylase [Riemerella anatipestifer RA-GD]
          Length = 352

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 102/344 (29%), Positives = 164/344 (47%), Gaps = 43/344 (12%)

Query: 8   ILHRYIGECNPKI-NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI 66
           +L +++G  N ++ N + S   PSNIAL KYWGK   ++  P N S+S +L +  T T+I
Sbjct: 1   MLEQFLGTPNFEVKNIQVSETCPSNIALIKYWGKYAQQI--PANPSISFTLNNAKTTTNI 58

Query: 67  TVIDSDADCIILNGQKISSQSSFF--KKTTQFCDLFRQFSKVY-----------FLIETS 113
                     + N  K     ++   K+ TQF     ++ K             + I T 
Sbjct: 59  ----------VFNANKPFGVKTYLAGKEETQFSSKIEKYFKTIESYLPWILSGSYEIRTE 108

Query: 114 NNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL--------SRVARLGSGSACRSFY 165
           N  P  +G+ASSASGF A+   L +I     K  +         S +ARLGSGSACRS Y
Sbjct: 109 NTFPHSSGIASSASGFGAIAKCLMKIDEAFSKEATTHDFRLKKASFLARLGSGSACRSLY 168

Query: 166 RGFCEWICGTDQNGM-DSFAVPFNNQ-----WPDLRIGLLKIIDREKKIGSREAMEITRH 219
            G   W    +  G  D FAVP+  +     +      +L I + +K + S     +  +
Sbjct: 169 NGLVVWGETPEVEGSSDLFAVPYTTEEVAEVFRKFNDWVLLIHEGQKSVSSTIGHGLM-N 227

Query: 220 HSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET 279
            +P+  +  Q+   +   +K+ +   D  K   + E  AL +HA M+ + P  +  +  T
Sbjct: 228 TNPYAERRFQEARENFVPLKEILKSGDLEKFITLVEHEALTLHAMMMMSEPAFILMKTGT 287

Query: 280 IQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIE-ETIKQF 321
           ++ + ++W+ R+ + +P++FTLDAG N+ LLF    E E I  F
Sbjct: 288 LEVINKIWEFRKSTGLPLFFTLDAGANVHLLFPENQETEKITAF 331


>gi|309807498|ref|ZP_07701458.1| putative diphosphomevalonate decarboxylase [Lactobacillus iners
           LactinV 01V1-a]
 gi|308169263|gb|EFO71321.1| putative diphosphomevalonate decarboxylase [Lactobacillus iners
           LactinV 01V1-a]
          Length = 204

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 102/174 (58%), Gaps = 6/174 (3%)

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI-ID-R 204
           + LSR+ARLGSGSA RS + GF EW  G D     SFA P N + P + + +L + +D  
Sbjct: 6   QELSRIARLGSGSATRSIFGGFVEWQKGYDD--QTSFAFPIN-EHPQMDLTMLAVELDVS 62

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I S   M+I +  SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH+ 
Sbjct: 63  QKDISSTCGMKIAQT-SPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMHSL 121

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
            + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I
Sbjct: 122 NLTAMQSFSYFQSTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDI 175


>gi|119953464|ref|YP_945673.1| diphosphomevalonate decarboxylase [Borrelia turicatae 91E135]
 gi|119862235|gb|AAX18003.1| diphosphomevalonate decarboxylase [Borrelia turicatae 91E135]
          Length = 312

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 152/291 (52%), Gaps = 16/291 (5%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI---SSQS 87
           ++AL KYWGKRD  LN+P  +S+++S+    +I+ + +  S  D IILN + +     + 
Sbjct: 10  SLALIKYWGKRDKFLNIPATSSIAVSVDKFYSISELEL--SCKDEIILNSRVVVLSDREI 67

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
           +FF    +  +       V F + + NN PT AGLASS+SGFA++   + R ++     +
Sbjct: 68  NFFNHARKILNK----PNVGFRVISENNFPTSAGLASSSSGFASIAACILRYFN-QYSHQ 122

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
             S++AR+GS SA R+ Y GF        +    SF +   N + DL I    +  R+K+
Sbjct: 123 KASQLARIGSASASRAIYGGFTL----LKEGAKSSFQLDSFNCFSDLCIIFAIVDGRKKE 178

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I SR AMEI +    ++  W +             +  DF   G    K+   M + M++
Sbjct: 179 ISSRVAMEICKQDKFYWDAWIESSRNIFKEALYFFLKGDFNGFGLKIVKSYQCMFSLMLS 238

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +S  ++Y++  TI+ ++ + D R + +P++ T+DAGP +K+L   K  E I
Sbjct: 239 SS--IIYFKSNTIELIKYIADLRSKGVPVFETMDAGPQVKVLCLKKDLELI 287


>gi|255535993|ref|YP_003096364.1| Diphosphomevalonate decarboxylase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342189|gb|ACU08302.1| Diphosphomevalonate decarboxylase [Flavobacteriaceae bacterium
           3519-10]
          Length = 359

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 162/315 (51%), Gaps = 29/315 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCI--ILNGQKISSQ 86
           PSNIAL KYWGK   ++  P N S+S +L +  T T I  I ++   +   L+G +   +
Sbjct: 31  PSNIALIKYWGKYAGQI--PANPSISYTLNNCKTNTSIEFIANEKFSVQTFLSGNE---E 85

Query: 87  SSFFKKTTQFCDLFRQFS----KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI--- 139
           + F +K  +F     Q+     +  ++I T N  P  +G+ASSASGF A+   L  +   
Sbjct: 86  AKFAEKIEKFFHTIEQYLPWILQGKYIITTQNTFPHSSGIASSASGFGAIAKCLMDLDEQ 145

Query: 140 YSIPE----KSESLSRVARLGSGSACRSFYRGFCEWICGTDQ--NGMDSFAVPF-----N 188
           +S P     K +  S +ARLGSGSA RS Y G   W   TD+     D FAVP+     +
Sbjct: 146 FSAPHGCDFKLKKASFLARLGSGSAGRSLYDGLVVW-GKTDEVAGSSDLFAVPYPENEVH 204

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
           + +      +L I + EK + S     +  + +P+  +  QQ   +   +K  +   D  
Sbjct: 205 SVFRSFNDWVLLIHEGEKSVSSTIGHSLM-NTNPYAERRFQQAHENFTLLKDILKTGDLA 263

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLK 307
              ++ E  AL +HA M+ + P  +  +  T+  + ++W+ R+++ +P++FTLDAG N+ 
Sbjct: 264 AFIKLVEHEALTLHAMMMMSDPAFILMKTGTLNVIHKIWEFREKTGLPLFFTLDAGANVH 323

Query: 308 LLF-THKIEETIKQF 321
           LLF  +  E+ IK+F
Sbjct: 324 LLFPANTDEDNIKEF 338


>gi|7544604|gb|AAA34506.2| ORF [Saccharomyces cerevisiae]
          Length = 194

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 110/193 (56%), Gaps = 26/193 (13%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + LNG
Sbjct: 6   ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWLNG 65

Query: 81  QKISSQSSFFKKTTQFC--DLFRQFSKVY--------------FLIETSNNIPTKAGLAS 124
           +      S   + TQ C  DL RQ  K                  I + NN PT AGLAS
Sbjct: 66  EP----HSIDNERTQNCLRDL-RQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS A
Sbjct: 121 SAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMA 180

Query: 185 VPF--NNQWPDLR 195
           V    ++ WP ++
Sbjct: 181 VQIADSSDWPQMK 193


>gi|295136033|ref|YP_003586709.1| diphosphomevalonate decarboxylase [Zunongwangia profunda SM-A87]
 gi|294984048|gb|ADF54513.1| diphosphomevalonate decarboxylase [Zunongwangia profunda SM-A87]
          Length = 363

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 159/321 (49%), Gaps = 36/321 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---------IILN 79
           PSNIAL KYWGK+++++  P N S+S +L +  T T +  +    +          +I  
Sbjct: 25  PSNIALVKYWGKKENQI--PANPSISFTLKNCKTTTRLNYVKVSDNSTTSRGIEFDVIFE 82

Query: 80  GQKISSQS----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           G K  S      SFFK+   +C    +F    F + + N+ P  +G+ASSASG +AL L 
Sbjct: 83  GVKKESFKPKIVSFFKRILPYCSYLEEFK---FEVVSDNSFPHSSGIASSASGMSALALC 139

Query: 136 LFRIYS--IPEKSESL-----SRVARLGSGSACRSFYRGFCEWICGTDQN---GMDSFAV 185
           +  +     PE  +       S +ARLGSGSACRS       W  G  Q      D++ V
Sbjct: 140 VMSLEKSLFPETEDDFFYKKASFLARLGSGSACRSVRGDLVVW--GQHQEIPLSSDTYGV 197

Query: 186 --PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
             PF   + + D +  +L ++D+ KK  S        H   F     QQ    L+ +  A
Sbjct: 198 QYPFKIADVFKDYQDTIL-LVDKGKKQVSSTVGHDLMHGHAFAAARFQQAHDHLSALIPA 256

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTL 300
               D  +  ++ E+ AL +HA M+++ P  L  +  T+  + ++W+ R++S IP+ FTL
Sbjct: 257 FEKGDVKQFIKIVEREALTLHAMMMSSDPYFLLMKPNTLAIINKIWEKREESKIPVCFTL 316

Query: 301 DAGPNLKLLFTHKIEETIKQF 321
           DAG N+ +L+  + +E I +F
Sbjct: 317 DAGANVHMLYPSQFKEEILEF 337


>gi|332881013|ref|ZP_08448682.1| putative diphosphomevalonate decarboxylase [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332681030|gb|EGJ53958.1| putative diphosphomevalonate decarboxylase [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 341

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 155/324 (47%), Gaps = 41/324 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCII----------L 78
           PSNIAL KYWGK+  +L  P N S+S +L H  T T I      A  +            
Sbjct: 7   PSNIALVKYWGKKGEQL--PANPSISFTLSHCYTETSIAYQRRSAATMATDAPFSFDFSF 64

Query: 79  NGQKISS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           +GQ   S      +FF +   +      +   +F I + N+ P  +G+ASSAS  AAL++
Sbjct: 65  DGQPKPSFHPKIEAFFARIAPYLPFLTDY---HFSIHSHNSFPHSSGIASSASAMAALSV 121

Query: 135 ALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMDS 182
            L ++       YS  E  +  S +ARLGSGSACRS       W     I G+     D 
Sbjct: 122 CLMQVARELGYTYSEEEFWQKASFLARLGSGSACRSVKGSIVVWGQHPSIVGSS----DD 177

Query: 183 FAVPFNNQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
           + +P+  Q    + D +  +L +IDRE+K  S        H  PF      Q ++++  +
Sbjct: 178 YGIPYPLQVAPVFADFQDTIL-LIDREQKQVSSTVGHNLMHGHPFAEARFLQANSNIDRL 236

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
             A    D     EV E  AL +HA M  + P  +  +  T++ ++RVW  R+ + +P+ 
Sbjct: 237 IGAFATGDIDTFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRVWQYRKDTKVPLC 296

Query: 298 FTLDAGPNLKLLFTHKIEETIKQF 321
           FTLDAG N+ LL+   +++ ++ F
Sbjct: 297 FTLDAGANVHLLYPKSVKDEVQTF 320


>gi|196004226|ref|XP_002111980.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
 gi|190585879|gb|EDV25947.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
          Length = 385

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 92/318 (28%), Positives = 151/318 (47%), Gaps = 22/318 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLS--LSLGHLGTITHITVIDS-DADCIIL 78
           ++++   P NIA+ KYWGKRD  L LP+N+SLS  LS   +   T I +  S   D + +
Sbjct: 5   KQATCIAPVNIAVVKYWGKRDENLILPINSSLSGTLSTDQMCAKTTIAISKSFQRDRLWI 64

Query: 79  NGQKISSQS----SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           NG++  +      +  ++    C    +    ++ I + NN PT AGLASSA+G+A L  
Sbjct: 65  NGKEQDATGKRLQNCLREVRSRCG--SEIEGCHYHICSVNNFPTAAGLASSAAGYACLG- 121

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN--NQWP 192
                +   E    +    R GSGSACRS Y GF +W  G   +G DS AV     + WP
Sbjct: 122 ---EYFEYKEGITKIQFTIRQGSGSACRSMYGGFVKWEMGNKSDGSDSIAVQVTPESHWP 178

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDL-AHIKQAIIDQDFIKLG 251
           ++ + +L + D++K + S   M+ +   S       + +   L   ++ AI  +++    
Sbjct: 179 EMEVLILVVSDKKKGVSSTSGMQTSVKTSKLLKYRAESLVPKLMTEMETAIQQKNYQAFA 238

