BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781016|ref|YP_003065429.1| diphosphomevalonate
decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781016|ref|YP_003065429.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040693|gb|ACT57489.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 355

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL
Sbjct: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA
Sbjct: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM
Sbjct: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ
Sbjct: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL
Sbjct: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK
Sbjct: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355


>gi|315122513|ref|YP_004063002.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495915|gb|ADR52514.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 351

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 277/351 (78%), Positives = 308/351 (87%), Gaps = 2/351 (0%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           M LSLRHIL  Y+G+C+P+IN+K SAFLPSNIALCKYWGKRD KLNLPLNNSLSLSLG L
Sbjct: 1   MPLSLRHILRIYLGKCSPQINKKGSAFLPSNIALCKYWGKRDEKLNLPLNNSLSLSLGRL 60

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GT+T ITVI+++ DCIILNGQK+S QS FFKKTTQFCDLFRQF KVYFLIET NNIPTKA
Sbjct: 61  GTLTEITVINANEDCIILNGQKVSPQSDFFKKTTQFCDLFRQFEKVYFLIETFNNIPTKA 120

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAALTLALFR+YS+PE  E+LSRVARLGSGSACRSFYRGFCEWICGTD NG+
Sbjct: 121 GLASSASGFAALTLALFRLYSLPEHIETLSRVARLGSGSACRSFYRGFCEWICGTDPNGI 180

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DSFA+P  NQWPDLRIGLL II+ EKKIGSREAMEITRH SPFFTQW QQI  D AHIKQ
Sbjct: 181 DSFAIPLKNQWPDLRIGLLNIIETEKKIGSREAMEITRHSSPFFTQWNQQIPVDFAHIKQ 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI+DQDFIKLGEV+E NALKMHATM+ ASP +LYWQ+ETI+GM+RVW+ARQ+SIPIYFTL
Sbjct: 241 AIVDQDFIKLGEVSENNALKMHATMLTASPSILYWQEETIKGMQRVWNARQKSIPIYFTL 300

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD--SLSQKNSI 349
           DAGPNLK LFTH  EE I++ FPEI +I+PLDSP+L S KD   L  +   
Sbjct: 301 DAGPNLKFLFTHDKEEIIRENFPEIMVINPLDSPNLQSNKDDFQLGNRYIT 351


>gi|154707588|ref|YP_001424026.1| diphosphomevalonate decarboxylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165918973|ref|ZP_02219059.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 334]
 gi|154356874|gb|ABS78336.1| diphosphomevalonate decarboxylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165917298|gb|EDR35902.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 334]
          Length = 503

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/351 (44%), Positives = 209/351 (59%), Gaps = 3/351 (0%)

Query: 5   LRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G   
Sbjct: 2   RKQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATA 61

Query: 65  HITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLAS
Sbjct: 62  AISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A
Sbjct: 121 SACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYA 180

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  
Sbjct: 181 EPLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAK 240

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGP
Sbjct: 241 KDFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           N+KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 301 NIKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|212212910|ref|YP_002303846.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuG_Q212]
 gi|212011320|gb|ACJ18701.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuG_Q212]
          Length = 503

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/351 (44%), Positives = 209/351 (59%), Gaps = 3/351 (0%)

Query: 5   LRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G   
Sbjct: 2   RKQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATA 61

Query: 65  HITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLAS
Sbjct: 62  AISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A
Sbjct: 121 SACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYA 180

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  
Sbjct: 181 EPLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAK 240

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGP
Sbjct: 241 KDFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           N+KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 301 NIKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|29653945|ref|NP_819637.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 493]
 gi|29541208|gb|AAO90151.1| diphosphomevalonate decarboxylase [Coxiella burnetii RSA 493]
          Length = 503

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/351 (44%), Positives = 209/351 (59%), Gaps = 3/351 (0%)

Query: 5   LRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G   
Sbjct: 2   RKQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATA 61

Query: 65  HITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLAS
Sbjct: 62  AISPSSTNQHELIINNQPIAIYSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A
Sbjct: 121 SACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYA 180

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  
Sbjct: 181 EPLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAK 240

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGP
Sbjct: 241 KDFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           N+KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 301 NIKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|153207695|ref|ZP_01946342.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218972|ref|YP_002305759.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuK_Q154]
 gi|120576391|gb|EAX33015.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii 'MSU Goat Q177']
 gi|212013234|gb|ACJ20614.1| diphosphomevalonate decarboxylase [Coxiella burnetii CbuK_Q154]
          Length = 503

 Score =  373 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/351 (44%), Positives = 208/351 (59%), Gaps = 3/351 (0%)

Query: 5   LRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G   
Sbjct: 2   RKQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATA 61

Query: 65  HITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP  AGLAS
Sbjct: 62  AISPSSTNQHELIINNQPIAIHSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLAAGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS+A
Sbjct: 121 SACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSYA 180

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            P    WP L IGL  +  + K + SRE M  T   SP ++ W +  + DL  +K+AI  
Sbjct: 181 EPLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEIANRDLTQLKKAIAK 240

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGP
Sbjct: 241 KDFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           N+KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 301 NIKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|161831576|ref|YP_001596532.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 331]
 gi|161763443|gb|ABX79085.1| diphosphomevalonate decarboxylase/isopentenyl-diphosphate
           delta-isomerase [Coxiella burnetii RSA 331]
          Length = 503

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 156/351 (44%), Positives = 207/351 (58%), Gaps = 3/351 (0%)

Query: 5   LRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            + I H+ + + +        AF PSNIALCKYWGKR+ +LNLP+ +SLS+SLG  G   
Sbjct: 2   RKQIFHQLLSQRSKSPQSSGHAFAPSNIALCKYWGKRNLELNLPVTSSLSISLGDKGATA 61

Query: 65  HITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
            I+   ++   +I+N Q I+  S+  K+   F + F  F  V + +E + NIP   GLAS
Sbjct: 62  AISPSSTNQHELIINNQPIAIYSTHAKQLLAFLEAF-NFLGVKYHLELNFNIPLATGLAS 120

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA  +AA+  AL   +      +SLS +ARLGSGSACRS + GF EW CG D +GMDS A
Sbjct: 121 SACAYAAIVKALDNFFEWQLDRKSLSILARLGSGSACRSVFNGFVEWYCGKDPDGMDSHA 180

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
            P    WP L IGL  +  + K + SRE M  T   SP ++ W ++ + DL  +K+AI  
Sbjct: 181 EPLVENWPGLCIGLCILNQKPKTVSSREGMRRTVTTSPLYSAWPEKANRDLTQLKKAIAK 240

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF  LG  AE NAL MHATM+AA PPLLY   ETI  M+++W  R+    IYFT DAGP
Sbjct: 241 KDFNLLGRTAESNALAMHATMLAAWPPLLYSSPETITVMQKIWSLREAGTEIYFTQDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           N+KLLF    +E IKQ FPEI II P  +      +  L  +N   LGI +
Sbjct: 301 NIKLLFLESNKEKIKQSFPEIEIISPFKTSR--EQRVVLVDENDRRLGIEE 349


>gi|78486075|ref|YP_392000.1| diphosphomevalonate decarboxylase [Thiomicrospira crunogena XCL-2]
 gi|78364361|gb|ABB42326.1| diphosphomevalonate decarboxylase [Thiomicrospira crunogena XCL-2]
          Length = 332

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 152/334 (45%), Positives = 201/334 (60%), Gaps = 2/334 (0%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           M    R  + + I   +    +K +   P NIAL KYWGKR+  LNLP N+SLS+SL  L
Sbjct: 1   MKNKQRDFVDQII--PHRTPTQKGTGKAPVNIALSKYWGKRNVDLNLPTNSSLSISLPGL 58

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           GT T I  +++ +D I LN  K++S  SF ++   F DLFR  ++  F++ T N++PT A
Sbjct: 59  GTKTQIEWVENQSDHIYLNETKVASDDSFAQRIRLFLDLFRPNTQGGFIVNTLNSVPTAA 118

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASG+AAL LAL   +      + LS +ARLGSGSA RS Y GF  W  G   NGM
Sbjct: 119 GLASSASGYAALVLALNDCFQWDLPLKRLSLLARLGSGSASRSLYDGFALWHKGQLDNGM 178

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DS+A   +  WP+L IGLL+I    K I S + M+ T +H   +  W  +   DL    Q
Sbjct: 179 DSYAEKIDQAWPELCIGLLEIDVSTKPISSTQGMQNTVNHCELYQAWPDKAEADLQKTHQ 238

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI D+DF +LG+ +E NAL MHATMIA  PP+LYWQ E++  M +VW  R +   +YFT+
Sbjct: 239 AIQDKDFQQLGQTSENNALAMHATMIATWPPILYWQPESVAAMHKVWQLRAEGCDVYFTM 298

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
           DAGPNLKLLF  +    I+  FP I +I P    
Sbjct: 299 DAGPNLKLLFLKQDAPMIQTHFPSIKVIQPFSDT 332


>gi|332686202|ref|YP_004455976.1| diphosphomevalonate decarboxylase [Melissococcus plutonius ATCC
           35311]
 gi|332370211|dbj|BAK21167.1| diphosphomevalonate decarboxylase [Melissococcus plutonius ATCC
           35311]
          Length = 333

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 137/332 (41%), Positives = 188/332 (56%), Gaps = 9/332 (2%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           N   SA   +NIAL KYWGK+D+ L +P+NNSLSL+L    T T +    S + D   LN
Sbjct: 2   NNMGSARAYTNIALIKYWGKKDNSLIIPMNNSLSLTLDAFYTDTTVKFTSSLNEDQFFLN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ+ +S+    KK  QF +  RQ   V  Y  IE+ N++PT AGLASSASGFAAL  A  
Sbjct: 62  GQRQTSKEE--KKIHQFLNFIRQSFGVNEYAKIESKNHVPTGAGLASSASGFAALAGACS 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
               +    + LSR+AR GSGSACRS Y GF EW  GT      +  +  +N   +L + 
Sbjct: 120 EALHLNLSLKELSRLARRGSGSACRSIYGGFSEWEKGTKDENSFALPLFADNWEKELAML 179

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + + D+ K++ SR  M+ T   S F+  W + +  DL   K AI ++DF  LG+  E N
Sbjct: 180 FIVVNDQIKEVSSRSGMQKTVETSCFYPGWLETVDKDLKQAKHAIKEKDFQLLGKTIEAN 239

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           ALKMHAT + A PP  YW +E+++ M+ +  AR+Q IP YFT+DAGPN+K+L   K  + 
Sbjct: 240 ALKMHATTLGAHPPFTYWSEESMKAMKSIRQARKQGIPCYFTMDAGPNVKVLVEKKNLKI 299

Query: 318 ----IKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
               +  FF E  +I  L  P +   K+    
Sbjct: 300 LHDFLINFFSENQLISALAGPGICILKERRQN 331


>gi|89094695|ref|ZP_01167631.1| diphosphomevalonate decarboxylase [Oceanospirillum sp. MED92]
 gi|89081041|gb|EAR60277.1| diphosphomevalonate decarboxylase [Oceanospirillum sp. MED92]
          Length = 334

 Score =  366 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 160/329 (48%), Positives = 216/329 (65%), Gaps = 1/329 (0%)

Query: 1   MSLSLRHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL 60
           MS++ + +++  + E   ++   + AF PSNIALCKYWGKR+++LNLP+N SLS+SLG L
Sbjct: 1   MSITKQSVVNSILTEST-QLGTAAEAFAPSNIALCKYWGKREAELNLPINGSLSISLGEL 59

Query: 61  GTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKA 120
           G+ T I   DS +D + LN + I     F  K   F +LFR+  +   +I+T NNIPT A
Sbjct: 60  GSRTSIVESDSGSDQVYLNDKLIEPTDRFATKVISFLNLFRRELQQPVVIKTVNNIPTAA 119

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAAL LA+   Y     +E LS  AR+GSGSA RS ++GF EW  G  ++GM
Sbjct: 120 GLASSASGFAALMLAINDFYRFGLGNEVLSAFARMGSGSASRSVFQGFVEWQKGLREDGM 179

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           DS A   + +W   RIGLLK+    KK+ SR  M+ T   +P +  W +Q + DL  IK+
Sbjct: 180 DSCAQRLDLEWQGFRIGLLKVATGAKKVDSRAGMQRTVESAPLYQAWPEQAAKDLQTIKR 239

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI D+D   LG+ AE+NAL MHATMI + PPLLYWQ E++  M RVW+ R   +P+Y T+
Sbjct: 240 AIEDKDIELLGQTAEQNALSMHATMIGSWPPLLYWQPESVAAMHRVWELRALGVPVYLTM 299

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIID 329
           DAGPNLKLLFT + E  ++  FPE+T +D
Sbjct: 300 DAGPNLKLLFTAEYEAQVRDAFPELTDLD 328


>gi|170099423|ref|XP_001880930.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644455|gb|EDR08705.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 396

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 103/326 (31%), Positives = 156/326 (47%), Gaps = 25/326 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIIL 78
            +++A  P NIA+ KYWGKRD+KL LP N+SLS++L   HL + T      S   D + L
Sbjct: 5   YQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFVKDTLWL 64

Query: 79  NGQKISSQSS--------FFKKTTQF-----CDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           NG++   +            K+  Q           + S     I + NN PT AGLASS
Sbjct: 65  NGKEDEIKPGGRLATCIFELKRLRQATVENEDPTAPKLSTYKVHIASYNNFPTAAGLASS 124

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASGFAAL  +L ++Y++P    +LS +AR GSGSACRS Y GF  W  G   +G DS A+
Sbjct: 125 ASGFAALVASLAQLYALPVSPSTLSIIARQGSGSACRSLYGGFVAWQEGVHPDGSDSLAI 184

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
                  WP++   +  + D +K   S   M++T   SP      +  +   +  I +AI
Sbjct: 185 QVAPQSHWPEIHALICVVSDDKKGTSSTSGMQLTVETSPLLQHRIKAVVPQRMKDISKAI 244

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------QSIPI 296
           +++DF     +   ++ + HA  +   PP+ Y    +   +  + +  +      Q    
Sbjct: 245 LEKDFDTFARITMADSNQFHAVALDTEPPIFYLNDVSRAIIAVIVEYNRLSLANGQGYKA 304

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFF 322
            +T DAGPN  +    K  + I Q  
Sbjct: 305 AYTYDAGPNAVIYTEEKNIKEIIQLI 330


>gi|238491808|ref|XP_002377141.1| diphosphomevalonate decarboxylase [Aspergillus flavus NRRL3357]
 gi|220697554|gb|EED53895.1| diphosphomevalonate decarboxylase [Aspergillus flavus NRRL3357]
          Length = 404

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 114/363 (31%), Positives = 173/363 (47%), Gaps = 25/363 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   +     +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAAPSDSTVFRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  S--DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
               AD +ILNG+    QSS              ++         + S +   I + NN 
Sbjct: 61  KYPTADELILNGKPQDIQSSKRTLACLSNLRSLRQELEAADSSLPRLSTLPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  GT 
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGTL 180

Query: 177 QNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
            +G DS A  V   + WP++R  +L +   +K + S E M+ T   S  F    +  +  
Sbjct: 181 ADGSDSLAEEVAPESHWPEMRALILVVSAEKKDVPSTEGMQTTVATSNLFATRAESVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I       S + W        K+    
Sbjct: 301 GRTVCAYTFDAGPNAVIYYLEKDSELVAGTVKAIL----GASSEGWDGPFYEPLKSFTAP 356

Query: 352 GIS 354
           G++
Sbjct: 357 GVA 359


>gi|169773789|ref|XP_001821363.1| diphosphomevalonate decarboxylase [Aspergillus oryzae RIB40]
 gi|83769224|dbj|BAE59361.1| unnamed protein product [Aspergillus oryzae]
          Length = 404

 Score =  361 bits (926), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 113/363 (31%), Positives = 172/363 (47%), Gaps = 25/363 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   +     +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAAPSDSTVFRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  S--DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
               AD +ILNG+    QSS              ++         + S +   I + NN 
Sbjct: 61  KYPTADELILNGKPQDIQSSKRTLACLSNLRSLRQELEAADSSLPRLSTLPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGNL 180

Query: 177 QNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
            +G DS A  V   + WP++R  +L +   +K + S E M+ T   S  F    +  +  
Sbjct: 181 ADGSDSLAEEVAPESHWPEMRALILVVSAEKKDVPSTEGMQTTVATSNLFATRAESVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I       S + W        K+    
Sbjct: 301 GRTVCAYTFDAGPNAVIYYLEKDSELVAGTVKAIL----GASSEGWDGPFYEPLKSFTAP 356

Query: 352 GIS 354
           G++
Sbjct: 357 GVA 359


>gi|115398169|ref|XP_001214676.1| hypothetical protein ATEG_05498 [Aspergillus terreus NIH2624]
 gi|114192867|gb|EAU34567.1| hypothetical protein ATEG_05498 [Aspergillus terreus NIH2624]
          Length = 401

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 112/353 (31%), Positives = 167/353 (47%), Gaps = 25/353 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            +++   P NIA+ KYWGKRD  LNLP N+SLS++L    L T+T  +        D +I
Sbjct: 7   FRATTTAPVNIAVIKYWGKRDPSLNLPTNSSLSVTLSQRSLRTLTTASCAAQYPSQDELI 66

Query: 78  LNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           LNG+    QSS              K          + S +   I + NN PT AGLASS
Sbjct: 67  LNGKPQEIQSSKRTLACLSNLRALRKALEDANPSLPKLSTLPLRIVSENNFPTAAGLASS 126

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+  +G DS A 
Sbjct: 127 AAGFAALVRAVADLYQLPDSPRDLSRIARQGSGSACRSLMGGYVAWRAGSLDDGSDSLAE 186

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
            V   + WP++R  +L +   +K + S E M+ T   S  F       +   +A I+ AI
Sbjct: 187 EVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSNLFATRATSVVPERMAAIETAI 246

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
            ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +        +T 
Sbjct: 247 QNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAAGRTVAAYTF 306

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGI 353
           DAGPN  + +  K  + +      I       + + W        KN+   G+
Sbjct: 307 DAGPNAVIYYLEKDNDLVAGTVKAIL----GPNTEGWDGPFYEPLKNTTAPGV 355


>gi|134115721|ref|XP_773574.1| hypothetical protein CNBI1880 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256200|gb|EAL18927.1| hypothetical protein CNBI1880 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 395

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 159/351 (45%), Gaps = 30/351 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCII 77
            +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + 
Sbjct: 3   YEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFEAGDKLW 62

Query: 78  LNGQKISSQSS-FFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           LNG++   +         +    +R+            S+    I + NN PT AGLASS
Sbjct: 63  LNGKEEVIKEGGRLAVCIKELRRWRKEMESKDKDLPKLSEWPLRIASYNNFPTAAGLASS 122

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASG AAL  +L  +YS+P+    LS VAR GSGSACRS + GF  W  GTD  G DS A 
Sbjct: 123 ASGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAE 182

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                  WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI 
Sbjct: 183 EVAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRIVPKRMDAISQAIK 242

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLD 301
            +DF +  ++   ++   HA  +  +PP+ Y    +   +  V +  +    I   +T D
Sbjct: 243 ARDFSEFAKLTMADSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAYTFD 302

Query: 302 AGPNLKLLFTHKIEETIKQFFPE-----ITIIDPLDS-----PDLWSTKDS 342
           AGPN  +    K    +               DP  +     P+ ++T   
Sbjct: 303 AGPNAVIYTLEKNMPVVLGAIKRFFPTGEEFEDPFQTGVRDLPEGFNTGVV 353