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDAGPNLKLL 309
           E+  K++ + HA  +   PP+ Y    + + ++ +    Q        +T DAGPN  L 
Sbjct: 239 EITMKDSNQFHAVCLDTYPPIAYMNDISHKIVQLITHFNQYCGEYKACYTFDAGPNAVLY 298

Query: 310 FTHK----IEETIKQFFP 323
              K    I   +  +FP
Sbjct: 299 VLAKDVPQILSAVCHYFP 316


>gi|328705849|ref|XP_003242922.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform 2
           [Acyrthosiphon pisum]
          Length = 348

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/278 (31%), Positives = 138/278 (49%), Gaps = 23/278 (8%)

Query: 74  DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVY-----------FLIETSNNIPTKAGL 122
           DC+ LNGQ +S + +  ++  +  DL R   K+              + + NN PT AGL
Sbjct: 16  DCVWLNGQIMSIERN--ERLKKCFDLIRNLIKIQKGENSQEVKWKIRVCSENNFPTAAGL 73

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+G+A L   L   + +   +  L  +AR GSGSACRS Y GF +W  G D  G DS
Sbjct: 74  ASSAAGYACLVYTLANAFGLV--NGDLPSIARQGSGSACRSIYGGFVQWTAGVDDQGYDS 131

Query: 183 FAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIK 239
            AV    +  WP++RI +L + D +KK  S   M+     S       Q+ +      I 
Sbjct: 132 TAVQIAADTHWPEMRIIILVVNDSKKKTSSTVGMKQAVKTSELLKYRIQKCVPERTKEII 191

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIY 297
           QAI D++F K  E+  +++ + HA  +   PP +Y  + + + +  V D  + +  I + 
Sbjct: 192 QAITDKNFEKFAEITMRDSNQFHAICLDTYPPCVYLNQVSHEIISFVHDYNEATGQIKVS 251

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
           +T  AGPN   LF  +I+ ++  F  E+  + P   P+
Sbjct: 252 YTFYAGPN-AFLFIQQIDLSL--FMSELVNVFPTMQPN 286


>gi|262196594|ref|YP_003267803.1| diphosphomevalonate decarboxylase [Haliangium ochraceum DSM 14365]
 gi|262079941|gb|ACY15910.1| diphosphomevalonate decarboxylase [Haliangium ochraceum DSM 14365]
          Length = 337

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 157/282 (55%), Gaps = 9/282 (3%)

Query: 34  LCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILNGQKISSQSSFFKK 92
           L KYWGKRD   NLP   SLSL+L  L T T +    + A D ++L+ +    ++    +
Sbjct: 18  LIKYWGKRDRARNLPAAGSLSLTLAALTTTTSVRFDPALAGDRLVLDHRVEDGKA--LAR 75

Query: 93  TTQFCDLFRQFSKVYFLIE--TSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
            + + DL R  + +    E  ++N+ PT +GLASSAS +AAL LA  R   +     +LS
Sbjct: 76  VSAWLDLVRAQAGIDTRAEVVSANDFPTASGLASSASAYAALALAATRAAGLTLDQRALS 135

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKI 208
            +AR GSGSA RS Y GF     G   +G D++A   +    WP LR+ +  +   +KK 
Sbjct: 136 ILARRGSGSAARSIYGGFVRMHAGARDDGSDAYAEALDEAGDWP-LRMVVAVVGGGQKKT 194

Query: 209 -GSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
            GSR+AME     SP +  W   +  DL    +AI  +DF  LG+V+E NAL MHA  +A
Sbjct: 195 HGSRDAMEHCAATSPLYAGWLSCVPGDLDSAARAIAARDFDALGQVSEANALAMHAAALA 254

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           + P ++YWQ  T+  +  V   R++ +  Y T+DAGP++K+L
Sbjct: 255 SRPAIVYWQPATLACLSEVRALRERGVGAYATMDAGPHVKVL 296


>gi|225010110|ref|ZP_03700582.1| GHMP kinase [Flavobacteria bacterium MS024-3C]
 gi|225005589|gb|EEG43539.1| GHMP kinase [Flavobacteria bacterium MS024-3C]
          Length = 371

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 156/323 (48%), Gaps = 46/323 (14%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS- 87
           PSNIAL KYWGK D ++  P N S+S +L H  T T +T++D      +L+ +   + S 
Sbjct: 25  PSNIALVKYWGKYDPQI--PANPSISFTLNHCNTKTSVTLVDQS----MLSDKSTGAFSF 78

Query: 88  -----------------SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
                            SFF +   +    + +   + +I + N  P  +G+ASSAS  A
Sbjct: 79  EFSFEGAPKPDFHPKIASFFARVFDYLPFLKTY---HLVINSENTFPHSSGIASSASAMA 135

Query: 131 ALTLALFRIY-SIPEKSESL---------SRVARLGSGSACRSFYRGFCEWICGTD-QNG 179
           AL+L L  +    P   +++         S +ARLGSGSA RS      +W      +  
Sbjct: 136 ALSLCLLELSDEFPPNDQNVFSEAFYAKASFLARLGSGSAARSISGPLMQWGKTPGFKAS 195

Query: 180 MDSFAVPFNNQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDL 235
            D  AVPFN      + + +  +L +   EK + S     + + H PF     QQ    L
Sbjct: 196 QDLVAVPFNKVLAPIFKNFQDTILLVDKGEKVVSSTVGHGLMKDH-PFAKARFQQAHDQL 254

Query: 236 AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-I 294
           A + +A++  D      V E  AL +HA M+ +SP  +  +  T+  +E++W+ R+ + +
Sbjct: 255 ALLTEALVSGDMETFISVVESEALTLHAMMLTSSPYFILMKPGTLSIIEKIWNFRKNTAL 314

Query: 295 PIYFTLDAGPNLKLLF--THKIE 315
           P+ FTLDAG N+ LL+   HK++
Sbjct: 315 PVCFTLDAGANVHLLYPEMHKVQ 337


>gi|114664085|ref|XP_001135547.1| PREDICTED: diphosphomevalonate decarboxylase isoform 1 [Pan
           troglodytes]
          Length = 434

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 155/353 (43%), Gaps = 63/353 (17%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISS 85
           P NIA+ KYWGKRD +L LP+N+SLS++L       T T +   D   D I LNG++   
Sbjct: 15  PVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDV 74

Query: 86  QSSFF-------------KKTTQFCDLFRQFSKVYFLIETSNNIPTK----------AGL 122
                             ++ ++  D           + + NN PT           A L
Sbjct: 75  GQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACL 134

Query: 123 ASSASGFAAL------------------------TLALFRIYSIPEKSESLSRVARLGSG 158
            ++  G + +                        T  L R+Y +      LS VAR GSG
Sbjct: 135 VAAGVGLSPVIPVLKRLMGEKHFRPGVQDQPGQHTYTLARVYGV---ESDLSEVARRGSG 191

Query: 159 SACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEI 216
           SACRS Y GF EW  G   +G DS A  V   + WP+LR+ L+ ++    ++  +     
Sbjct: 192 SACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRV-LILVVSGVGRVEQQPCGLS 250

Query: 217 TRHHSPFFTQWTQQ--ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
               +P   Q+  +  +   +A + + I ++DF    ++  K++ + HAT +   PP+ Y
Sbjct: 251 APWETPCALQFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISY 310

Query: 275 WQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
               + + +  V  ++A      + +T DAGPN  ++FT  +++T+ +F   +
Sbjct: 311 LNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-AVIFT--LDDTVAEFVAAV 360


>gi|319952528|ref|YP_004163795.1| ghmp kinase [Cellulophaga algicola DSM 14237]
 gi|319421188|gb|ADV48297.1| GHMP kinase [Cellulophaga algicola DSM 14237]
          Length = 364

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 159/316 (50%), Gaps = 29/316 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC------IILNGQK 82
           PSNIAL KYWGK++++L  P N S+S +L    T T I+    +         ++  G  
Sbjct: 25  PSNIALVKYWGKKENQL--PQNPSISFTLDACATTTKISFKRLNKPSEEYSFDLLFEG-- 80

Query: 83  ISSQSSFFKKTTQF---CDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +S+  F  K   F    +++  F K Y F IETSN+ P  +G+ASSASG +AL L L  
Sbjct: 81  -NSKEDFKPKIKIFFTRIEVYLPFLKEYHFTIETSNSFPHSSGIASSASGMSALALCLVA 139

Query: 139 IYSI--PEKSES-----LSRVARLGSGSACRSFYRGFCEWICGTDQNGM-DSFAVPF--- 187
           +     PE S+      +S +ARLGSGSACRS      +W    +  G  D F + +   
Sbjct: 140 LEKQLNPEMSDDFFTKKVSFLARLGSGSACRSIEGDIVQWGNHENTEGSSDLFGIKYPYK 199

Query: 188 -NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
            ++ +      +L +   +K++ S     +  +H PF TQ  +Q   +L  +       D
Sbjct: 200 VHDNFKRFHDTILLVDKGQKQVSSTVGHNLMHNH-PFATQRFKQAHENLDKLIAVFESGD 258

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP-IYFTLDAGPN 305
             +   + E  AL +HA M+ + P  +  +  T++ + ++W+ R++S   + FTLDAG N
Sbjct: 259 LKEFIAIVESEALTLHAMMMTSMPNFILMKPNTLEIINKIWEFREKSNSNVCFTLDAGAN 318

Query: 306 LKLLFTHKIEETIKQF 321
           + +L+    ++ + QF
Sbjct: 319 VHVLYPENEKDVVFQF 334


>gi|332292092|ref|YP_004430701.1| GHMP kinase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170178|gb|AEE19433.1| GHMP kinase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 360

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 162/319 (50%), Gaps = 35/319 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC------IILNGQK 82
           PSNIAL KYWGK   +  LP N S+S +L +  T T ++   +          I L+G+ 
Sbjct: 25  PSNIALVKYWGKYGEQ--LPQNPSISFTLSNCHTTTTLSYKKNSNFSGEIPFEIFLDGE- 81

Query: 83  ISSQSSFFKKTTQF---CDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLALFR 138
             +   F  K T+F     ++  F K Y + IETSN+ P  +G+ASSASG +AL L L  
Sbjct: 82  --AAPDFKPKITKFFKRIAIYMPFVKEYEYKIETSNSFPHSSGIASSASGMSALALCLME 139

Query: 139 IYSIPEKS-------ESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMDSFAVP 186
           +    E +       E  S +ARLGSGSACRS       W     I G+      S+   
Sbjct: 140 MERGMEGAMTDAFFNEKASFLARLGSGSACRSIEGPLVVWGKHAEIEGSTNFYGTSYEGE 199

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHS---PFFTQWTQQISTDLAHIKQAII 243
            + ++ + +  +L +   EK++ S    ++   H+     FTQ  + +S+ +   KQ  +
Sbjct: 200 IHEKFHNYQDTILLVDKGEKQVSSTVGHDLMHGHAFAKARFTQAHENLSSLMQVFKQGDV 259

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDA 302
           DQ FIK   + E  AL +HA M+ + P  +  + +T++ +  +W  R ++   I FTLDA
Sbjct: 260 DQ-FIK---IVESEALTLHAMMMTSHPYFILMKPKTLEIINEIWAYRNETGSKICFTLDA 315

Query: 303 GPNLKLLFTHKIEETIKQF 321
           G N+ +L+    +E++++F
Sbjct: 316 GANVHVLYPENEKESVQKF 334


>gi|114664087|ref|XP_001135959.1| PREDICTED: diphosphomevalonate decarboxylase isoform 2 [Pan
           troglodytes]
 gi|114664089|ref|XP_001136051.1| PREDICTED: diphosphomevalonate decarboxylase isoform 3 [Pan
           troglodytes]
          Length = 379

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 92/309 (29%), Positives = 151/309 (48%), Gaps = 29/309 (9%)

Query: 39  GKRDSKLNLPLNNSLSLSLGH---LGTITHITVIDSDADCIILNGQKISSQSSFF----- 90
           GKRD +L LP+N+SLS++L       T T +   D   D I LNG++             
Sbjct: 4   GKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLR 63

Query: 91  --------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
                   ++ ++  D           + + NN PT AGLASSA+G+A L   L R+Y +
Sbjct: 64  EIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLARVYGV 123

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLK 200
                 LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + WP+LR+ L+ 
Sbjct: 124 ---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRV-LIL 179

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQ--ISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           ++    ++  +         +P   Q+  +  +   +A + + I ++DF    ++  K++
Sbjct: 180 VVSGVGRVEQQPCGLSAPWETPCALQFRAESVVPARMAEMARCIRERDFPSFAQLTMKDS 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
            + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN  ++FT  +++
Sbjct: 240 NQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN-AVIFT--LDD 296