>gi|156847450|ref|XP_001646609.1| hypothetical protein Kpol_1028p24 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117288|gb|EDO18751.1| hypothetical protein Kpol_1028p24 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 396

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 109/344 (31%), Positives = 172/344 (50%), Gaps = 24/344 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIILNG 80
           +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T     +    D + LNG
Sbjct: 5   ASTTAPVNIATLKYWGKRDKDLNLPTNSSISVTLAQEDLRTLTSAATDEGFTQDKLWLNG 64

Query: 81  QKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGF 129
           ++ S  S+  ++        RQ            S+    I + NN PT AGLASSA+GF
Sbjct: 65  KEESLDSARTQQCLADLRGLRQQVEAQDPQAPKMSQWKLHIVSENNFPTAAGLASSAAGF 124

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           AAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G + +G DS AV    
Sbjct: 125 AALVVAIAKLYQLPQDYSEISKIARKGSGSACRSLFGGYVAWEMGENLDGSDSKAVEVAP 184

Query: 190 --QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQD 246
              WP+++  +L + D +K   S   M++T   S  F +  +  +      +KQAI ++D
Sbjct: 185 LNHWPNMKAAILVVSDMKKDTPSTSGMQLTVKTSDLFQERIKNVVPQRFEEMKQAIRNKD 244

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGP 304
           F    ++  K++   HAT + + PP+ Y    + + +  V           + +T DAGP
Sbjct: 245 FPTFADLTMKDSNSFHATCLDSYPPIFYMNDTSRKIIRLVHSINAFYNETIVAYTYDAGP 304

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNS 348
           N  L +  + E  +  F  ++      D    W TK + ++ N 
Sbjct: 305 NAVLYYLEENESKLFAFIYKL-----FDKVSGWETKYTEAELND 343


>gi|302680056|ref|XP_003029710.1| hypothetical protein SCHCODRAFT_69496 [Schizophyllum commune H4-8]
 gi|300103400|gb|EFI94807.1| hypothetical protein SCHCODRAFT_69496 [Schizophyllum commune H4-8]
          Length = 404

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 105/360 (29%), Positives = 165/360 (45%), Gaps = 25/360 (6%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCII 77
             +++A  P NIA  KYWGKRD+KL LP N+SLS++L    L + T      S + D + 
Sbjct: 3   TYQATASAPVNIACIKYWGKRDTKLILPTNSSLSVTLDQDYLKSTTTSRADPSFEKDQLW 62

Query: 78  LNGQKISSQS-SFFKKTTQFCDLFRQ------------FSKVYFLIETSNNIPTKAGLAS 124
           LNG +   +  S  +   +     R+             S  +  I + NN PT AGLAS
Sbjct: 63  LNGTEDEIKPGSRLETCIKEMKRLRKVEVEDKDPSAPKLSTYHVRIASYNNFPTAAGLAS 122

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SASGFAAL  +L  +Y +P    +LS +AR GSGSACRS Y GF  W  GT  +G DS A
Sbjct: 123 SASGFAALVSSLAALYKLPVSPSTLSLIARQGSGSACRSLYGGFVAWEQGTKADGSDSLA 182

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQA 241
           +     + WP L   +  + D +K   S   M+ T   SP      +  +   +A I  A
Sbjct: 183 IQIAPESHWPTLHAVVCVVNDAKKGTSSTAGMQRTVETSPLLQHRIKHVVPQRMAEISDA 242

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------QSIP 295
           I  +DF     +  +++ + HA  +   PP+ Y    +   +  + +  +          
Sbjct: 243 IRARDFDAFARITMQDSNQFHAVALDTDPPIFYMNDVSKAIVALIVEYNRVAIEKTGKRK 302

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
             +T DAGPN  +    +  + I     +       +  D+++   +  +K ++  G ++
Sbjct: 303 AAYTYDAGPNAVIYVEQENVKEIVDLILQYFPDAAANFKDVFNLYANDQKKGAVVSGFNE 362


>gi|145256805|ref|XP_001401521.1| diphosphomevalonate decarboxylase [Aspergillus niger CBS 513.88]
 gi|134058430|emb|CAK47917.1| unnamed protein product [Aspergillus niger]
          Length = 404

 Score =  359 bits (921), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 110/363 (30%), Positives = 167/363 (46%), Gaps = 25/363 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +         +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAASADSQVFRATTTAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQRSLRTLTTASCAP 60

Query: 71  S--DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
                D + LNG+    QSS              ++         + S     I + NN 
Sbjct: 61  FYPAKDELTLNGKPQDIQSSKRTLACLASLRAHRRELEDANPSLPKLSSFPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+ 
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYQLPQSPRDLSRIARQGSGSACRSLMGGYVAWRAGSL 180

Query: 177 QNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
           ++G DS A        WP++R  +L +   +K + S E M+ T   S  F       +  
Sbjct: 181 EDGSDSLAEEVAPQSHWPEMRALILVVSAAKKDVPSTEGMQTTVATSNLFATRASTVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIQNRDFPAFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAI 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I      +  + W        K+    
Sbjct: 301 GRTVCAYTYDAGPNAVIYYLEKDTELVAGTVKAIL----GEKTEGWEGPFYTPLKDVTTP 356

Query: 352 GIS 354
           G+S
Sbjct: 357 GVS 359


>gi|255560311|ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gi|223539619|gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
          Length = 415

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 106/355 (29%), Positives = 175/355 (49%), Gaps = 25/355 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
            +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V    D D + LNG
Sbjct: 9   VTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG 68

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 69  KEISLSGGRYQNCLREIRARACDVEDKEKGIKIAKKDWEKLHVHIASFNNFPTAAGLASS 128

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G   +G DS AV
Sbjct: 129 AAGFACLVFALAKLMNAREDNSELSAIARQGSGSACRSLFGGFVKWIMGKVDDGSDSLAV 188

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 189 QLVDEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRIIQMEEAI 248

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             +DF    ++   ++ + HA  +   PP+ Y    + + +  V  W+  +++  + +T 
Sbjct: 249 NKRDFASFAQITCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNRSEETPQVAYTF 308

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPN  L+   +  +T  Q   ++    P +S    ++     +    + GI +
Sbjct: 309 DAGPNAVLI--AQNRKTAVQLLQKLLYYFPPNSDTDLNSYVLGDKSILKDAGIEE 361


>gi|224110186|ref|XP_002315441.1| predicted protein [Populus trichocarpa]
 gi|222864481|gb|EEF01612.1| predicted protein [Populus trichocarpa]
          Length = 416

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 104/362 (28%), Positives = 174/362 (48%), Gaps = 25/362 (6%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-D 72
                    +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S D
Sbjct: 2   AGKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFD 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIP 117
            D + LNG++IS     ++   +                    + + K++  + + NN P
Sbjct: 62  QDRMWLNGKEISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNFP 121

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G  +
Sbjct: 122 TAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAE 181

Query: 178 NGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTD 234
           +G DS AV   +   W +L I +  +  R+K+  S   M  +   S        + +   
Sbjct: 182 DGSDSLAVQLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKR 241

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQ 292
           +  +++AI ++DF    ++   ++ + HA  +   PP+ Y    + + +  V  W+  ++
Sbjct: 242 IKQMEEAIKNRDFGSFAQLTCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNRSEE 301

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           +  + +T DAGPN  L+      +   Q   ++    P  S    ++     +    + G
Sbjct: 302 TPQVAYTFDAGPNAVLI--AHNRKAATQLLQKLLFYFPPSSDADLNSYVIGDKSILKDAG 359

Query: 353 IS 354
           I 
Sbjct: 360 IE 361


>gi|67528432|ref|XP_662018.1| hypothetical protein AN4414.2 [Aspergillus nidulans FGSC A4]
 gi|40741141|gb|EAA60331.1| hypothetical protein AN4414.2 [Aspergillus nidulans FGSC A4]
 gi|259482774|tpe|CBF77574.1| TPA: diphosphomevalonate decarboxylase (AFU_orthologue;
           AFUA_4G07130) [Aspergillus nidulans FGSC A4]
          Length = 404

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 112/363 (30%), Positives = 168/363 (46%), Gaps = 26/363 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   +     +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAAVSESPVYRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  S--DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
           S   AD + LNG+    QSS              ++         + S +   I + NN 
Sbjct: 61  SYPAADELTLNGKPQDIQSSKRTLACLASLRAHRQELESADPSLPKLSTLPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYKLPQSPTELSRIARQGSGSACRSLMGGYVAWRAGEL 180

Query: 177 QNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
            +G DS A        WP++R  +L +   +K + S   M+ T   S  F       +  
Sbjct: 181 ADGSDSLAEEVAPQAHWPEMRALILVVSAEKKDVPSTTGMQTTVATSELFATRANAVVPA 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D     
Sbjct: 241 RMAAIETAIQNRDFPAFAEITMRDSNGFHATCLDSWPPIFYMNDVSRAAVRLVHDINNAV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K    +   F  I         + WS     + K  +  
Sbjct: 301 GRTVCAYTFDAGPNAVIYYLEKDSNLVAGTFKSIL----GTELEGWSGPFYDAVK-DVSS 355

Query: 352 GIS 354
           G+S
Sbjct: 356 GVS 358


>gi|170084655|ref|XP_001873551.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651103|gb|EDR15343.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 396

 Score =  358 bits (919), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 104/326 (31%), Positives = 156/326 (47%), Gaps = 25/326 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIIL 78
            +++A  P NIA+ KYWGKRD+KL LP N+SLS++L   HL + T      S   D + L
Sbjct: 5   YQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFVKDTLWL 64

Query: 79  NGQKISSQS--------SFFKKTTQF-----CDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           NG++   +         S  K+  Q           + S     I + NN PT AGLASS
Sbjct: 65  NGKEDEIKPGGRLATCISELKRLRQATVENEDPSAPKLSTYKVHIASYNNFPTAAGLASS 124