Query: 317 TIKQFFPEI 325
           T+ +F   +
Sbjct: 297 TVAEFVAAV 305


>gi|300121677|emb|CBK22252.2| unnamed protein product [Blastocystis hominis]
          Length = 280

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 102/200 (51%), Gaps = 8/200 (4%)

Query: 122 LASSASGFAALTLALFRIYSI---PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
           +ASSASG A LT  L  +Y +   PE+   L+ + R  SGSACRS Y G  +W  G+ ++
Sbjct: 1   MASSASGLACLTKCLSAVYGVLTSPEEETILNSITRQASGSACRSLYGGLVKWDKGSRED 60

Query: 179 GMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF-TQWTQQISTDL 235
           G+DS A  V  ++ WP+ RI +  + +  K +GS E M      SP    ++T  +   +
Sbjct: 61  GLDSIAHQVLPSDSWPEFRIAVCIVSESRKSVGSTEGMNRCVETSPLMRVRYTDLVENRI 120

Query: 236 AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW--QKETIQGMERVWDARQQS 293
           A   +A    DF  LGE+  + +  +HA   AA P ++Y   Q + I  + R  ++    
Sbjct: 121 AEAIKAFSMHDFGALGEIIMQESDDLHAICAAAEPSIVYLSNQSQFIIKLVRAINSFMNQ 180

Query: 294 IPIYFTLDAGPNLKLLFTHK 313
             I ++ DAG N  L F  K
Sbjct: 181 TIIAYSFDAGSNAFLFFEEK 200


>gi|228472590|ref|ZP_04057350.1| diphosphomevalonate decarboxylase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276003|gb|EEK14759.1| diphosphomevalonate decarboxylase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 356

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 151/317 (47%), Gaps = 34/317 (10%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-------DADCIILNGQK 82
           SNIAL KYWGKRD ++  P+N S+S +L H  T T I +            D       K
Sbjct: 26  SNIALVKYWGKRDEQI--PMNPSISFTLSHSYTETVIEMAPRTDFTSSFQIDFFFDEEPK 83

Query: 83  ---ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
              +    +FF +   +    R +   YF+I +SN+ P  AG+ASSAS  AAL + L +I
Sbjct: 84  DNFLPKIETFFTRIRNYIPFLRDY---YFVIRSSNSFPHSAGIASSASAMAALAVCLMKI 140

Query: 140 YSI--PEKSESL-----SRVARLGSGSACRSFYRGFCEWICGTDQNG-MDSFAVPFN--- 188
            ++  PE +E       S +ARLGSGSACRS Y G   W   +   G  D + +P     
Sbjct: 141 ENLFDPEMTEQFFHEKASFLARLGSGSACRSTYSGVVLWGEHSAVMGSSDLYGIPMEDVH 200

Query: 189 ---NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
              N + D    +L I   +K + S +  ++   H P+      Q    +A +K  +   
Sbjct: 201 EVFNTYQD---TILLIDKGQKPVSSTKGHQLMIGH-PYAEARFLQAREHIAALKSILKKG 256

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGP 304
           D     ++ E  AL +HA M+ + P  L  +  TI  +E++W  R  +  P+ FTLDAG 
Sbjct: 257 DLEGFMDLVESEALALHAMMMTSDPYYLLMRPNTIAAIEKIWYLRASTQKPLCFTLDAGA 316

Query: 305 NLKLLFTHKIEETIKQF 321
           N+ LL+    +  I  F
Sbjct: 317 NIHLLYPKAYKADIIPF 333


>gi|297699432|ref|XP_002826792.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pongo abelii]
          Length = 399

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 150/320 (46%), Gaps = 38/320 (11%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKR------DSKLNLPLNNSLSLSLGHLGTITHITVID 70
            P + E +SA++P   +   + G R       SK    LN+ L L L  +  +  +    
Sbjct: 41  GPSVQESASAYVPVMGSRAAWLGTRHACWAASSKAVAHLNDQLGLGLSGVFLVRCLAQKR 100

Query: 71  SDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
            ++     +G  + S  SF               KV+  + + NN PT AGLASSA+G+A
Sbjct: 101 RNSR----DGDPLPSSLSF---------------KVH--VASVNNFPTAAGLASSAAGYA 139

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFN 188
            L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V   
Sbjct: 140 CLAYTLARVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIAWQVAPE 196

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDF 247
           + WP+LR+ +L +   +K  GS   M  +   SP    +    +   +A + + I ++DF
Sbjct: 197 SHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRADSVVPARVAEMARCIRERDF 256

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPN 305
               ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAGPN
Sbjct: 257 PSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPN 316

Query: 306 LKLLFTHKIEETIKQFFPEI 325
             +     +++T+ +F   +
Sbjct: 317 AVIF---ALDDTVAEFVAAV 333


>gi|153799404|gb|ABS50474.1| NapT5 [Streptomyces sp. CNQ525]
          Length = 225

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 95/165 (57%), Gaps = 10/165 (6%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISSQSSF 89
           NIAL KYWGKRD  L LP  +SLS++L    T T + +  ++  D ++L G+    ++  
Sbjct: 56  NIALIKYWGKRDEHLVLPRTDSLSMTLDIFPTTTRVRLAPEAGRDVVVLGGRPAEGEA-- 113

Query: 90  FKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++   F DL R  +++    ++E+ N +PT AGLASSASGFAAL +A  R Y +   + 
Sbjct: 114 LRRIVTFLDLVRHSARLPHRAVVESHNTVPTGAGLASSASGFAALAVAAARAYGLSLTAT 173

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVPF 187
            LSR+AR GSGSA RS + GF  W  G     T    + S+A P 
Sbjct: 174 GLSRLARRGSGSASRSVFGGFAVWHAGRPGQDTKAADLGSYAEPV 218


>gi|203284584|ref|YP_002222324.1| mevalonate pyrophosphate decarboxylase [Borrelia duttonii Ly]
 gi|201084027|gb|ACH93618.1| mevalonate pyrophosphate decarboxylase [Borrelia duttonii Ly]
          Length = 313

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 151/287 (52%), Gaps = 18/287 (6%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           ++AL KYWGKRD  LN P  +S+++S+    +IT + +  S  D IILN + +  Q    
Sbjct: 10  SLALIKYWGKRDRFLNTPATSSIAVSVDKFYSITELVL--SSRDEIILNSKSVVLQD--- 64

Query: 91  KKTTQFCDLFRQFSK---VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            +  +F +  R+      + F I + NN PT AGLASS+SGFA++   + + +      +
Sbjct: 65  -REKKFFNYARKILNKLDIGFKIVSENNFPTSAGLASSSSGFASIAACILKYFD-QFSYQ 122

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID-REK 206
             S +AR+GS SA R+ Y GF        +  +++F     N + +L I +  I+D +EK
Sbjct: 123 KASELARIGSASASRAIYGGF----TFLKEGALNAFQCNNYNCFNELCI-IFAIVDGQEK 177

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           +I SR AME+ +    ++  W +             +  DF K G    K+   M A M+
Sbjct: 178 EISSRTAMELCKQERFYWDAWIKSSQNIFKEALYFFLIGDFNKFGLRVIKSYQCMFALML 237

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           ++S  ++Y++  TI  ++ V + R++   ++ T+DAGP +K+L   K
Sbjct: 238 SSS--IIYFKDSTINLIKYVAELRREGFSVFETMDAGPQVKILCLKK 282


>gi|257051777|ref|YP_003129610.1| diphosphomevalonate decarboxylase [Halorhabdus utahensis DSM 12940]
 gi|256690540|gb|ACV10877.1| diphosphomevalonate decarboxylase [Halorhabdus utahensis DSM 12940]
          Length = 323

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 134/298 (44%), Gaps = 18/298 (6%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSSFFK 91
            L KY G RD +L  P ++S+SL      + T +    +   D  +++G+ I  + +  +
Sbjct: 12  GLVKYHGIRDPELRTPYHDSISLCTAPSNSTTTVAFEPERPEDEYVIDGEHIDGRGA--E 69

Query: 92  KTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
           +     D  R+ + +     + + NN P+  G  SSASGFAAL  AL     +      +
Sbjct: 70  RIRTVVDNVRERADLDERVRVASENNFPSNVGFGSSASGFAALATALVEAAGLDLSRPEI 129

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FAVPFNNQWPDLRIGLLKIIDREKK 207
           S +AR GS SA R+   GF +   G++     S    VP  +   D+RI +  +I   K+
Sbjct: 130 STIARRGSTSAARAVTGGFSDLRAGSNDADCRSKRLDVPLED---DVRI-VGAVIPAYKE 185

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
             +        H    F      +   LA ++ A+   DF +  E+AE + L + AT + 
Sbjct: 186 TEAAHEEAAESH---MFEGRLAHVHEQLADMRDALGRGDFERSFEIAEHDTLSLAATTMT 242

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP----NLKLLFTHKIEETIKQF 321
                +YWQ E+++  E V D R   +P+YF+ D G     N    +  ++E  I+  
Sbjct: 243 GPSGWVYWQPESLEVFETVRDLRDDGVPVYFSGDTGASIYVNTTAEYVDRVESAIETL 300


>gi|256819342|ref|YP_003140621.1| GHMP kinase [Capnocytophaga ochracea DSM 7271]
 gi|256580925|gb|ACU92060.1| GHMP kinase [Capnocytophaga ochracea DSM 7271]
          Length = 342

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 97/324 (29%), Positives = 155/324 (47%), Gaps = 35/324 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
           PSNIAL KYWGK+  +L  P N S+S +L H  T T I   +  ++  I +G+  S   S
Sbjct: 7   PSNIALVKYWGKKGEQL--PANPSISFTLTHCYTETSIEY-ERRSESSIASGEPFSFDFS 63

Query: 89  F---------------FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           F               F++   +    + +   +F I + N+ P  +G+ASSAS  AAL+
Sbjct: 64  FEGQPKPSFHPKIHTFFERIVAYLPFLKDY---HFSIASHNSFPHSSGIASSASAMAALS 120

Query: 134 LALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMD 181
           + L +I       Y+     +  S +ARLGSGSACRS       W     I G+      
Sbjct: 121 VCLMQISKELGETYAEEAFWQKASFLARLGSGSACRSVRGSIVVWGEHPAIIGSSDEYSI 180

Query: 182 SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
            + +P +  + + +  +L +IDR +K  S        H  PF      Q + ++  + ++
Sbjct: 181 PYPLPVHEVFQNYQDTIL-LIDRGQKQVSSTVGHNLMHGHPFAEARFAQANENINKLVRS 239

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTL 300
               D  +  EV E  AL +HA M  + P  +  +  T++ ++R+W  R+++ IP+ FTL
Sbjct: 240 FASGDVERFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRIWQYRKETNIPLCFTL 299

Query: 301 DAGPNLKLLFTHKIEETIKQFFPE 324
           DAG N+ LL+       +K F  E
Sbjct: 300 DAGANVHLLYPKTSTTEVKWFIEE 323


>gi|203288118|ref|YP_002223133.1| mevalonate pyrophosphate decarboxylase [Borrelia recurrentis A1]
 gi|201085338|gb|ACH94912.1| mevalonate pyrophosphate decarboxylase [Borrelia recurrentis A1]
          Length = 313

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 151/287 (52%), Gaps = 18/287 (6%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           ++AL KYWGKRD  LN P  +S+++S+    +IT + +  S  D IILN + +  Q    
Sbjct: 10  SLALIKYWGKRDRFLNTPATSSIAVSVDKFYSITELVL--SSRDEIILNSKSVVLQD--- 64

Query: 91  KKTTQFCDLFRQFSK---VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            +  +F +  R+      + F I + NN PT AGLASS+SGFA++   + + +      +
Sbjct: 65  -REKKFFNYARKILNKLDIGFKIVSENNFPTSAGLASSSSGFASIAACILKYFD-QFSYQ 122

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID-REK 206
             S +AR+GS SA R+ Y GF        +  +++F     N + +L I +  I+D +EK
Sbjct: 123 KASELARIGSASASRAIYGGF----TFLKEGALNAFQCNNYNCFNELCI-IFAIVDGQEK 177

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMI 266
           +I SR AME+ +    ++  W +             +  DF K G    K+   M A M+
Sbjct: 178 EISSRTAMELCKQERFYWDAWIKSSQNIFKEALYFFLIGDFNKFGLRVIKSYQCMFALML 237

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           ++S  ++Y++  TI  ++ V + R++   ++ T+DAGP +K+L   K
Sbjct: 238 SSS--IIYFKDITINLIKYVAELRREGFSVFETMDAGPQVKILCLKK 282


>gi|315224790|ref|ZP_07866611.1| diphosphomevalonate decarboxylase [Capnocytophaga ochracea F0287]
 gi|314945193|gb|EFS97221.1| diphosphomevalonate decarboxylase [Capnocytophaga ochracea F0287]
          Length = 342