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASGFAAL  +L ++Y++P    +LS +AR GSGSACRS Y GF  W  G   +G DS AV
Sbjct: 125 ASGFAALVASLAQLYALPVSPSTLSIIARQGSGSACRSLYGGFVAWQEGVLPDGSDSLAV 184

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
                  WP++   +  + D +K   S   M++T   S       +  +   +  I +AI
Sbjct: 185 QVAPQSHWPEIHALICVVSDDKKGTSSTSGMQLTVETSTLLQHRIKAVVPQRMKDISKAI 244

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------QSIPI 296
           +++DF     +   ++ + HA  +   PP+ Y    +   +  + +  +      Q    
Sbjct: 245 LEKDFDTFARITMADSNQFHAVALDTEPPIFYMNDVSRAIIAVIVEYNRLSLANGQGYKA 304

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFF 322
            +T DAGPN  +    K  + I Q  
Sbjct: 305 AYTYDAGPNAVIYAEEKNIKEIIQLI 330


>gi|58261674|ref|XP_568247.1| diphosphomevalonate decarboxylase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57230329|gb|AAW46730.1| diphosphomevalonate decarboxylase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 395

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 159/351 (45%), Gaps = 30/351 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCII 77
            +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + 
Sbjct: 3   YEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFEAGDKLW 62

Query: 78  LNGQKISSQSS-FFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           LNG++   +         +    +R+            S+    I + NN PT AGLASS
Sbjct: 63  LNGKEEVIKEGGRLAVCIKELRGWRKEMESKDKDLPKLSEWPLRIASYNNFPTAAGLASS 122

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASG AAL  +L  +YS+P+    LS VAR GSGSACRS + GF  W  GTD  G DS A 
Sbjct: 123 ASGLAALVASLASLYSLPQSPSQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAE 182

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                  WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI 
Sbjct: 183 EVAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRIVPKRMDAISQAIK 242

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLD 301
            +DF +  ++   ++   HA  +  +PP+ Y    +   +  V +  +    I   +T D
Sbjct: 243 ARDFSEFAKLTMADSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAYTFD 302

Query: 302 AGPNLKLLFTHKIEETIKQFFPE-----ITIIDPLDS-----PDLWSTKDS 342
           AGPN  +    K    +               DP  +     P+ ++T   
Sbjct: 303 AGPNAVIYTLEKNMPVVLGAIKRFFPTGEEFEDPFQTGVRDLPEGFNTGVV 353


>gi|118763544|gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
          Length = 421

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 106/364 (29%), Positives = 180/364 (49%), Gaps = 25/364 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID 70
           +GE         +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T ++V  
Sbjct: 1   MGEQGENWILMVTAQTPTNIAVIKYWGKRDESLILPINSSISVTLDPSHLCTTTTVSVSP 60

Query: 71  S-DADCIILNGQKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSN 114
           S   DC+ LNG++IS     F++  +                    + + K++  I + N
Sbjct: 61  SFKQDCMWLNGKEISLSGGRFQRCLREIRSRACDVEDEKKGFKIAKKDWEKLHVHIASYN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G
Sbjct: 121 NFPTAAGLASSAAGFACLVFSLAKLMNLKEDHGQLSAIARQGSGSACRSLFGGFVKWDMG 180

Query: 175 TDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQI 231
            + +G DS A+P  +   W +L I +  +   +K+  S   M  T   SP       + +
Sbjct: 181 KESDGSDSIAIPLVDEKHWDELVIVIAVVSAHQKETSSTSGMRDTVETSPLIQHRAKEVV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDA 289
              +  +++AI ++DF     ++  ++ + HA  +  SPP+ Y    + + +  V  W+ 
Sbjct: 241 PKRIVQMEEAISNRDFSTFAHLSCSDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNR 300

Query: 290 RQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
            + +  + +T DAGPN  ++  ++   T+     ++    P  +     +     +    
Sbjct: 301 SEGTPQVAYTFDAGPNAAMIARNRKVATLL--LQKLLYCFPPQADADLDSYVIGDKSLLK 358

Query: 350 ELGI 353
           E G+
Sbjct: 359 EAGV 362


>gi|170033728|ref|XP_001844728.1| diphosphomevalonate decarboxylase [Culex quinquefasciatus]
 gi|167874805|gb|EDS38188.1| diphosphomevalonate decarboxylase [Culex quinquefasciatus]
          Length = 372

 Score =  357 bits (917), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 107/329 (32%), Positives = 160/329 (48%), Gaps = 18/329 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILN 79
             +   P NIA+ KYWGKRD  L LPLN+S+S +L   HL T T IT  DS   + I+LN
Sbjct: 3   SVTCIAPVNIAVIKYWGKRDEDLILPLNDSVSATLSTDHLCTKTTITTSDSLTENKIVLN 62

Query: 80  GQKISSQSSFFKKTTQFCD--------LFRQFSKVYFLIETSNNIPTKAGLASSASGFAA 131
           G++ S ++    +  +             +   K    + T NN PT AGLASSASG+A 
Sbjct: 63  GKEESFENPRLIRCLEEVRKKADAANKCRKDILKWNIKVTTENNFPTAAGLASSASGYAC 122

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNN 189
               L  +Y I +  + +S +AR GSGSACRS Y GF +W  G   +G DS AV     +
Sbjct: 123 FVYTLACLYGIED--QEISSIARQGSGSACRSLYSGFVQWRKGELPDGSDSIAVQLTPAD 180

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFI 248
            WP++RI +L + D  KK  S   M  +   S       ++      A + +A+  +DF 
Sbjct: 181 FWPEMRIIVLVVNDMRKKTSSTGGMSTSVKTSKLLKHRAERCVPEHTAQLVEALKGKDFE 240

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNL 306
             G++  +++ + HA  +   PP +Y    +   +  V      ++ I + +T DAGPN 
Sbjct: 241 TFGKITMQDSNQFHAVCLDTFPPCVYMNDTSHAIVTLVHRFNDLKKDIRVAYTFDAGPNA 300

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPD 335
            L    K    +     ++   D L SP+
Sbjct: 301 CLYLLEKDVPEVLATVNKVFPNDALGSPE 329


>gi|157104385|ref|XP_001648384.1| diphosphomevalonate decarboxylase [Aedes aegypti]
 gi|108880368|gb|EAT44593.1| diphosphomevalonate decarboxylase [Aedes aegypti]
          Length = 372

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 104/329 (31%), Positives = 158/329 (48%), Gaps = 18/329 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHI-TVIDSDADCIILN 79
             +   P NIA+ KYWGKRD  L LPLN+S+S +L   HL T T I T      + IILN
Sbjct: 3   SVTCIAPVNIAVIKYWGKRDEDLILPLNDSVSATLSTDHLCTKTTITTCESFTENKIILN 62

Query: 80  GQKISSQSSFFKKTTQFC--------DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAA 131
           G++ S  +    +  +              +  K    ++T NN PT AGLASSASG+A 
Sbjct: 63  GKEESFDNPRLLRCLEEIKKRAKASNKCKPEILKWNVHVKTENNFPTAAGLASSASGYAC 122

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNN 189
           L   L  +Y I   +E +S +AR GSGSACRS + GF +W  G   +G DS AV    ++
Sbjct: 123 LVYTLACLYGIE--NEEISSIARQGSGSACRSLHSGFVQWQKGEHPDGSDSVAVQLVPHD 180

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFI 248
            WP++RI +L + D  KK  S   M  +   S       ++        + +A+  +DF 
Sbjct: 181 FWPEMRIIVLVVNDARKKTSSTGGMSTSVKTSKLLKYRVEECVPKHTKDLVEALNKKDFE 240

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNL 306
             G++  +++ + HA  +   PP +Y    +   +  V      ++ + + +T DAGPN 
Sbjct: 241 TFGKITMQDSNQFHAVCLDTYPPCVYMNDISFAVVNMVHQFNALKKEVKVAYTFDAGPNA 300

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPD 335
            L    K    +     ++   D L  P+
Sbjct: 301 CLYLLEKDVPEVLAVVNKVFPNDKLGDPE 329


>gi|321256436|ref|XP_003193399.1| diphosphomevalonate decarboxylase [Cryptococcus gattii WM276]
 gi|317459869|gb|ADV21612.1| diphosphomevalonate decarboxylase, putative [Cryptococcus gattii
           WM276]
          Length = 395

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 111/351 (31%), Positives = 165/351 (47%), Gaps = 30/351 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS--DADCII 77
            +++A  P NIA  KYWGKRD++L LP N+SLS++L   HL + T      S    D + 
Sbjct: 3   YEATASAPVNIACIKYWGKRDTRLILPTNSSLSVTLDQDHLRSTTTSRADASFETGDRLW 62

Query: 78  LNGQKISSQSS-FFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           LNG++ + +         +    +R+            S+    I + NN PT AGLASS
Sbjct: 63  LNGKEEAIKEGGRLAVCIKELREWRKEMEDKQKDLPKLSEWPLRIASYNNFPTAAGLASS 122

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASG AAL  +L  +YS+P+ +  LS VAR GSGSACRS + GF  W  GTD  G DS A 
Sbjct: 123 ASGLAALVASLASLYSLPQSASQLSLVARQGSGSACRSLFGGFVAWREGTDPAGSDSLAE 182

Query: 186 PFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                  WP++   +  + D +K   S   M+ T   S    +  + +   +  I QAI 
Sbjct: 183 EVAPREHWPEMHALICVVSDAKKGTSSTSGMQKTVETSTLLQERLRVVPKRMDAISQAIK 242

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLD 301
            +DF +  ++   ++   HA  +  +PP+ Y    +   +  V +  +    I   +T D
Sbjct: 243 ARDFSEFAKLTMVDSNSFHAVCLDTAPPIFYLNDVSRAIIAVVEELNRAAGEIIAAYTFD 302