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 159/325 (48%), Gaps = 37/325 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
           PSNIAL KYWGK+  +L  P N S+S +L H  T T I   +  ++  I +G+  S   S
Sbjct: 7   PSNIALVKYWGKKGKQL--PANPSISFTLTHCYTETSIEY-ERRSESSIASGEPFSFDFS 63

Query: 89  F---------------FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           F               F++   +    + +   +F I + N+ P  +G+ASSAS  AAL+
Sbjct: 64  FEGQPKPSFHPKIHTFFERIVAYLPFLKDY---HFSIASHNSFPHSSGIASSASAMAALS 120

Query: 134 LALFRI-YSIPEKS------ESLSRVARLGSGSACRSFYRGFCEW------ICGTDQNGM 180
           + L +I   + E S      +  S +ARLGSGSACRS       W      I  +D+ G+
Sbjct: 121 VCLMQISKELGETSTEEAFWQKASFLARLGSGSACRSVQGNIVVWGEHPAIIGSSDEYGI 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
             + +P +  + + +  +L +IDR +K  S        H  PF      Q + ++  + +
Sbjct: 181 P-YPLPVHEVFQNYQDTIL-LIDRGQKQVSSTVGHNLMHGHPFAEARFAQANENINKLVR 238

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
           +    D  +  EV E  AL +HA M  + P  +  +  T++ ++R+W  R+++ IP+ FT
Sbjct: 239 SFASGDVERFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRIWQYRKETNIPLCFT 298

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPE 324
           LDAG N+ LL+       +K F  E
Sbjct: 299 LDAGANVHLLYPKTSTTEVKWFIEE 323


>gi|320532061|ref|ZP_08032947.1| putative diphosphomevalonate decarboxylase [Actinomyces sp. oral
           taxon 171 str. F0337]
 gi|320135728|gb|EFW27790.1| putative diphosphomevalonate decarboxylase [Actinomyces sp. oral
           taxon 171 str. F0337]
          Length = 184

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 87/172 (50%), Gaps = 7/172 (4%)

Query: 160 ACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRH 219
           A RS + G   W  G D     S+A P   +  DL + ++ + +R K I S  AM  T  
Sbjct: 1   ATRSVFGGLVLWNAGHDDA--SSYAEPVGCEM-DLAMVVVVLSERYKPISSTRAMRATMT 57

Query: 220 HSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKET 279
            SP F  W +    DL     A+   D  +LGEV E NAL MHATMIA  P ++YW  +T
Sbjct: 58  TSPLFPAWVEASRGDLQVALDAVRAGDLERLGEVVEGNALGMHATMIATRPGIVYWLPQT 117

Query: 280 IQGMERVWDARQQSIPIYFTLDAGPNLKLLF----THKIEETIKQFFPEITI 327
           +  +  +   R + +P++ T+DAGPN+K+L       ++   ++   P  T+
Sbjct: 118 VAALHAIRAMRDEGLPVWATIDAGPNVKVLTEGARAEEVAAALRDRLPGTTV 169


>gi|89890109|ref|ZP_01201620.1| diphosphomevalonate decarboxylase [Flavobacteria bacterium BBFL7]
 gi|89518382|gb|EAS21038.1| diphosphomevalonate decarboxylase [Flavobacteria bacterium BBFL7]
          Length = 351

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 151/309 (48%), Gaps = 27/309 (8%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--------IDSDADCIILNG 80
           PSNIAL KYWGK    + LP N S+S +L    TIT +T         I  D +      
Sbjct: 24  PSNIALVKYWGKYG--MQLPANPSISFTLNACRTITTVTASKGTHGFNISYDGEPKPEFA 81

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            KI +   +FK+   +C     +   +F I+T N  P  +G+ASSAS  AA+++ +    
Sbjct: 82  PKIEA---YFKRIADYCPWIANY---HFDIDTHNTFPHSSGIASSASSMAAMSVCMMDFE 135

Query: 141 SIPEKSE----SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF-----AVPFNNQW 191
           S     E      S +ARLGSGSACRS       W    + +G   +     +   +  +
Sbjct: 136 STLTGQEMDFHKASFLARLGSGSACRSLKGSAVVWGTHDEVDGSSQYFGIDKSDYLHPVF 195

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
            D +  +L +   EK + S    E+   H+ F     +Q   +L+ +K A+ D D     
Sbjct: 196 QDFQDTILLVDKGEKVVSSTVGHELMNGHA-FAKARFEQAHENLSTLKIALQDGDLETFI 254

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLF 310
           ++ E  AL +HA M+ + P  +  + +T+  +E +W  R+++ IP+ FTLDAG N+ +L+
Sbjct: 255 KITESEALTLHAMMMTSHPYFILMKPKTLSIIEEIWAFRKETGIPVCFTLDAGANVHMLY 314

Query: 311 THKIEETIK 319
            ++  E ++
Sbjct: 315 PNENNEAVQ 323


>gi|118372050|ref|XP_001019222.1| diphosphomevalonate decarboxylase family protein [Tetrahymena
           thermophila]
 gi|89300989|gb|EAR98977.1| diphosphomevalonate decarboxylase family protein [Tetrahymena
           thermophila SB210]
          Length = 432

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 99/346 (28%), Positives = 155/346 (44%), Gaps = 68/346 (19%)

Query: 31  NIALCKYWGKRDSKLNLPLNNS--LSLSLGHLGTITHITVIDSDADC-IILNGQKISSQS 87
           NIAL KYWGK D +  LPLN+S  ++LS   L T T IT+ +   D   +LNGQ     S
Sbjct: 20  NIALVKYWGKFDEEYILPLNSSTGITLSTEDLQTRTTITLTNKYKDIKFLLNGQP-HPVS 78

Query: 88  SFFKKTTQFCD-------------------------LFRQF-----SKVYFLIETSNNIP 117
              KK  +F +                           ++F     S++   I++ N+ P
Sbjct: 79  GRLKKILKFFEDKALAALGEELVPLQEGESQDTKRKTLKEFLNGDLSQLKLKIKSVNSFP 138

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSE-SLSRVARLGSGSACRSFYRGFCEWICGTD 176
           T +GLASSASG AAL++ LF +Y + E+ E   S +ARLGSGSA RS Y G  EW     
Sbjct: 139 TASGLASSASGLAALSVCLFDVYHMKEEYEFQRSVIARLGSGSASRSIYGGLVEWTGVPH 198

Query: 177 QNGMDSFAVPFNNQ-------------------------WPDLRIGLLKIIDREKKIGSR 211
           Q     F    NN+                         + DL + ++      K++ S 
Sbjct: 199 QYLQKKFESK-NNEIQLSEQEYEQLSKLCIAKQTHNETFFEDLDVFVVAYSFESKEVPST 257

Query: 212 EAMEITRHHSPFFT-QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP 270
             M  +   S     +        +A +K+AI ++++ +L  +   ++ + HA  +  +P
Sbjct: 258 SGMLQSTQTSELLKYRALNTAHVHIAGVKKAIEEKNYNELARLVRLDSNQFHAVCLDTTP 317

Query: 271 PLLY---WQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           P+ Y   + K  I  + ++  A +  +   +T DAGP+  +L  HK
Sbjct: 318 PIFYLNDFSKNMINFIHQLDSALEYHVA--YTFDAGPH-AVLLVHK 360


>gi|332664945|ref|YP_004447733.1| diphosphomevalonate decarboxylase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332333759|gb|AEE50860.1| diphosphomevalonate decarboxylase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 379

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 156/323 (48%), Gaps = 40/323 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS---- 84
           PSNIA+ KYWGK   +L  P N S+S +L    T T  + +  +       G++IS    
Sbjct: 41  PSNIAIVKYWGKHGQQL--PRNPSISFTLQAAYTETEFSYVPRET-----TGEEISLDFF 93

Query: 85  ----SQSSFFKKTTQFC------DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
               +Q++F +K  +F       ++    ++ +  I ++N+ P  AG+ASSAS  +AL L
Sbjct: 94  FEGQAQAAFAQKIVKFLSALAAEEILPFLTQFHLTIHSANSFPHSAGIASSASSMSALAL 153

Query: 135 AL-------FRIYSIP-EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM-DSFAV 185
            L       F   + P E     S +ARLGSGSACRS Y     W     Q G  D +  
Sbjct: 154 CLCSMEQELFGTLTDPVEFYRKASFLARLGSGSACRSLYPVMGSWGKIEKQAGSSDLWGS 213

Query: 186 P----FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
           P     +  +      +L +   EK + SR   ++    +P+     QQ + +L  +   
Sbjct: 214 PCADWVHPVFHTFHDDILIVSKGEKSVSSRAGHQLMEG-NPYANARYQQATNNLDQLVDI 272

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR---QQSIPIYF 298
           +   D    G++AE  AL +HA M+++ PP L  +  ++  +E++   R   QQ  P+YF
Sbjct: 273 LKSGDVHAFGQIAELEALTLHALMMSSQPPYLLMKPNSLAMIEKIRQYRLDTQQ--PLYF 330

Query: 299 TLDAGPNLKLLFTHKIEETIKQF 321
           TLDAGPNL LL+  +I   +  F
Sbjct: 331 TLDAGPNLHLLYPAEIAGHVAPF 353


>gi|298207506|ref|YP_003715685.1| hypothetical protein CA2559_04605 [Croceibacter atlanticus
           HTCC2559]
 gi|83850142|gb|EAP88010.1| hypothetical protein CA2559_04605 [Croceibacter atlanticus
           HTCC2559]
          Length = 360

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 95/309 (30%), Positives = 161/309 (52%), Gaps = 38/309 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI------TVIDSDADCIILNGQK 82
           PSNIAL KYWGKRD  + +P N S+S +L    TIT +       + +  +  + L+G++
Sbjct: 25  PSNIALVKYWGKRD--IQIPENTSISFTLNTCKTITTLHFEKKENLTNDYSFQVYLDGER 82

Query: 83  ISS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +S       FF++  ++    + +    F IETSN+ P  +G+ASSASG AAL++ L  
Sbjct: 83  TTSFEPKIGKFFERIEEYLPFLKNYK---FKIETSNSFPHSSGIASSASGMAALSMCLVA 139

Query: 139 I-YSIPEKSESL------SRVARLGSGSACRSFYRGFCEWICGTDQ---NGMDSFAVPFN 188
           +   I    ++L      S +ARLGSGSA RS       W  G  +      +++A+ ++
Sbjct: 140 LEKQIDNLKDNLYFQNKASFLARLGSGSASRSIDGPMMIW--GKHEAIPESTNNYAIKYD 197

Query: 189 NQWP---DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID- 244
              P   D +  +L +   EK++ S    ++   H PF  Q   Q   ++  + + +   
Sbjct: 198 KIDPVFKDYQDTILLVDKGEKQVSSTVGHQLMYGH-PFSEQRFNQAQDNMVSLLEILESG 256

Query: 245 --QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLD 301
             +DFI L    E+ AL +HA M+ ++P  +  +  T++ + R+W  R+++ + + FTLD
Sbjct: 257 NLKDFINL---VEREALTLHAMMMTSNPYFILMKPNTLEIINRIWAFRKETNLNLCFTLD 313

Query: 302 AGPNLKLLF 310
           AG N+ LL+
Sbjct: 314 AGANVHLLY 322


>gi|256088146|ref|XP_002580219.1| diphosphomevalonate decarboxylase [Schistosoma mansoni]
 gi|238665734|emb|CAZ36458.1| diphosphomevalonate decarboxylase [Schistosoma mansoni]
          Length = 387

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 141/298 (47%), Gaps = 23/298 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHI-TVIDSDADCIILNGQ---- 81
           P NIAL KYWGK D     P  +S+SL+L   H+GT T + T  D       LNG+    
Sbjct: 4   PVNIALLKYWGKGDDLNIYPSTSSISLTLNQAHVGTKTAMFTKNDLKESLFKLNGKLLDV 63

Query: 82  ---KISSQSSFFKKTTQFCDLF--RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
               +S  +  F K  Q       R     +  +E+ NN PT AGLASSASG AA   AL
Sbjct: 64  LIVGMSIFTILFIKLAQLRSRLDGRLVPSPFLCVESENNFPTSAGLASSASGTAAFAFAL 123

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRI 196
             +Y +       + ++R GSGS+CRS   GF +W    D +       P  + WP+LR+
Sbjct: 124 GTMYGL---DGDYTSLSRRGSGSSCRSLLGGFVQWSNNHDDHTSVQQLFP-ASYWPELRV 179

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ---AIIDQDFIKLGEV 253
            +    +  K +GS +AM      S  F     ++ +   H K+   A+ D+DF  L EV
Sbjct: 180 LICVTNENPKPVGSTDAMLCCVKTSYLFRN--GRVPSSKIHEKEIISALKDRDFSALAEV 237

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP--IYFTLDAGPNLKLL 309
             + + ++HA  +   PP +Y  + +   M+ V       +   + +T DAGPN  LL
Sbjct: 238 TMRESNQLHALCLDTWPPCIYLNELSHSIMDFVHSINNYFMKNVVAYTFDAGPNAFLL 295


>gi|15921219|ref|NP_376888.1| diphosphomevalonate decarboxylase [Sulfolobus tokodaii str. 7]
 gi|15622004|dbj|BAB65997.1| 257aa long hypothetical diphosphomevalonate decarboxylase
           [Sulfolobus tokodaii str. 7]
          Length = 257

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 119/239 (49%), Gaps = 8/239 (3%)

Query: 93  TTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
           + +  ++FR+    ++Y  +E+ +N P   GLASSA+G AAL  A      +    + LS
Sbjct: 5   SGRVLNIFRKLYGKEIYAKVESWSNFPKSTGLASSAAGIAALVYATNEALELGLSQKELS 64

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKI 208
           ++AR+GSGSACRS   GF  W  G   +G DS+       N W +L   +  + ++ KKI
Sbjct: 65  KIARIGSGSACRSTAGGFVLWEKGERDDGEDSYCYSLFPENHWKELVDIIAIVSEKSKKI 124

Query: 209 GSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
            SRE M IT   S       + I   L  + ++I +++  +      +++  MHA ++ +
Sbjct: 125 SSREGMIITAKTSNLMKCRLKFIEETLPKVIKSIEERNEKEFYYWLMRHSNSMHAVILDS 184

Query: 269 SPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITI 327
            P   Y    +++ ME +    Q+     +T DAGPN  +  T K ++ + +F   I +
Sbjct: 185 WPSFFYLNDTSLKIMEWI----QEFGKAGYTFDAGPNPHIFTTEKYKDEVIRFLNSIGV 239


>gi|213964145|ref|ZP_03392383.1| ghmp kinase [Capnocytophaga sputigena Capno]
 gi|213953186|gb|EEB64530.1| ghmp kinase [Capnocytophaga sputigena Capno]
          Length = 343

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 153/324 (47%), Gaps = 35/324 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ-- 86
           PSNIAL KYWGK+  +L  P N S+S +L H  T T I   +  ++  I +G   S    
Sbjct: 7   PSNIALVKYWGKKGEQL--PANPSISFTLTHCYTETSIDY-ERRSELSIASGDSFSFNFS 63

Query: 87  -------------SSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
                        S+FF++   +    + +   +F I + N+ P  +G+ASSAS  AAL+
Sbjct: 64  FEEQPKPSFHPKISTFFERILPYLPFLKDY---HFNIASHNSFPHSSGIASSASAMAALS 120

Query: 134 LALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMD 181
           + L +I       Y+     +  S +ARLGSGSACRS       W     I G+      
Sbjct: 121 VCLMKIAVELGETYTEEAFWQKASFLARLGSGSACRSVKGSIVVWGEHPAIAGSSDEYGI 180

Query: 182 SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
           ++ +P +  + + +  +L +IDR +K  S        H  PF      Q + ++  +   
Sbjct: 181 TYPLPVHEVFQNYQDTIL-LIDRGQKQVSSTVGHNLMHGHPFAEARFTQANKNINQLVSC 239

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTL 300
               D     E+ E  AL +HA M  + P  +  +  T++ ++RVW  R+ + +P+ FTL
Sbjct: 240 FASGDIEHFMEIVESEALTLHAMMQTSIPYFILMRPNTLEVIQRVWQYRKDTKVPLCFTL 299

Query: 301 DAGPNLKLLFTHKIEETIKQFFPE 324
           DAG N+ LL+       +++F  E
Sbjct: 300 DAGANVHLLYPKTSIAEVQKFIAE 323


>gi|327405190|ref|YP_004346028.1| diphosphomevalonate decarboxylase [Fluviicola taffensis DSM 16823]
 gi|327320698|gb|AEA45190.1| diphosphomevalonate decarboxylase [Fluviicola taffensis DSM 16823]
          Length = 351

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 156/311 (50%), Gaps = 21/311 (6%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
           PSNIA+ KYWGK+ +++    + SL+LS         ++   SD    +    +      
Sbjct: 18  PSNIAIVKYWGKKGNQIPCNSSLSLTLSNSFTEVEAELSEKTSDEAVQLSYYFEGEINEQ 77

Query: 89  FFKKTTQFC----DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI-YSIP 143
           F ++  +F     + F    +    I++SN+ P  AG+ASSAS F A++LAL  I Y I 
Sbjct: 78  FSQRVAKFLFDNREYFPFIGENAITIQSSNSFPHSAGIASSASAFGAISLALLDIAYGIE 137

Query: 144 --EKSESL----SRVARLGSGSACRSFYRGFCEWICGTD---QNGMDSFAVPFNNQWP-- 192
             EK E+     S +ARLGSGSA RS + GF  W  GT+   QN  +  A+      P  
Sbjct: 138 GKEKDETFYMEASNLARLGSGSASRSMFPGFASW--GTNDQIQNSSNEHAIEIKEVHPVF 195

Query: 193 -DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
            +++  +L I D  KK+ S     +  +H P+     +Q +   A + + +   D     
Sbjct: 196 HNMKDAILIIEDEPKKVSSSVGHSLMNNH-PYAENRFKQANERTAELVEILKAGDMEAFI 254

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLF 310
            + E  AL +HA M+ +    L  +  TI  +E++ + R++S +P+ FTLDAGPN+ +L+
Sbjct: 255 HMCESEALTLHAMMMTSMDYYLLVKPGTITAIEKLMEFRKESKVPVCFTLDAGPNVHVLY 314

Query: 311 THKIEETIKQF 321
               E  +++F
Sbjct: 315 PKAYEVQVEEF 325


>gi|120437951|ref|YP_863637.1| diphosphomevalonate decarboxylase [Gramella forsetii KT0803]
 gi|117580101|emb|CAL68570.1| diphosphomevalonate decarboxylase [Gramella forsetii KT0803]
          Length = 380

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 160/321 (49%), Gaps = 40/321 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS------DADCIILNGQK 82
           PSNIAL KYWGK ++++  P N S+S +L H  + T +           D D      +K
Sbjct: 45  PSNIALIKYWGKLENQI--PANPSISFTLDHCKSTTTLKFKKKENPGNFDFDFFFEGKEK 102

Query: 83  ISSQ---SSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
              +     FF++   +C   + +   YF I + N+ P  +G+ASSASG +AL L L ++
Sbjct: 103 EDFKPKIRKFFERIEAYCPYLKDY---YFEIHSENSFPHSSGIASSASGMSALALCLMQL 159

Query: 140 YSIPEKS-------ESLSR----VARLGSGSACRSFYRGFCEWICGTDQ---NGMDSFAV 185
               EK        E  +R    +ARLGSGSA RS       W  G  +   +  D +A+
Sbjct: 160 ----EKELNPKIDKEQFNRKASFLARLGSGSASRSIAGELVVW--GKHEYIESSSDLYAI 213

Query: 186 PFNNQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQA 241
            + +Q    + + +  +L +   EK++ S    ++   H PF  +  +Q + +L  +   
Sbjct: 214 EYPHQVHKNFKNYQDTILLVDKGEKQVSSTIGHDLMHGH-PFAEKRFEQANENLKKLIPV 272

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTL 300
           +   D     ++ E+ AL +HA M+++ P  +  +  T++ + ++W+ R+ + IP  FTL
Sbjct: 273 LKSGDLSAFIKIVEREALSLHAMMMSSQPYFILMKPNTLEIINKIWEFREATKIPACFTL 332

Query: 301 DAGPNLKLLFTHKIEETIKQF 321
           DAG N+ LL+  K ++ + +F
Sbjct: 333 DAGANVHLLYPDKHKDEVLEF 353


>gi|219114256|ref|XP_002176299.1| MPDC mevalonate diphosphate decarboxylase [Phaeodactylum
           tricornutum CCAP 1055/1]
 gi|217402702|gb|EEC42691.1| MPDC mevalonate diphosphate decarboxylase [Phaeodactylum
           tricornutum CCAP 1055/1]
          Length = 415

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 158/334 (47%), Gaps = 42/334 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI----DSDADCIILNGQKI- 83
           P+NIA+ KYWGK D   N P+N+S S++L H   +  +T +    D   D + LNG ++ 
Sbjct: 17  PTNIAVVKYWGKADEHYNTPINSSCSVTL-HQDDLRAVTTVAVSKDFVQDRLWLNGVEVP 75

Query: 84  -SSQSSFFK----------------------KTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
            ++ S  F+                      KT        ++  ++  + + N  PT A
Sbjct: 76  HAATSRRFRACVDGVLALAPDKYHTDDDNNNKTVAIAQ--HEWPTLHVHVSSYNTFPTAA 133

Query: 121 GLASSASGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGT-DQN 178
           GLASSA+G+AAL  AL ++    E      S +AR GSGSACRS Y G   W  GT D+ 
Sbjct: 134 GLASSAAGYAALVAALVQLTGATETFPGEFSTLARQGSGSACRSLYGGLVAWHAGTADEQ 193

Query: 179 GMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDL 235
             DS A    ++  WP LR  +  + D +K   S   M+ +   SP    +    +   +
Sbjct: 194 WRDSRAEQLADEASWPALRAVIAVVSDAQKDTASTAGMQASVKTSPLLAFRAAHVVPQRM 253

Query: 236 AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQS 293
             + QA   +DF   G++  +++ + HAT +   PP+ Y    + Q +  V  ++     
Sbjct: 254 QELTQAWRRRDFPVFGKITMQDSNQFHATCLDTYPPIFYMNDVSRQIIRIVTAYNDYAGE 313

Query: 294 IPIYFTLDAGPN--LKLLFTHK--IEETIKQFFP 323
           I   +TLDAGPN  L +L  H+  +   ++ FFP
Sbjct: 314 IRAAYTLDAGPNVVLYVLEPHRPVLAALLRHFFP 347


>gi|163753333|ref|ZP_02160457.1| mevalonate diphosphate decarboxylase [Kordia algicida OT-1]
 gi|161327065|gb|EDP98390.1| mevalonate diphosphate decarboxylase [Kordia algicida OT-1]
          Length = 360

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 151/313 (48%), Gaps = 23/313 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC------IILNGQK 82
           PSNIAL KYWGK+++++  P N S+S +L    T T ++              +   G++
Sbjct: 25  PSNIALIKYWGKKEAQI--PQNPSISFTLDACATTTKLSYHKKATKAAQFSFELFFEGKQ 82

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-FLIETSNNIPTKAGLASSASGFAALTLALFRIY- 140
                       Q  + +  F K Y F IETSN+ P  +G+ASSASG +AL L L  +  
Sbjct: 83  KDDFKPKINTFLQRIEPYLPFLKDYHFTIETSNSFPHSSGIASSASGMSALALCLMSLEK 142

Query: 141 ----SIPEK--SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM-DSFAVPF----NN 189
               S+ ++  ++  S +ARLGSGSA RS       W    D  G  D F + +    + 
Sbjct: 143 ELNPSMTDEHFNQKASFLARLGSGSASRSIEGDLIVWGTHEDTVGSSDLFGIKYPYKVHE 202

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
            + +    +L +   EK++ S     +  +H PF  Q   Q   +L  ++  + D D  +
Sbjct: 203 VFKNYHDTILLVDKGEKQVSSTVGHNLMHNH-PFAAQRFAQAHENLTKMQSVLADGDLKE 261

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKL 308
              + E  AL +HA M+ + P  +  +  T++ + R+W  RQ+S   + FTLDAG N+ +
Sbjct: 262 FIAIVESEALTLHAMMMTSMPYFILMKPNTLEIINRIWQFRQESGTNVCFTLDAGANVHV 321

Query: 309 LFTHKIEETIKQF 321
           L+    ++ +  F
Sbjct: 322 LYPENEKDKVYPF 334


>gi|218189889|gb|EEC72316.1| hypothetical protein OsI_05509 [Oryza sativa Indica Group]
          Length = 188

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 90/164 (54%), Gaps = 18/164 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG++IS 
Sbjct: 18  PTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEISL 77

Query: 86  QSSFF-------KKTTQFCDLFRQ--------FSKVYFLIETSNNIPTKAGLASSASGFA 130
               F       +K  Q  +  ++        + K++  I + NN PT AGLASS +G  
Sbjct: 78  SGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLASSVAGLV 137

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
                L  + ++ E    LS +AR GSGSACRS Y GF +W  G
Sbjct: 138 CFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMG 181