Query: 302 AGPNLKLLFTHKIEE----TIKQFFP-EITIIDPLDS-----PDLWSTKDS 342
           AGPN  +    K        IK+FFP      DP  +     P  ++T   
Sbjct: 303 AGPNAVIYTLEKNMPFVLGAIKRFFPTSEEFEDPFQTNVRDLPQGFNTGVV 353


>gi|241947931|ref|XP_002416688.1| diphosphomevalonate decarboxylase, putative; mevalonate
           pyrophosphate decarboxylase, putative;
           mevalonate-5-diphosphate decarboxylase, putative
           [Candida dubliniensis CD36]
 gi|223640026|emb|CAX44270.1| diphosphomevalonate decarboxylase, putative [Candida dubliniensis
           CD36]
          Length = 367

 Score =  356 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 110/349 (31%), Positives = 169/349 (48%), Gaps = 23/349 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +   S + D + L
Sbjct: 2   YSASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASPSFEKDQLWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFR---------QFSKVYFLIETSNNIPTKAGLASSASGF 129
           NG+  S  +   +         R         + S++   I + NN PT AGLASSA+GF
Sbjct: 62  NGKLESLDTPRTQACLADLRNLRASIETPDSPKLSQMKLHIVSENNFPTAAGLASSAAGF 121

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           AAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV    
Sbjct: 122 AALVTAIAKLYQLPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTSNDGEDSKAVEIAP 181

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQD 246
            + WP L+  +L + D +K   S   M+ T   S  F     Q+       +K AI+ +D
Sbjct: 182 LDHWPTLKAVILVVSDDKKDTPSTTGMQATVESSDLFAHRISQVVPRRFDQMKSAILAKD 241

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL 306
           F K  E+  K++   HA  + + PP+ Y    + Q ++   +  +  +   +T DAGPN 
Sbjct: 242 FPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKQIIKLAEEINRDGVICAYTFDAGPNA 301

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
            + +    ++ +     +     P      W T      + +   G+S+
Sbjct: 302 VIYYDESNQDKVLAHLYKHFGHVP-----GWKTHYKAETQTT---GVSR 342


>gi|146329706|ref|YP_001209416.1| diphosphomevalonate decarboxylase [Dichelobacter nodosus VCS1703A]
 gi|146233176|gb|ABQ14154.1| diphosphomevalonate decarboxylase [Dichelobacter nodosus VCS1703A]
          Length = 328

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 143/315 (45%), Positives = 197/315 (62%), Gaps = 3/315 (0%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ 81
             ++AF P+NIAL KYWGKRD++LNLP N SLS+SL HLGT T I     + D +  + +
Sbjct: 2   HSATAFAPANIALAKYWGKRDAQLNLPTNGSLSISLAHLGTTTTI--SAGERDQLYCDHR 59

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            +   ++F +K   F D  +   +   +I T NNIPT AGLASSASGFAALTLAL   + 
Sbjct: 60  LLPPDTAFVQKVWHFIDFCQP-KRPPLVIHTQNNIPTAAGLASSASGFAALTLALNDFFQ 118

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                E LS++AR GSGSACRS ++GF  W  G   +G D +A P  + W DLR+G++ I
Sbjct: 119 WSLSREQLSQIARRGSGSACRSLWQGFVYWQKGEKADGSDCYARPIASDWQDLRLGIITI 178

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
               KKI SR+AM  T   SP F+ WTQ    DL  I QA++D+DF+ L + AE NAL M
Sbjct: 179 DAAAKKISSRQAMNHTAASSPLFSSWTQAAEADLKVIYQAVLDRDFLTLAQTAEANALMM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA+++AA P + YWQ +T+  ++ +W AR + + +Y TLDAG N+KLL+  + E  I   
Sbjct: 239 HASLLAARPAIFYWQPQTLAMLQCIWQARAEGLAVYATLDAGANVKLLYRAQDEAEIASM 298

Query: 322 FPEITIIDPLDSPDL 336
           FP+  +I+P  +   
Sbjct: 299 FPQAQLINPFQTVTS 313


>gi|70994672|ref|XP_752113.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus Af293]
 gi|66849747|gb|EAL90075.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus Af293]
 gi|159124973|gb|EDP50090.1| diphosphomevalonate decarboxylase [Aspergillus fumigatus A1163]
          Length = 404

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 110/362 (30%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   + +   +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAATSDRTVYRATTTAPVNIAVIKYWGKRDASLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  --SDADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
               AD +ILNG+    Q+S              +          + S +   I + NN 
Sbjct: 61  IYPAADELILNGKPQDIQTSKRTLACLSNLRSLRQALENADPSLPKLSTLPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYQLPQSPLELSRIARQGSGSACRSLMGGYVAWRAGER 180

Query: 177 QNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
           ++G DS A  V   + WP++R  +L +   +K + S E M+ T   S  F       +  
Sbjct: 181 EDGSDSLAEEVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSSLFATRAASVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIQNKDFATFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I       + + +        KN    
Sbjct: 301 GRTVCAYTFDAGPNAVIYYLEKDSEVVAGTIKAIL----GPNTEGFDGPFYDILKNVTAS 356

Query: 352 GI 353
            +
Sbjct: 357 VV 358


>gi|119501112|ref|XP_001267313.1| diphosphomevalonate decarboxylase [Neosartorya fischeri NRRL 181]
 gi|119415478|gb|EAW25416.1| diphosphomevalonate decarboxylase [Neosartorya fischeri NRRL 181]
          Length = 404

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 111/362 (30%), Positives = 169/362 (46%), Gaps = 25/362 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   +     +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MAATSDHTVYRATTTAPVNIAVIKYWGKRDASLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  --SDADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
               AD +ILNG+    QSS              +          + S +   I + NN 
Sbjct: 61  IYPAADELILNGKPQDIQSSKRTLACLSNLRSLRQALENADPSLPKLSALPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  
Sbjct: 121 PTAAGLASSAAGFAALVRAIADLYQLPQSPLELSRIARQGSGSACRSLMGGYVAWRAGER 180

Query: 177 QNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
           ++G DS A  V   + WP++R  +L +   +K + S E M+ T   S  F       +  
Sbjct: 181 EDGSDSLAEEVAPASHWPEMRAIILVVSAEKKDVPSTEGMQTTVATSSLFATRAASVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI ++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIQNKDFATFAEITMRDSNSFHATCLDSWPPIFYMNDVSRAAVRLVHDINRAV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I       + + +        KN    
Sbjct: 301 GRTVCAYTFDAGPNAVIYYLEKDSEVVAGTVKAIL----GPNTEGFDGPFYDILKNVTAS 356

Query: 352 GI 353
            +
Sbjct: 357 VV 358


>gi|224097622|ref|XP_002311015.1| predicted protein [Populus trichocarpa]
 gi|222850835|gb|EEE88382.1| predicted protein [Populus trichocarpa]
          Length = 416

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 174/354 (49%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K++  + + NN PT AGLASS
Sbjct: 70  KEISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +WI G  ++G DS AV
Sbjct: 130 AAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAEDGSDSLAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W +L I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKRIKQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    +++  ++ + HA  +   PP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 250 KNRDFGSFAQLSCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNCSEGTPQVAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+      +   Q   ++    P  S    ++     +    + GI 
Sbjct: 310 DAGPNAVLI--AHNRKAATQLMQKLLFCFPPSSDADLNSYVIGDKSILKDAGIE 361


>gi|238879484|gb|EEQ43122.1| diphosphomevalonate decarboxylase [Candida albicans WO-1]
          Length = 362

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 108/317 (34%), Positives = 162/317 (51%), Gaps = 16/317 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +  +S + D + L
Sbjct: 2   YSASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASESFEKDQLWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFR----------QFSKVYFLIETSNNIPTKAGLASSASG 128
           NG+  S  +   +         R          + S++   I + NN PT AGLASSA+G
Sbjct: 62  NGKLESLDTPRTQACLADLRKLRASIEQSPDTPKLSQMKLHIVSENNFPTAAGLASSAAG 121

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
           FAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV   
Sbjct: 122 FAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTLPDGQDSKAVEIA 181

Query: 189 --NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQ 245
               WP LR  +L + D +K   S   M+ T   S  F     + +      +K+AI+D+
Sbjct: 182 PLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDLFAHRIAEVVPQRFEAMKKAILDK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF K  E+  K++   HA  + + PP+ Y    + + ++ V    QQ +   +T DAGPN
Sbjct: 242 DFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKMVETINQQEVVAAYTFDAGPN 301

Query: 306 LKLLFTHKIEETIKQFF 322
             + +    ++ +    
Sbjct: 302 AVIYYDEANQDKVLSLL 318


>gi|156059890|ref|XP_001595868.1| hypothetical protein SS1G_03958 [Sclerotinia sclerotiorum 1980]
 gi|154701744|gb|EDO01483.1| hypothetical protein SS1G_03958 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 382

 Score =  355 bits (911), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 105/344 (30%), Positives = 164/344 (47%), Gaps = 24/344 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
            ++S   P NIA+ KYWGKRD+KLNLP N+S+S++L    L T T  +       D ++L
Sbjct: 7   YQASTTAPVNIAVVKYWGKRDAKLNLPTNSSISVTLSQNDLRTHTTASCSSTFTEDTLLL 66

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           NG      ++  +   +     R           + +     I + NN PT AGLASSA+
Sbjct: 67  NGSPQDISNARTQACFRELRSLRSALEEADSSLPKLASYPLKIISENNFPTAAGLASSAA 126

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+  +Y +      LSR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 127 GFAALVRAIANLYELKSNPTELSRIARQGSGSACRSLFGGYVAWEMGQKEDGSDSVAVEV 186

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIID 244
                WP +R  +L +   +K + S   M+IT   S  F Q  +  +   +  +++AI +
Sbjct: 187 APASHWPTMRALILVVSAEKKGVSSTSGMQITVATSKLFKQRAENVVPEHMKEMERAIKE 246