>gi|123474438|ref|XP_001320402.1| diphosphomevalonate decarboxylase family protein [Trichomonas
           vaginalis G3]
 gi|121903206|gb|EAY08179.1| diphosphomevalonate decarboxylase family protein [Trichomonas
           vaginalis G3]
          Length = 341

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 148/310 (47%), Gaps = 20/310 (6%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGK +     P++ SLS++L    T T       D D   LN +    ++   
Sbjct: 19  NIALVKYWGKENIPEITPIHGSLSVTLNFGVTTTKAEYSSDDVDHFYLNNK----EAEIT 74

Query: 91  KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGL---ASSASGFAALTLALFRIYSIP---- 143
            +     D F    K++F I + N+ PT AGL   A+ A+ F     +L    + P    
Sbjct: 75  SRLKTAIDFFNDNGKLHFNITSVNSFPTAAGLASSAAGAAAFVGALASLVGKTNNPITYW 134

Query: 144 -EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
            +K   L+ +AR  SGS CRS + GF EW+ GT    + +  +   +QW D  +  + + 
Sbjct: 135 MQKGVDLTALARKVSGSGCRSIHGGFVEWVPGTPSESV-AKQIADQHQWEDFVVFSVIVS 193

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQ--ISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
            ++K + S + M+ T    P+   W  Q  +   ++  K+ I ++DF  L E+  + + +
Sbjct: 194 SKKKDVLSTKGMQSTVETVPWI-HWRAQEVVPKRISDAKKFINEKDFASLAEIIMRESNE 252

Query: 261 MHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           +HA  +A  PP+ Y   E+   +  + ++ D  + +I  Y + DAGPN  +  T + E+ 
Sbjct: 253 LHANCLATFPPIKYLNDESFKVVSAIHQLNDDHKINIAAY-SFDAGPNPFVFTTKEHEKA 311

Query: 318 IKQFFPEITI 327
           +     EI I
Sbjct: 312 VLDKLHEIGI 321


>gi|52842257|ref|YP_096056.1| mevalonate diphosphate decarboxylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629368|gb|AAU28109.1| mevalonate diphosphate decarboxylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 322

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 157/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 15  PANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFN 74

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 75  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 132

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++++RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 133 SELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 184

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 185 HQVIVISSQEKEIPSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 243

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L MH        P  Y    T+     +E+ W+ +    P+  T+DAGPN+ LL+  
Sbjct: 244 HEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTMDAGPNVHLLYRS 301

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 302 DQTDLARQF 310


>gi|148359614|ref|YP_001250821.1| mevalonate diphosphate decarboxylase [Legionella pneumophila str.
           Corby]
 gi|296107656|ref|YP_003619357.1| diphosphomevalonate decarboxylase [Legionella pneumophila 2300/99
           Alcoy]
 gi|148281387|gb|ABQ55475.1| mevalonate diphosphate decarboxylase [Legionella pneumophila str.
           Corby]
 gi|295649558|gb|ADG25405.1| diphosphomevalonate decarboxylase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 315

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 157/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           PSNIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 8   PSNIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLSIPGAPEFN 67

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 68  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 125

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++++RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 126 SDLTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 178 HQVIVISSQEKEIPSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 236

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L MH        P  Y    T+     +E+ W+ +    P+  T+DAGPN+ LL+  
Sbjct: 237 HEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTMDAGPNVHLLYRS 294

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 295 DQTDLARQF 303


>gi|54297968|ref|YP_124337.1| hypothetical protein lpp2023 [Legionella pneumophila str. Paris]
 gi|53751753|emb|CAH13175.1| hypothetical protein lpp2023 [Legionella pneumophila str. Paris]
          Length = 315

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 157/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 8   PANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLSIPGAPEFN 67

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 68  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 125

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++++RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 126 SELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 178 HQVIVISSQEKEIPSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 236

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L MH        P  Y    T+     +E+ W+ +    P+  T+DAGPN+ LL+  
Sbjct: 237 HEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTMDAGPNVHLLYRS 294

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 295 DQTDLARQF 303


>gi|307610771|emb|CBX00383.1| hypothetical protein LPW_21041 [Legionella pneumophila 130b]
          Length = 315

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 156/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 8   PANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFN 67

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 68  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 125

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++ +RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 126 SELTQKPLPSIDEQAQWSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 178 HQVIVISSQEKEISSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 236

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L MH        P  Y    T+     +E+ W+ +    P+  T+DAGPN+ LL+  
Sbjct: 237 HEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTMDAGPNVHLLYRS 294

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 295 DQTDLARQF 303


>gi|83596054|gb|ABC25412.1| mevalonate diphosphate decarboxylase [uncultured marine bacterium
           Ant39E11]
          Length = 338

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 154/310 (49%), Gaps = 23/310 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
           PSNIAL KYWGK   +  LP N S+S +L +  + T +++ +     + LNG     + +
Sbjct: 8   PSNIALVKYWGKHGQQ--LPSNPSISFTLSNCRSTTSMSLKEGKGFTVALNG---VDKPA 62

Query: 89  FFKKTTQFCDLFRQ----FSKVYFLIETSNNIPTKAGLASSASGFAALTLALF---RIYS 141
           F  K   + D            +  IE+SN+ P  +G+ASSAS F+A+ L L    R   
Sbjct: 63  FAAKIQTWFDRIDDRLPWLKDHHVTIESSNSFPHSSGIASSASAFSAMALCLLDHARKAG 122

Query: 142 IPEKS----ESLSRVARLGSGSACRSFYRGFCEWICGTDQNG-MDSFAVPFNNQ-WPDLR 195
           +   S    +  S +ARLGSGSA RS   G   W       G  D+ A+P+ ++  PD+ 
Sbjct: 123 LSTMSSDFIQEASLLARLGSGSASRSVMGGLVVWGVHKGTPGSSDNHAIPYPHEVHPDMM 182

Query: 196 I--GLLKIID-REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
               L+ ++D  +K + S    E+   H PF     +Q   ++  ++  +   D     +
Sbjct: 183 SYQDLVLLVDVGQKSVSSSAGHELMAKH-PFAATRFEQAHHNMDALQGILKTGDHWAFID 241

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFT 311
           + E  AL +H  M+ +SP  L  +  T+  ++R+   RQ+  +P+ FTLDAG N+ +L+ 
Sbjct: 242 LIESEALTLHGLMMNSSPSYLLMKPNTLAIIQRIRQFRQEKQVPVGFTLDAGANVHMLYP 301

Query: 312 HKIEETIKQF 321
             ++ T++ F
Sbjct: 302 ESLKSTVESF 311


>gi|54294939|ref|YP_127354.1| hypothetical protein lpl2018 [Legionella pneumophila str. Lens]
 gi|53754771|emb|CAH16258.1| hypothetical protein lpl2018 [Legionella pneumophila str. Lens]
          Length = 315

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 156/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 8   PANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLERLPTKKDIWEPLTIPGAPEFN 67

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 68  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 125

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++ +RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 126 SELTQKPLPSIDEQAQWSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 178 HQVIVISSQEKEIPSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 236

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L MH        P  Y    T+     +E+ W+ +    P+  T+DAGPN+ LL+  
Sbjct: 237 HEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTMDAGPNVHLLYRS 294

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 295 DQTDLARQF 303


>gi|86132443|ref|ZP_01051037.1| diphosphomevalonate decarboxylase [Dokdonia donghaensis MED134]
 gi|85817004|gb|EAQ38188.1| diphosphomevalonate decarboxylase [Dokdonia donghaensis MED134]
          Length = 360

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 164/322 (50%), Gaps = 41/322 (12%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC------IILNGQ- 81
           PSNIAL KYWGK   +  LP N S+S +L +  T T +T   + +        ++L+G+ 
Sbjct: 25  PSNIALVKYWGKHGEQ--LPQNPSISFTLSNCHTTTTLTYKKTASATGEIEFDVLLDGKS 82

Query: 82  ------KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
                 KI   + FF++  ++    +++S   ++I+T+N+ P  +G+ASSASG +AL L 
Sbjct: 83  EPDFKPKI---AKFFERIEKYIPFVKEYS---YVIDTANSFPHSSGIASSASGMSALALC 136

Query: 136 LFRI--YSIPEKS-----ESLSRVARLGSGSACRSFYRGFCEWICGTD-QNGMDSFAVPF 187
           L  I   S P+ +     +  S +ARLGSGSACRS       W    +  N  D F   +
Sbjct: 137 LMEIERQSNPDMTPAYFLQKASFLARLGSGSACRSLDGPLVVWGNHKEISNSSDIFGTSY 196

Query: 188 N----NQWPDLRIGLLKIIDREKKIGSREAMEITRHHS---PFFTQWTQQISTDLAHIKQ 240
           N    + + + +  +L +   EK++ S     +   H+     F+Q    +S  +   + 
Sbjct: 197 NSNVHDNFKNYQDTILLVDKGEKQVSSTVGHGLMHGHAFAKARFSQAHDNLSELMRVFEA 256

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
             +D  FIKL    E  AL +HA M+ + P  +  + +T++ +  +WD RQQ+   + FT
Sbjct: 257 GDVDA-FIKL---VESEALTLHAMMMTSHPYFILMKPKTLEIINEIWDYRQQTGSKVCFT 312

Query: 300 LDAGPNLKLLFTHKIEETIKQF 321
           LDAG N+ +L+    + +++ F
Sbjct: 313 LDAGANVHVLYPENEKYSVQDF 334


>gi|225904435|gb|ACO35355.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
          Length = 206

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 101/180 (56%), Gaps = 18/180 (10%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S   D + LNG
Sbjct: 12  ATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQDRMWLNG 71

Query: 81  QKISSQSSFF--------KKTTQFCDLFR-------QFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     +        K+     D  +        + K++  I + NN PT AGLASS
Sbjct: 72  KEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTAAGLASS 131

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L     ++ ++ E+  + S +AR GSGSAC S Y GF +W  G D +G DS AV
Sbjct: 132 AAGFACLVFTPAKLMNVKEEHGNFSAIARQGSGSACPSMYGGFVKWKMGNDADGSDSIAV 191


>gi|42523132|ref|NP_968512.1| diphosphomevalonate decarboxylase [Bdellovibrio bacteriovorus
           HD100]
 gi|39575337|emb|CAE79505.1| Diphosphomevalonate decarboxylase [Bdellovibrio bacteriovorus
           HD100]
          Length = 326

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 149/310 (48%), Gaps = 30/310 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDAD----CIILNGQKIS 84
           PSNIAL KY GK +   N P N SLS +L +L T   +T +D   D     +  + QKI 
Sbjct: 9   PSNIALIKYMGKIEGSGNKPTNGSLSYTLENLRTYVRLTEVDGAQDQWKPLVREDLQKIE 68

Query: 85  ----SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
                Q  F K      D  +   K  FLIE++NN P+  GLASSAS FAALTLA   ++
Sbjct: 69  LSEKGQQRFIKHLQNLKD--KWGIKQSFLIESANNFPSDCGLASSASSFAALTLAAAEMF 126

Query: 141 SI--PE----KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL 194
               P+      + LS ++R GSGS+CRS +  +  W           +A P   +  +L
Sbjct: 127 QQINPQPWGTDKKYLSELSRQGSGSSCRSLFTPWALW--------QHEYAEPMAFEVKNL 178

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
              ++ + D +K++ S EA ++    SP FT   ++    L  +  A+   D+    ++ 
Sbjct: 179 HHMVVIVEDSKKEVSSSEAHKLVT-TSPRFTGRPERAELRLKDLSMALQFNDWHIARQIV 237

Query: 255 EKNALKMHATMIAASPPLLYWQ---KETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
               + MH     ++P   Y     K+ ++  +  W+ + Q  P+  T+DAG N+ LLF 
Sbjct: 238 WDEFIDMHRLFETSTPSFTYMNDGSKKVLEDCQAFWN-KWQDGPL-VTMDAGANVHLLFR 295

Query: 312 HKIEETIKQF 321
           H  ++   Q+
Sbjct: 296 HDQKKQFAQY 305


>gi|289526975|pdb|3LTO|A Chain A, Crystal Structure Of A Mevalonate Diphosphate
           Decarboxylase From Legionella Pneumophila
 gi|289526976|pdb|3LTO|B Chain B, Crystal Structure Of A Mevalonate Diphosphate
           Decarboxylase From Legionella Pneumophila
          Length = 323

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 95/309 (30%), Positives = 155/309 (50%), Gaps = 29/309 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ---- 81
           P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G     
Sbjct: 8   PANIALIKYXGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFN 67

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT----LAL 136
             + +Q  F     +  + F       FLI++SNN P  +GLASSAS FAALT    +AL
Sbjct: 68  LSVEAQKRFIDHLVRLKEYFGYVGG--FLIQSSNNFPHSSGLASSASSFAALTKCASIAL 125

Query: 137 FRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   P  S +  ++++RLGSGS+CRSFY  +  W  G   + +D   +P+     DL 
Sbjct: 126 SELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW-TGDKVSAID---LPYK----DLL 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  + ++  
Sbjct: 178 HQVIVISSQEKEIPSRVAHKLVK-TSPFYETRSERAEANLKLLLNAFENKDWTSIYQICW 236

Query: 256 KNALKMHATMIAASPPLLYWQKETIQ---GMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
              L  H        P  Y    T+     +E+ W+ +    P+  T DAGPN+ LL+  
Sbjct: 237 HEFLDXHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDG-PV-VTXDAGPNVHLLYRS 294

Query: 313 KIEETIKQF 321
              +  +QF
Sbjct: 295 DQTDLARQF 303


>gi|119587194|gb|EAW66790.1| mevalonate (diphospho) decarboxylase, isoform CRA_a [Homo sapiens]
          Length = 269

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 15/202 (7%)

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPF 187
           AA TLA  R+Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  V  
Sbjct: 3   AAYTLA--RVYGV---ESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAP 57

Query: 188 NNQWPDLRIGLLKIIDREKKI-GSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQ 245
            + WP+LR+ L+ ++  EKK+ GS   M  +   SP      +  +   +A + + I ++
Sbjct: 58  ESHWPELRV-LILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEMARCIRER 116

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAG 303
           DF    ++  K++ + HAT +   PP+ Y    + + +  V  ++A      + +T DAG
Sbjct: 117 DFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAG 176

Query: 304 PNLKLLFTHKIEETIKQFFPEI 325
           PN  ++FT  +++T+ +F   +
Sbjct: 177 PN-AVIFT--LDDTVAEFVAAV 195


>gi|260061656|ref|YP_003194736.1| hypothetical protein RB2501_08645 [Robiginitalea biformata
           HTCC2501]
 gi|88785788|gb|EAR16957.1| hypothetical protein RB2501_08645 [Robiginitalea biformata
           HTCC2501]
          Length = 373

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 145/321 (45%), Gaps = 33/321 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC------IILNGQK 82
           PSNIAL KYWGKRD +  LP N S+S +L    T T I     +         + L+G  
Sbjct: 25  PSNIALVKYWGKRDGQ--LPTNPSVSFTLEACRTSTRIAYSPLEQSVKGPRFRVFLDG-- 80

Query: 83  ISSQSSFFKKTTQFCDLFRQF----SKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                 F  K  QF +    +    S ++  I T N+ P  +G+ASSASG AAL L L  
Sbjct: 81  -FPAPDFEPKIRQFLERALPYAPFLSGLHLEIRTENSFPHSSGIASSASGMAALALCLVS 139

Query: 139 IYS--IPEKSESLSR-----VARLGSGSACRSFYRGFCEWICGTDQNGM----DSFAVPF 187
           +    +P      +R     +ARLGSGSA RS   G   W    +Q G+    D   VP+
Sbjct: 140 LEEQLLPGTDPGYARRKASFLARLGSGSAARSTAGGLILW---GEQEGIPESTDLLGVPY 196

Query: 188 NNQWPDL---RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
             +  ++       + ++D+ +K  S           PF  +  +Q    L  +      
Sbjct: 197 PGEVHEVFHTYHDTILLVDKGQKTVSSSVGHGLMDGHPFAAERFEQARRHLEKLGGIFAS 256

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSI-PIYFTLDAG 303
            D      + E  AL +HA M+ ++P  +  +  T++ +E++ D R+++  P+ FTLDAG
Sbjct: 257 GDLEAFANLVESEALSLHAMMLTSTPSFILMKPGTLEIIEKIRDYRRETGHPVCFTLDAG 316

Query: 304 PNLKLLFTHKIEETIKQFFPE 324
            N+ +L+       +  F  E
Sbjct: 317 ANVHVLYPEASAGPVYSFIRE 337


>gi|330718590|ref|ZP_08313190.1| diphosphomevalonate decarboxylase [Leuconostoc fallax KCTC 3537]
          Length = 202

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 100/195 (51%), Gaps = 10/195 (5%)

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
           +LSR+AR GSGSA RSF+  F  W  G D +   SFA   +     + + + ++  ++KK
Sbjct: 9   TLSRLARRGSGSASRSFFGHFAVWHAGIDND--SSFAESLHAPAMPIALVVAEVSSQQKK 66

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH-ATMI 266
           +GS E M+     SP +  W          ++ A++  D  K+G +AE NA+ MH   + 
Sbjct: 67  VGSTEGMQRAL-TSPDYGNWVNNSQQQFIDMQSAVMAADIEKIGTIAEANAMSMHDLNLT 125

Query: 267 AASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK-----IEETIKQF 321
           A   P  Y+  ET + ++ V D + Q +  + T+DAGPN+K++ TH      I +T+   
Sbjct: 126 ATQHPFTYFTAETQRILQIVDDLKHQGLLAFATMDAGPNVKII-THVEHAQLIIQTLNNA 184

Query: 322 FPEITIIDPLDSPDL 336
            P + +      PD+
Sbjct: 185 LPNLKLEIAQSGPDI 199


>gi|194770049|ref|XP_001967111.1| GF15902 [Drosophila ananassae]
 gi|190618582|gb|EDV34106.1| GF15902 [Drosophila ananassae]
          Length = 800

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 118/228 (51%), Gaps = 9/228 (3%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFC 169
           +++ NN PT AGLASSA+G+A L  +L  +Y IP  ++ L+ VAR GSGSACRS Y GF 
Sbjct: 43  VKSFNNFPTAAGLASSAAGYACLVYSLACLYGIP-VNDQLTTVARQGSGSACRSLYGGFV 101

Query: 170 EWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
           +W  G   +G DS A  V  +  WP++ + +L + D+ K  GS   M+ +   S      
Sbjct: 102 QWHRGNLDSGCDSVAKQVVSSKFWPNMHLIILVVNDQRKNTGSTLGMQRSVQTSQLIQHR 161

Query: 228 TQQISTD-LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV 286
             ++  + +  +K AI   DF    ++  K++ + HA  +   PP +Y  + +   +  V
Sbjct: 162 ADKVVPERVNQLKTAIHKHDFDTFAKITMKDSNQFHAIAMDTYPPCVYMNETSHSIVSFV 221

Query: 287 WDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
            D  +   S  I +T DAGPN  L   + +EE I +    I    P D
Sbjct: 222 HDFNELMGSSLIAYTFDAGPNACL---YVLEENIPKLIYAINKAFPND 266


>gi|254495128|ref|ZP_05108052.1| diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
 gi|85819478|gb|EAQ40635.1| diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
          Length = 359

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 153/320 (47%), Gaps = 38/320 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADC---IILNGQKI 83
           PSNIAL KYWGK + ++  P N S+S +L +  TIT I    I+   +    +   G+K 
Sbjct: 25  PSNIALVKYWGKSNPQI--PKNASISFTLNNCHTITTIEFEKIEKTTEVTFDLFFEGKKK 82

Query: 84  SS----QSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
                  + FFK+   +C     +      I + N+ P  +G+ASSASG +A+ + L  +
Sbjct: 83  EEFKPKIAEFFKRIQDYCPYIFNYK---MTINSENSFPHSSGIASSASGLSAIAMCLMSL 139

Query: 140 YSIPEKSESLSR---------VARLGSGSACRSFYRGFCEW------ICGTDQNGMD-SF 183
            +  E  + LS+         +ARLGSGSA RS       W      +  +D  G+   F
Sbjct: 140 EN--ELVQDLSQDFINKKASFLARLGSGSASRSIEGPLVVWGEHPAIVESSDLYGVQFPF 197

Query: 184 AV-PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAI 242
            V P    + D+   +L +   EK++ S     +  +H P+ T   QQ + +L  I   +
Sbjct: 198 KVDPIFQNYQDV---ILLVDKGEKQVSSTVGHNLMHNH-PYATNRFQQANDNLGKITTIL 253

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP-IYFTLD 301
            +    +   + E  AL +HA M+ +SP  +  +  T++ +  +W+ R  +   I FTLD
Sbjct: 254 QEGKIKEFIHLVESEALTLHAMMLTSSPYFILMKPNTLEIINSIWEYRNNTNSNICFTLD 313

Query: 302 AGPNLKLLFTHKIEETIKQF 321
           AG N+ +LF    ++ + QF
Sbjct: 314 AGANVHVLFPENEKDEVLQF 333


>gi|323306522|gb|EGA59916.1| Mvd1p [Saccharomyces cerevisiae FostersO]
          Length = 199

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 99/188 (52%), Gaps = 10/188 (5%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFC 169
           I + NN PT AGLASSA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+ 
Sbjct: 18  IVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYV 77

Query: 170 EWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
            W  G  ++G DS AV    ++ WP ++  +L + D +K + S + M++T   S  F + 
Sbjct: 78  AWEMGKAEDGHDSMAVQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKER 137

Query: 228 TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW 287
            + +      + +  I +    L +    ++   HAT     PP +          ER +
Sbjct: 138 IEHVVPKRFEVMRKAIVEKIRHLAKETMMDSNSFHATCFGLFPPNIL--------HERHF 189

Query: 288 DARQQSIP 295
            A  Q +P
Sbjct: 190 QAYHQLVP 197


>gi|301166760|emb|CBW26337.1| mevalonate diphosphate decarboxylase [Bacteriovorax marinus SJ]
          Length = 362

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 156/315 (49%), Gaps = 24/315 (7%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILNGQKISSQ 86
           PSNIAL KYWGK   +L  P N S+S +L    T    +    D+ +D I+L+    + +
Sbjct: 25  PSNIALIKYWGKYGHQL--PCNTSISFTLNESKTTMDFSWSSKDTPSDEIVLDFYFENKK 82

Query: 87  SSFFK-KTTQFCDLFRQ-FSKVYFL---IETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +  F+ K   F +  R+ F  + FL   IE++N+ P  AG+ASSAS  +AL L L  I +
Sbjct: 83  NQLFEDKIRAFLEKNRELFPMLKFLNLEIESTNSFPHSAGIASSASSMSALALGLCSIEN 142

Query: 142 ------IPEKS--ESLSRVARLGSGSACRSFYRGFCEWICGT--DQNGMDSFAVPF---N 188
                 I E    +  + VARL SGSA RS +     W   T       D  A P    +
Sbjct: 143 QAFDLDICEADLIQKATYVARLASGSASRSVFPEVASWGENTLTSIKSSDELAAPVEGVH 202

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
             +   R  ++ +   EK + SR    +   H P+  +  ++ +  +  +   +   D  
Sbjct: 203 EVFKTYRDSIVIVDGGEKAVSSRAGHALMEAH-PYREERFKRANELVETLYNILKSGDTK 261

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLK 307
              ++ E  AL++H  M+ ++P  +  +  T+  +E++ + R++S + + FTLDAGPN+ 
Sbjct: 262 SFCDLVETEALELHGLMMNSNPSFILMKPNTLAVIEKIREFRKESGLDLCFTLDAGPNVH 321

Query: 308 LLFTHKIEETIKQFF 322
           +L+   IEE +++F 
Sbjct: 322 ILYPQSIEEEVQKFL 336


>gi|225012603|ref|ZP_03703038.1| GHMP kinase [Flavobacteria bacterium MS024-2A]
 gi|225003136|gb|EEG41111.1| GHMP kinase [Flavobacteria bacterium MS024-2A]
          Length = 356

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 105/339 (30%), Positives = 163/339 (48%), Gaps = 37/339 (10%)

Query: 12  YIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-- 69
           +I      IN  ++   PSNIAL KYWGK + +L  P N SLS +L +  T T +     
Sbjct: 6   FIASAALPINYTTTWEAPSNIALIKYWGKYEPQL--PKNPSLSFTLSNSKTKTKVIFTPH 63

Query: 70  ---DSDADCIILNGQKISSQ---SSFFKKTTQFCD-LFRQFSKVYFLIETSNNIPTKAGL 122
              + D +      QK   +    +FF +  ++   +F    +V+    + N+ P  +G+
Sbjct: 64  AKNEIDFEFFFHGIQKPDFKPKLKTFFDRIGEYIPWIFSYHLEVF----SENSFPHSSGI 119

Query: 123 ASSASGFAALTLALFRIYS--IPEKS-----ESLSRVARLGSGSACRSFYRGFCEW-ICG 174
           ASSAS  AAL+L L  +     PE       +  S +ARLGSGSA RS       W    
Sbjct: 120 ASSASSMAALSLCLMDLERQLFPEMETVYFYQKASFLARLGSGSAARSIQGPVIFWGKNA 179