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +V   ++   HAT +   PP+ Y    +   +  V D  +        +T DA
Sbjct: 247 KDFEGFAKVTMMDSNSFHATCLDTFPPIFYLNDVSRAAIRAVEDINKAAGKTVAAYTFDA 306

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           GPN  + F  +  + +      +      +  D W+ K+  S+ 
Sbjct: 307 GPNAVIYFEEENIDLVAGALKSVL-----EGVDGWNGKEVESKS 345


>gi|6625790|gb|AAF19399.1|AF203779_1 diphosphomevalonate decarboxylase MVD1 [Candida albicans]
          Length = 362

 Score =  355 bits (911), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 108/317 (34%), Positives = 162/317 (51%), Gaps = 16/317 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  +  +S + D + L
Sbjct: 2   SSASVTAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQDDLRTLTTASASESFEKDQLWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFR----------QFSKVYFLIETSNNIPTKAGLASSASG 128
           NG+  S  +   +         R          + S++   I + NN PT AGLASSA+G
Sbjct: 62  NGKLESLDTPRTQACLADLRKLRASIEQSPDTPKLSQMKLHIVSENNFPTAAGLASSAAG 121

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
           FAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  GT  +G DS AV   
Sbjct: 122 FAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGTLPDGQDSKAVEIA 181

Query: 189 --NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQ 245
               WP LR  +L + D +K   S   M+ T   S  F     + +      +K+AI+D+
Sbjct: 182 PLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDLFAHRIAEVVPQRFEAMKKAILDK 241

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF K  E+  K++   HA  + + PP+ Y    + + ++ V    QQ +   +T DAGPN
Sbjct: 242 DFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKMVETINQQEVVAAYTFDAGPN 301

Query: 306 LKLLFTHKIEETIKQFF 322
             + +    ++ +    
Sbjct: 302 AVIYYDEANQDKVLSLL 318


>gi|255710979|ref|XP_002551773.1| KLTH0A07238p [Lachancea thermotolerans]
 gi|238933150|emb|CAR21331.1| KLTH0A07238p [Lachancea thermotolerans]
          Length = 397

 Score =  354 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 109/343 (31%), Positives = 166/343 (48%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +   +S   D + L
Sbjct: 4   YTASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDLRTLTSVATSESFTEDQLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           NGQ  S Q    +   Q     R           + S+    I + NN PT AGLASSA+
Sbjct: 64  NGQPESLQGERTQHCLQDLRNLRSRIEAQDSSLPRMSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G++ +G DS AV  
Sbjct: 124 GFAALVMAIAKLYQLPDSHSEISKIARKGSGSACRSLFGGYVAWEMGSEPDGSDSKAVEV 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
                WP+++  +L +    K   S   M+ T   S  F +     +      +KQAI D
Sbjct: 184 APQSHWPEMKAAILVVSADRKDTPSTSGMQHTVATSDLFQERIRNVVPKRFEEMKQAIQD 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF +  E+  +++   HAT + + PP+ Y    + + ++             + +T DA
Sbjct: 244 RDFTRFAELTMRDSNSFHATCLDSFPPIFYMNDTSRKIVKLCHQINAFYDETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F   +           W TK S + 
Sbjct: 304 GPNAVLYYLQENEAKLMAFVHHV-----FQKNSGWDTKFSQND 341


>gi|121706710|ref|XP_001271604.1| diphosphomevalonate decarboxylase [Aspergillus clavatus NRRL 1]
 gi|119399752|gb|EAW10178.1| diphosphomevalonate decarboxylase [Aspergillus clavatus NRRL 1]
          Length = 403

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 117/356 (32%), Positives = 174/356 (48%), Gaps = 29/356 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID--SDADCII 77
            +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +       AD +I
Sbjct: 9   YRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTLTTASCSAIYPTADELI 68

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR--------------QFSKVYFLIETSNNIPTKAGLA 123
           LNG+    QSS  K+T       R              + S +   I + NN PT AGLA
Sbjct: 69  LNGKPQDIQSS--KRTLACLSSLRSLRQALESTDSSLPKLSTLPLRIVSENNFPTAAGLA 126

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 127 SSAAGFAALVRAVANLYQLPQSPRELSRIARQGSGSACRSLMGGYVAWRAGELEDGSDSL 186

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQ 240
           A  V   + WP++R  +L +   +K + S E M+ T   S  F       +   +A I+ 
Sbjct: 187 AEEVAPASHWPEMRAIVLVVSAEKKDVPSTEGMQTTVATSSLFATRATSVVPERMAAIET 246

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI+++DF    E+  +++   HAT + + PP+ Y    +   +  V D  +        +
Sbjct: 247 AILNKDFPAFAELTMRDSNGFHATCLDSWPPIFYMNDVSRAAVRIVHDINRAIGRTVCAY 306

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           T DAGPN  + +  K  E +      I   +     D W+       K+    G+S
Sbjct: 307 TFDAGPNAVIYYLEKDSELVAGTVKAILTTN----TDGWNGPFYDILKDVTAPGVS 358


>gi|312212165|emb|CBX92249.1| hypothetical protein [Leptosphaeria maculans]
          Length = 919

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 108/340 (31%), Positives = 162/340 (47%), Gaps = 25/340 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T T  +   S    D ++
Sbjct: 55  HRASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSPSYPAEDTLL 114

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           LNGQ      +  +   +     R           + +     I + NN PT AGLASSA
Sbjct: 115 LNGQPQDVSGARTQACFRELRTLRRKLEEQDSSLPKLADQPLRIVSENNFPTAAGLASSA 174

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FA 184
           +GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F 
Sbjct: 175 AGFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSAADGSDSVAFQ 234

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+ T   S  F    ++     +  +++AI 
Sbjct: 235 VAPASHWPNMRAVILVVSAAKKGVSSTTGMQTTVATSSLFQSRAKETVPRRMKEMQEAIK 294

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           ++DF   G+V   ++   HAT +   PP+ Y    +   +  V         I   +T D
Sbjct: 295 NKDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDISRAAIMVVNAINAAAGKIIAAYTFD 354

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD 341
           AGPN  + +  + E+ +   F  I         D W  + 
Sbjct: 355 AGPNAVVYYLEENEKDVAGLFKLIL-----GDKDGWQGER 389


>gi|322700394|gb|EFY92149.1| diphosphomevalonate decarboxylase [Metarhizium acridum CQMa 102]
          Length = 391

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 113/358 (31%), Positives = 175/358 (48%), Gaps = 24/358 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  D D ++
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASYSDGDSLM 66

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +     R           + S +   I + NN PT AGLASSA
Sbjct: 67  LNGEPSDISGARTQACFRELRARRAALEASNPSLPKLSTLPLKIVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G  ++G DS A  
Sbjct: 127 AGFAALVQAIANLYELPDSPSELSLIARQGSGSACRSLFGGYVAWRMGDKEDGSDSMADL 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+ T   S  F Q   Q +  ++  ++QAI 
Sbjct: 187 VAPASHWPNMRALILVVSAAKKGVSSTSGMQQTVATSGLFQQRIAQVVPANMDLMEQAIK 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFTLD 301
            +DF K  EV  +++   HA      PP+ Y    +   +  V   +A+       +T D
Sbjct: 247 AKDFAKFAEVTMRDSNSFHACCADTYPPIFYMNDVSRAAIRAVESINAKAGRTIAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS----TKDSLSQKNSIELGISK 355
           AGPN  + +  +   T+   F  +         D  S     K      ++++ G+S+
Sbjct: 307 AGPNCVVYYLEEDAPTVLGAFAGVLNGVSGWKEDSVSAQSGAKLEDGIASTLKDGVSR 364


>gi|164604978|dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
          Length = 415

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 103/354 (29%), Positives = 169/354 (47%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL T T + V  S   D + LNG
Sbjct: 9   VTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPVHLCTTTTVAVSPSFAQDRMWLNG 68

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 69  KEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLHVHIASYNNFPTAAGLASS 128

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ +  E    LS +AR GSGSACRS + GF +W  G  ++G DS AV
Sbjct: 129 AAGFACLVFALAKLMNAKEDHSELSAIARQGSGSACRSLFGGFVKWKMGKVEDGSDSLAV 188

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  T   S        + +   +  ++++I
Sbjct: 189 QVVDEKHWDDLVIIIAVVSSRQKETSSTTGMRETVETSLLLQHRAKEIVPKRIVQMEESI 248

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
            +++F     +   ++ + HA  +   PP+ Y    + + +  V    +   +  + +T 
Sbjct: 249 KNRNFASFAHLTCADSNQFHAVCMDTCPPIFYMNDTSHRIISCVEKWNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+      +   Q   ++    P +S    ++     +    + GI 
Sbjct: 309 DAGPNAVLI--AHNRKAAAQLLQKLLFYFPPNSDTELNSYVLGDKSILKDAGIE 360


>gi|225464152|ref|XP_002266399.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296087980|emb|CBI35263.3| unnamed protein product [Vitis vinifera]
          Length = 422

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 101/355 (28%), Positives = 174/355 (49%), Gaps = 25/355 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
           ++A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V     +D + LNG
Sbjct: 13  TTAQTPTNIAVIKYWGKRDEALILAVNDSISVTLDPQHLCTTTTVAVSPMFQSDRMWLNG 72

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS Y GF +W+ G ++NG DS AV
Sbjct: 133 AAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEENGSDSIAV 192

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W +L I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 193 QLQDEKHWDELVIIIAVVSSRQKETSSTSGMRDSVETSLLLQHRAKEVVPKRIIEMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF     +   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 253 KNRDFPSFARLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPN  L+   +  +        +    P  S    ++     +    ++G+ +
Sbjct: 313 DAGPNAVLI--ARDRKVAANLLQRLLYYFPPHSDTDLNSYVIGDKSILGDVGVEE 365


>gi|23097681|ref|NP_691147.1| mevalonate diphosphate decarboxylase [Oceanobacillus iheyensis
           HTE831]
 gi|22775904|dbj|BAC12182.1| mevalonate diphosphate decarboxylase [Oceanobacillus iheyensis
           HTE831]
          Length = 324

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 130/322 (40%), Positives = 186/322 (57%), Gaps = 10/322 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQ 81
           K++A   +NIAL KYWGKR+  + LP N++LSL+L    T+T +    +  +D   LN +
Sbjct: 2   KATAKAHTNIALIKYWGKRNEPIILPTNSNLSLTLDGFSTVTTVHFQEELSSDEFFLNDR 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +   +S  ++ T F D  R  +   +Y  I + N++PT AG ASSASGFAAL  A  + 
Sbjct: 62  LVEDAAS--QRVTGFLDKVRAMAGKEMYARIHSLNHVPTAAGFASSASGFAALAAASTKA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
             +      LS + R GSGSACRS Y GF EW  G  ++G DS+AVP  +    D+R+  
Sbjct: 120 IGLELNDTELSILTRQGSGSACRSIYGGFVEWQMGEKEDGSDSYAVPIASKDHWDIRVAA 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + +   EKK+ SR+ M  T   SPF+  W +Q   DL  IK AI D+DF K G +AE N 
Sbjct: 180 VVLSATEKKVSSRDGMRRTVETSPFYDGWLKQTPKDLEEIKTAIHDKDFEKTGSIAEANC 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++MHAT + A+PP  YWQ  T++ M+ V   R++ IP YFT+DAGPN+K+L+  K E  +
Sbjct: 240 MRMHATTLGANPPFTYWQDTTMRVMQNVQQMREEGIPAYFTIDAGPNVKVLYLPKDESKV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           KQ   +I     +I       +
Sbjct: 300 KQRLEQIMGVEDVIVSKPGKGI 321


>gi|189196182|ref|XP_001934429.1| diphosphomevalonate decarboxylase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187980308|gb|EDU46934.1| diphosphomevalonate decarboxylase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 398

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 111/343 (32%), Positives = 167/343 (48%), Gaps = 25/343 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T T  +   +    D ++
Sbjct: 5   HRASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSSTYPKEDTLL 64

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSA 126
           LNGQ      +  +   +     R+            S++   I + NN PT AGLASSA
Sbjct: 65  LNGQSQDVSGARTQACFRELRALRKQLEDKDSSLPKLSELPLRIVSENNFPTAAGLASSA 124

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FA 184
           +GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F 
Sbjct: 125 AGFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSASDGSDSVAFQ 184

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+IT   S  F     + +   +  +++AI 
Sbjct: 185 VAPASHWPNMRAVILVVSAAKKGVSSTSGMQITVATSSLFQSRATETVPRRMKEMQKAIQ 244

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           D+DF   G+V   ++   HAT +   PP+ Y    +   ++ V         I   +T D
Sbjct: 245 DKDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDVSRAAIKVVESINAAAGKIIAAYTFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLS 344
           AGPN  + +  + E+ +   F  I      +  D W      S
Sbjct: 305 AGPNAVIYYLEENEKEVAGLFKTIL-----NEKDGWQGARGQS 342


>gi|50555265|ref|XP_505041.1| YALI0F05632p [Yarrowia lipolytica]
 gi|49650911|emb|CAG77848.1| YALI0F05632p [Yarrowia lipolytica]
          Length = 387

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 112/344 (32%), Positives = 166/344 (48%), Gaps = 24/344 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
            ++S   P NIA  KYWGKRD  LNLP NNS+S++L    L T+T  +       D + L
Sbjct: 3   HQASTTAPVNIATLKYWGKRDPALNLPTNNSISVTLSQDDLRTLTTASCSPDFTQDELWL 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           NG++            +     R           + +     I + NN PT AGLASSA+
Sbjct: 63  NGKQEDVSGKRLVACFRELRALRHKMEDSDSSLPKLADQKLKIVSENNFPTAAGLASSAA 122

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+  +Y + E  E LS VAR GSGSACRS Y G+  W  GT+ +G DS AV  
Sbjct: 123 GFAALIRAVANLYELQETPEQLSIVARQGSGSACRSLYGGYVAWEMGTESDGSDSRAVQI 182

Query: 188 --NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
              + WP++R  +L +   +K   S   M++T H SP F +     +    A +K++I+D
Sbjct: 183 ATADHWPEMRAAILVVSADKKDTSSTTGMQVTVHTSPLFKERVTTVVPERFAQMKKSILD 242

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    E+  +++ + HAT + + PP+ Y    +   +  V    +   +    +T DA
Sbjct: 243 RDFPTFAELTMRDSNQFHATCLDSYPPIFYLNDVSRASIRVVEAINKAAGATIAAYTFDA 302

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           GPN  + +  K EE +      I         + W    S+  K
Sbjct: 303 GPNCVIYYEDKNEELVLGALKAIL-----GRVEGWEKHQSVDAK 341


>gi|16417950|gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
          Length = 415

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 170/354 (48%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL T T + V  S   D + LNG
Sbjct: 9   VTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVAVSPSFAQDRMWLNG 68

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K+Y  I + NN PT AGLASS
Sbjct: 69  KEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLYVHIASYNNFPTAAGLASS 128

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ +  E +  LS +AR GSGSACRS + GF +W  G  ++G DS AV
Sbjct: 129 AAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWKMGKVEDGSDSLAV 188

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  T   S        + +   +  ++++I
Sbjct: 189 QVVDEKHWDDLVIIIAVVSSRQKETSSTTGMRETVETSLLLQHRAKEIVPKRIVQMEESI 248

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
            +++F     +   ++ + HA  +   PP+ Y    + + +  V    +   +  + +T 
Sbjct: 249 KNRNFASFAHLTCADSNQFHAVCMDTCPPIFYMNDTSHRIISCVEKWNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+      +   Q   ++    P +S    ++     +    + GI 
Sbjct: 309 DAGPNAVLI--AHNRKAAAQLLQKLLFYFPPNSDTELNSYVLGDKSILKDAGIE 360


>gi|168042855|ref|XP_001773902.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674746|gb|EDQ61250.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 423

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 109/352 (30%), Positives = 173/352 (49%), Gaps = 27/352 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD KL LP+N+S+S++L   HL   T +      + D + LNG+
Sbjct: 13  TARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFEKDRLWLNGK 72

Query: 82  KISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S +   +K   +                      ++ ++  I + NN PT AGLASSA
Sbjct: 73  EVSVEGVRYKNCLREMRARATDVVIESSGKVIRKEDWNSLHIHIASENNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEKSE-SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  AL ++  + EK E  L+ +ARLGSGSACRS Y GF EW  G + +G DS AV
Sbjct: 133 AGFACLVYALAQLMGVQEKYEGELTAIARLGSGSACRSLYGGFVEWKMGQEIDGTDSIAV 192

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
                  W DL I +  +  R+K+  S   M+ +   SP       + +   +  +++AI
Sbjct: 193 QLAEESHWKDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEVVPKRIVQMEKAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
              +F +  ++   ++ + HAT +  SPP+ Y    + + +  V  W+       + +T 
Sbjct: 253 KSMNFTEFAKITCADSNQFHATCLDTSPPIFYLNDTSRKLIGLVERWNRHAGEPQVAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           DAGPN  +    K +E   Q    +    P  S D   ++     ++ +E  
Sbjct: 313 DAGPNAVMF--AKNKEVAAQLLQRLLYQFP-PSADTDISRYVHGDQSILESA 361


>gi|164660688|ref|XP_001731467.1| hypothetical protein MGL_1650 [Malassezia globosa CBS 7966]
 gi|159105367|gb|EDP44253.1| hypothetical protein MGL_1650 [Malassezia globosa CBS 7966]
          Length = 430

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 109/349 (31%), Positives = 160/349 (45%), Gaps = 37/349 (10%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-------- 71
            +++   P NIA+ KYWGKRD+KL LP N+SLS++L   HL T+T      S        
Sbjct: 4   YQATCTAPVNIAVIKYWGKRDTKLVLPTNDSLSVTLDQDHLRTVTTARADASFGTDEAGT 63

Query: 72  DADCIILNGQKISSQS-SFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTK 119
             D + LNG + S +               R             SK    + + NN PT 
Sbjct: 64  RQDKLWLNGAEESIKPGGRLDACLCEMRKLRAELEAKDRSLPPLSKWGLRLCSENNFPTA 123

Query: 120 AGLASSASGFAALTLALFRIYSIP--EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           AGLASSASGFAAL +++  +Y +     S  LS +AR GSGSACRS   GF  W  GT  
Sbjct: 124 AGLASSASGFAALAVSVAELYGLRAVMTSSQLSIIARRGSGSACRSVLGGFVAWQMGTAD 183

Query: 178 NGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTD 234
           +G DSFA+P      WPDL + +  + D +K   S   M+ T   SP      +  +   
Sbjct: 184 DGSDSFAIPIAEREHWPDLHVLICVVNDAKKGTSSTVGMQNTVETSPLLQHRIKHVVPER 243

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--- 291
           +  + +AI  +DF    ++   ++   HA  +  +PP+ Y    +   +  V +  +   
Sbjct: 244 MQQMNEAIQKRDFAAFTQLTTADSNNFHACCLDTTPPIFYMNDTSRAIVHVVEELNRARA 303

Query: 292 ---QSIPIYFTLDAGPNLKLLFTHKIE----ETIKQFFPEITIIDPLDS 333
              +     +T DAGPN  L    K      + ++ +FP  T+ D L  
Sbjct: 304 EAGEDPIAAYTFDAGPNAVLYVREKDMSCVRQVVQHYFPGATMDDRLQG 352


>gi|260794527|ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gi|229277476|gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
          Length = 409

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 163/351 (46%), Gaps = 29/351 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIIL 78
            + +   P NIA+ KYWGKRD +L LP+N SLS++L    L   T +    D   D + L
Sbjct: 15  SQVTCTAPVNIAVIKYWGKRDEQLVLPINPSLSVTLSQDQLCARTTVAASADFKRDRVWL 74