Query: 175 TDQNGMDSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF----FTQ 226
              +  D FA PF    ++ + + +  +L +    K + S +   +   H PF    F Q
Sbjct: 180 VRDSSSDLFATPFGTTLHSVFDNYQDTILLVDKGSKPVSSTQGHNLMHGH-PFAENRFLQ 238

Query: 227 WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV 286
            +  +S+ +  ++   +D DFI L E+    AL +HA M+ +SP  +  Q  T+  + RV
Sbjct: 239 ASNNLSSLVPIMETGALD-DFIHLVEL---EALSLHAMMLTSSPYFILMQPNTLAIIHRV 294

Query: 287 WDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           W+ R++ SIP+ FTLDAG N+ LL+  +    I  F  E
Sbjct: 295 WEFRKETSIPLCFTLDAGANVHLLYPKQDIGVIHSFIKE 333


>gi|254496228|ref|ZP_05109122.1| mevalonate diphosphate decarboxylase [Legionella drancourtii
           LLAP12]
 gi|254354533|gb|EET13174.1| mevalonate diphosphate decarboxylase [Legionella drancourtii
           LLAP12]
          Length = 322

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 157/313 (50%), Gaps = 31/313 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISS 85
           A  P+NIAL KY GK+D   N P N+SLS SL +L +   +  I+S  D  +    K   
Sbjct: 12  AHAPANIALIKYMGKKDESSNNPDNSSLSYSLNNLLSTVKLEQINSKDD--VWEPLKTPG 69

Query: 86  QSSFFKK---TTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALT-LAL 136
              F       T+F +   +  K +     FL+++ NN P  +G+ASSAS FAALT  A+
Sbjct: 70  VPEFALSEVGKTKFLNHLARIKKRFAYDGGFLVQSCNNFPHSSGMASSASSFAALTRCAV 129

Query: 137 FRIYSIPEKS----ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
           F +  + +K     +  + ++RLGSGS+CRSFY  +  W     ++ + +  +P+    P
Sbjct: 130 FALAELTQKEILSVDEQAYISRLGSGSSCRSFYSPWALW----QEDKVTAIDLPY----P 181

Query: 193 DLRIGLLKIIDREKK-IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
           +L +  + +ID EKK + S EA +  +    + T+ +Q+    L  +  A    D+ K  
Sbjct: 182 EL-VHQVVVIDAEKKEVSSSEAHKRVKSSDLYVTR-SQRAEEHLTLLLAAFKANDWGKAY 239

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNLKL 308
           ++  +    MH      + P  Y  + +   +  +E++WD +    P+  T+DAGPN+ L
Sbjct: 240 QICWREFQDMHQLFNTCAQPFSYITENSLAVLNDLEQLWDKKGDG-PL-VTMDAGPNIHL 297

Query: 309 LFTHKIEETIKQF 321
           L+     E  ++F
Sbjct: 298 LYRPDQIEMAREF 310


>gi|88801344|ref|ZP_01116872.1| hypothetical protein PI23P_01757 [Polaribacter irgensii 23-P]
 gi|88782002|gb|EAR13179.1| hypothetical protein PI23P_01757 [Polaribacter irgensii 23-P]
          Length = 359

 Score = 92.4 bits (228), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/319 (28%), Positives = 151/319 (47%), Gaps = 36/319 (11%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID------SDADCIILNGQK 82
           PSNIAL KYWGK D +  LP N S+S +L +  T T I          +D D      +K
Sbjct: 25  PSNIALVKYWGKSDPQ--LPKNASISFTLNNCHTRTTIGFSKQESKACADFDLFFEGKEK 82

Query: 83  ISSQ---SSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
              +   + FFK+   +C     +     +I ++N+ P  +G+ASSASG +A+ + L  +
Sbjct: 83  EEFKPKIADFFKRVQIYCPYVLDYK---MIISSTNSFPHSSGIASSASGLSAIAMCLMSL 139

Query: 140 YSIPEKS-------ESLSRVARLGSGSACRSFYRGFCEW-----ICGTDQNGMDSFAVPF 187
                 S       +  S +ARLGSGSA RS       W     I G+       F    
Sbjct: 140 EQALNPSLTAAFIIKKASFLARLGSGSASRSIEGPLVVWGEHPAIVGSSDVFGIQFPYKV 199

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF----FTQWTQQISTDLAHIKQAII 243
           +  + + +  +L +   EK++ S     +   H P+    F Q  + +S  ++ I Q   
Sbjct: 200 HAVFENYQDAILLVDKGEKQVSSTLGHNLMHDH-PYAENRFVQANENVS-KMSEILQKGA 257

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIPIYFTLDA 302
            + F+ L    E  AL +HA M+ ++P  +  +  T++ ++++W+ R  ++  I FTLDA
Sbjct: 258 LKAFVNL---VESEALALHAMMLTSTPYFILMKPNTLEIIQKIWEFRVAENSNICFTLDA 314

Query: 303 GPNLKLLFTHKIEETIKQF 321
           G N+ +L+    +E I +F
Sbjct: 315 GANVHILYPFNEKEKINRF 333


>gi|149370070|ref|ZP_01889921.1| hypothetical protein SCB49_03314 [unidentified eubacterium SCB49]
 gi|149356561|gb|EDM45117.1| hypothetical protein SCB49_03314 [unidentified eubacterium SCB49]
          Length = 366

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 152/322 (47%), Gaps = 35/322 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC-----IILNGQK- 82
           PSNIAL KYWGK   +  +P N S+S +L +  T T +T    + +      + L+G + 
Sbjct: 25  PSNIALVKYWGKYGEQ--MPQNASVSFTLSNCRTETTLTYTKKENNGSYAFEVYLDGNRE 82

Query: 83  ---ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
                    FF +  Q+    R +S   F I+T N  P  +G+ASSASG +AL + L  I
Sbjct: 83  VGFEPKIKKFFDRIVQYVPFIRAYS---FKIDTKNTFPHSSGIASSASGMSALAVCLVAI 139

Query: 140 YSIPEKSESLSR--------------VARLGSGSACRSFYRGFCEWICGTDQNGMDS-FA 184
            S    + +LS               +ARLGSGSA RS       W    +  G  + F 
Sbjct: 140 ESQLLGATNLSTAEETKNSTTQKASFLARLGSGSAARSLEGPLVVWGEHPNIKGSSNLFG 199

Query: 185 VPFNNQ----WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           V +  +    + + +  +L +   EK++ S    ++  + +P+     ++ + +L  +  
Sbjct: 200 VKYEGEVHENFRNYQDTILLVDKGEKQVSSTVGHDLM-NDNPYAEARFKEANDNLLKLTT 258

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
              + +     ++ E  AL++H  M+A+ P  +  +  T++ + R+W  R ++   + FT
Sbjct: 259 VFKNGNVDTFIKLVESEALQLHGMMMASKPYFILMKPNTLEIINRIWAYRNETESKVCFT 318

Query: 300 LDAGPNLKLLFTHKIEETIKQF 321
           LDAG N+ +L+    +  I++F
Sbjct: 319 LDAGANVHVLYPENEKTVIQEF 340


>gi|284164373|ref|YP_003402652.1| diphosphomevalonate decarboxylase [Haloterrigena turkmenica DSM
           5511]
 gi|284014028|gb|ADB59979.1| diphosphomevalonate decarboxylase [Haloterrigena turkmenica DSM
           5511]
          Length = 327

 Score = 89.4 bits (220), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 156/320 (48%), Gaps = 22/320 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQ 81
           K++A       L KY G RD    LP ++S+SL      T T +   +D + D  +++G+
Sbjct: 2   KATAMAHPIQGLVKYHGMRDEIERLPYHDSISLCTAPSHTRTTVEFSMDYEEDTFVVDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK----VY-FLIETSNNIPTKAGLASSASGFAALTLAL 136
           ++  ++  +++     +  R  S     VY   +E+ N+ P+  GL SS+SGFAA  +AL
Sbjct: 62  ELDGRA--YERVEAVVEKARSKSDAAHTVYPVRLESENSFPSNVGLGSSSSGFAAAAMAL 119

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRI 196
                +    + +S +AR+GS SA R+    F +   G +     S  +P ++   DL+I
Sbjct: 120 AEAAELDASRQEISTIARVGSASAARAVTGAFSQLHTGLNDEDCRSRRIP-SDLHEDLKI 178

Query: 197 --GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
             GL+    +E +   REA +     S  F      I   +A ++ A+ + +F +  E+A
Sbjct: 179 VVGLVP-YHKETEDAHREAAD-----SHMFQARNAHIHGQIAEMRDALRNNEFDRAFELA 232

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTH- 312
           E+++L + AT +      +YWQ  T++    V + R++  IP+YF+ D G ++ +  T  
Sbjct: 233 EQDSLSLAATTMTGPSGWVYWQPATLKIFNTVRELREEEDIPVYFSTDTGASVYVNTTEE 292

Query: 313 ---KIEETIKQFFPEITIID 329
              ++EE +       T+ D
Sbjct: 293 HVDEVEEAVSDCGVSTTVWD 312


>gi|17537203|ref|NP_496967.1| hypothetical protein Y48B6A.13 [Caenorhabditis elegans]
 gi|5824804|emb|CAB54447.1| C. elegans protein Y48B6A.13a, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 326

 Score = 89.0 bits (219), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 121/243 (49%), Gaps = 8/243 (3%)

Query: 107 YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYR 166
           +F + ++ N P  AGLASSA+GFAA+ LA+ RI  + +     +R+AR+GSGSACRS Y 
Sbjct: 64  HFHVTSTTNFPVAAGLASSAAGFAAIALAIQRILRLDDSQ--ANRLARIGSGSACRSMYG 121

Query: 167 GFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF 224
           G   W  G   +G D  AV       W DL   +L   D  KK+GS E M  +R  S   
Sbjct: 122 GLVHWRKGEMDDGSDCLAVRTEAAANWEDLYCIILVFDDGRKKVGSSEGMRRSRETSQLL 181

Query: 225 TQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
               + I    +  I++A   ++F +L  V   ++ + HA  + ++PP+ Y  + + Q +
Sbjct: 182 KHRIESIVPQRIQQIQEAYTSRNFEQLARVIMADSNQFHAVCMDSTPPIRYLNEASWQLI 241

Query: 284 ERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSL 343
           + V +     I   +T DAGPN  ++     +E   QF   +     + S DL      L
Sbjct: 242 DTVEEFNIGGIRAAYTFDAGPNACVIVQ---KENASQFLKAVLQTIQVPSEDLQVIGKEL 298

Query: 344 SQK 346
           +++
Sbjct: 299 AEQ 301


>gi|270159824|ref|ZP_06188480.1| mevalonate diphosphate decarboxylase [Legionella longbeachae
           D-4968]
 gi|289165418|ref|YP_003455556.1| diphosphomevalonate decarboxylase [Legionella longbeachae NSW150]
 gi|269988163|gb|EEZ94418.1| mevalonate diphosphate decarboxylase [Legionella longbeachae
           D-4968]
 gi|288858591|emb|CBJ12472.1| putative diphosphomevalonate decarboxylase [Legionella longbeachae
           NSW150]
          Length = 316

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 152/313 (48%), Gaps = 30/313 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQ- 81
           A  P+NIAL KY GK+D   N P N+SLS +L +L +   +  + S  D    +I+ G  
Sbjct: 5   AHAPANIALIKYMGKKDESSNAPDNSSLSYTLDNLISTVRLEKLSSKKDIWEPLIVPGGI 64

Query: 82  -----KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT--- 133
                    Q  F     +    F    +  FL+++ NN P  +G+ASSAS FAALT   
Sbjct: 65  DELVISPEGQKRFLDHLARIKSHFDY--EAGFLVQSCNNFPHSSGMASSASSFAALTRCA 122

Query: 134 -LALFRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
            +AL  +   P  S +  ++++RLGSGS+CRSFY  +  W      + + +  +P+    
Sbjct: 123 SIALSELTQKPMPSIDEQAQLSRLGSGSSCRSFYSPWALW----QDDKVKAVELPYQQL- 177

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
             +  G++ + +++K++ S EA +  +  S F+    Q+   +L  +  A+I +D+    
Sbjct: 178 --IYQGII-VSNKKKEVPSSEAHKRVK-TSSFYATRAQEAEDNLKLLLNALISKDWASAY 233

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKET---IQGMERVWDARQQSIPIYFTLDAGPNLKL 308
           ++       MH        P  Y  + +   +  +E  WD +    PI  T+DAGPN+ L
Sbjct: 234 QICWYEFQSMHRLFHTCEQPFSYMTENSTDLLHHLEDFWDKKGDG-PI-VTMDAGPNIHL 291

Query: 309 LFTHKIEETIKQF 321
           L+    ++  ++F
Sbjct: 2