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVY-----------FLIETSNNIPTKAGLASSAS 127
           NGQ+ S  +   +K         +  K               + + NN PT AGLASSA+
Sbjct: 75  NGQEQSVDAPRLQKCLGEIRRLARKRKHKDERAGDLLGSCVHVCSENNFPTAAGLASSAA 134

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           G+A L  +L +++ I      +S +AR GSGSACRS Y GF EW  G  ++G DS A  V
Sbjct: 135 GYACLVQSLAKLFHID---GDVSHIARQGSGSACRSMYGGFVEWTMGRLEDGADSVAKQV 191

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
                WP+LR+ +  +   +K +GS E M+ T   S       +  + +    ++QAI++
Sbjct: 192 APAEHWPELRVLVAVVNAGKKAVGSTEGMQTTVKTSALVKYRAEHVVPSRQEDMRQAILE 251

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDA 302
           +DF   GE+  K++ + HAT +   PP+ Y  + +   +  V         I   +T DA
Sbjct: 252 RDFQTFGEITMKDSNQFHATCLDTYPPIFYLNETSKHIIHLVHRYNRHHGKIKAAYTFDA 311

Query: 303 GPNLKLLFTHKIEETI----KQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
           GPN  L         +    + FFP        +S   +      + +  +
Sbjct: 312 GPNAVLYLLQDDVPEVLALLRHFFP---PSSTNNSEREFVQGLPDANRKDL 359


>gi|302309175|ref|NP_986435.2| AGL232Cp [Ashbya gossypii ATCC 10895]
 gi|299788235|gb|AAS54259.2| AGL232Cp [Ashbya gossypii ATCC 10895]
          Length = 397

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 108/343 (31%), Positives = 169/343 (49%), Gaps = 26/343 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRDS LNLP N+S+S++L    L T+T   T  +   D + LNG
Sbjct: 6   ASTTAPVNIATLKYWGKRDSMLNLPTNSSISVTLSQEDLRTLTSAATGPELAEDRLWLNG 65

Query: 81  QKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGF 129
           +  S  ++  ++        R+            S+    I + NN PT AGLASSA+GF
Sbjct: 66  KPESLGNARTQQCLADLRALRRALETEEPDLPRMSEWKLHIVSENNFPTAAGLASSAAGF 125

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           AAL +A+ ++Y +P+    +S++AR GSGSACRS Y G+  W  G + +G DS AV   +
Sbjct: 126 AALVVAVAKLYGLPQDYSEISKIARKGSGSACRSLYGGYVAWEMGAEADGSDSRAVQIAD 185

Query: 190 --QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQD 246
              WP++R  +L +    K   S   M+ T H S  F +     +      +  AI  +D
Sbjct: 186 VEHWPEMRAAILVVSADRKDTPSTSGMQQTVHTSDLFKERVATVVPRRYGEMAAAIRARD 245

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM---ERVWDARQQSIPIYFTLDAG 303
           F     +  +++   HAT + + PP+ Y    + + +     + +   ++I + +T DAG
Sbjct: 246 FATFARLTMQDSNSFHATCLDSFPPIFYMNDTSRRIVKLCHLINEFYNETI-VAYTFDAG 304

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           PN  L +  + E  +  F   +       + D W T  S  Q+
Sbjct: 305 PNAVLYYLAENEARLCGFLSAV-----FGANDGWETTFSTEQR 342


>gi|242766378|ref|XP_002341158.1| diphosphomevalonate decarboxylase [Talaromyces stipitatus ATCC
           10500]
 gi|218724354|gb|EED23771.1| diphosphomevalonate decarboxylase [Talaromyces stipitatus ATCC
           10500]
          Length = 404

 Score =  351 bits (902), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 102/328 (31%), Positives = 163/328 (49%), Gaps = 23/328 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   +    + D 
Sbjct: 7   FRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTVTTASCSPNYPATEGDT 66

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LNG+  + Q+S              K+         + S     + + NN PT AGLA
Sbjct: 67  LTLNGKPENIQASKRTLACLSSLRALRKELESADPSLPKLSSYPLRVVSENNFPTAAGLA 126

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 127 SSAAGFAALVRAIADLYELPQSPTELSRIARQGSGSACRSLQGGYVAWRAGVKEDGSDSL 186

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQ 240
           A  +   + WP++R  +L +   +K + S   M+ T   SP F    + I    +  +++
Sbjct: 187 AEEIAPASHWPEMRALILVVSAEKKDVPSTTGMQTTVSTSPLFATRAEHIVPRRMTGMEE 246

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI  +DF    ++  +++   HA  + + PP+ Y    +   +  V D  +        +
Sbjct: 247 AITKRDFAAFADLTMRDSNNFHAVCLDSEPPIFYLNDVSRAAIRLVNDINRLAGKTVAAY 306

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEIT 326
           T DAGPN  + +  ++ E +   F  I 
Sbjct: 307 TFDAGPNAVIYYLDEVSELVGGTFKTIL 334


>gi|169603648|ref|XP_001795245.1| hypothetical protein SNOG_04832 [Phaeosphaeria nodorum SN15]
 gi|111066103|gb|EAT87223.1| hypothetical protein SNOG_04832 [Phaeosphaeria nodorum SN15]
          Length = 398

 Score =  351 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 107/340 (31%), Positives = 165/340 (48%), Gaps = 25/340 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T T  +   +    D + 
Sbjct: 5   HRASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLSQADLRTHTTASCSSTYPSQDALF 64

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSA 126
           LNGQ      +  +   +     R+            + +   I + NN PT AGLASSA
Sbjct: 65  LNGQSQDVSGARTQACFRELRALRKQLEEKDSSLPKLADLPLRIVSENNFPTAAGLASSA 124

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FA 184
           +GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F 
Sbjct: 125 AGFAALVRAIANLYVLPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSATDGSDSVAFQ 184

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+ T   S  F     + +   +  +++AI 
Sbjct: 185 VAPASHWPNMRAVILVVSAAKKGVSSTTGMQTTVATSTLFQSRAAETVPRRMKEMQEAIQ 244

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           ++DF   G++A  ++   HAT +   PP+ Y    +   ++ V         I   +T D
Sbjct: 245 NKDFEAFGKLAMMDSNSFHATCLDTFPPIFYLNDISRAAIKVVEAINAAAGKIIAAYTFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD 341
           AGPN  + +  + E+ +   F  I      +  D W  + 
Sbjct: 305 AGPNAVVYYEEENEKEVAGLFKTIL-----NEKDGWQGER 339


>gi|116205702|ref|XP_001228660.1| hypothetical protein CHGG_02144 [Chaetomium globosum CBS 148.51]
 gi|88182741|gb|EAQ90209.1| hypothetical protein CHGG_02144 [Chaetomium globosum CBS 148.51]
          Length = 394

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 110/352 (31%), Positives = 165/352 (46%), Gaps = 26/352 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            ++S   P NIA+ KYWGKRDSKLNLP N+SLS++L    L T+T  +   S      D 
Sbjct: 6   YRASTTAPVNIAVVKYWGKRDSKLNLPTNSSLSVTLSQADLRTLTTASCSASYPASQGDS 65

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLAS 124
           ++LNG+      +  +   +     R+            S +   + + NN PT AGLAS
Sbjct: 66  LLLNGEPSDIAGARTQACFRELRTRREALEAADPSLPQLSTMPLRLVSENNFPTAAGLAS 125

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A
Sbjct: 126 SAAGFAALVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGDAADGSDSMA 185

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQA 241
             V   + WPD+R  +L +   +K + S   M+ T   S  F +   + +  ++A +++A
Sbjct: 186 DQVAEASHWPDMRALILVVSAAKKGVSSTSGMQQTVATSGLFQERIAKVVPQNMAAMEKA 245

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFT 299
           I ++DF    EV  +++   HAT     PP+ Y    +   +  V             +T
Sbjct: 246 IAERDFASFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEQINAAAGRTVAAYT 305

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
            DAGPN  + +  K  E +      +           W +      K SI L
Sbjct: 306 FDAGPNAVIYYLEKDTEAVVGTLYHVL----GGEVGGWKSTVVQGLKPSISL 353


>gi|73956933|ref|XP_546783.2| PREDICTED: similar to Diphosphomevalonate decarboxylase (Mevalonate
           pyrophosphate decarboxylase) (Mevalonate
           (diphospho)decarboxylase) [Canis familiaris]
          Length = 400

 Score =  351 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 106/358 (29%), Positives = 164/358 (45%), Gaps = 28/358 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   V  D  
Sbjct: 2   ASEKPLLAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAVSKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++   +    +   +      +  +                 I + NN PT 
Sbjct: 62  EDRIWLNGREEDVEQPRLQACLREIRRLARKRRSTGDEDPLPLSLTYKVHIASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLAQVYGVD---SDLSEVARRGSGSACRSLYGGFVEWQMGERADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K +GS   M+ +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLMGSTAGMQTSVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF   G++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMTRCIQERDFQGFGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIVHLVHRFNTHHGQT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNSIEL 351
            + +T DAGPN  +       +T+ +F   +    P +S  D +     +      + 
Sbjct: 299 KVAYTFDAGPNAVVFTLE---DTVPEFVAAVQHCFPPESNGDKFLKGLPVRPTPLSDE 353


>gi|154292222|ref|XP_001546687.1| hypothetical protein BC1G_14194 [Botryotinia fuckeliana B05.10]
 gi|150846214|gb|EDN21407.1| hypothetical protein BC1G_14194 [Botryotinia fuckeliana B05.10]
          Length = 382

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 107/344 (31%), Positives = 160/344 (46%), Gaps = 24/344 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
            ++S   P NIA+ KYWGKRD+KLNLP N+S+S++L    L T T  T       D ++L
Sbjct: 7   YQASTTAPVNIAVVKYWGKRDAKLNLPTNSSISVTLSQDDLRTHTTATCSSTFTEDSLLL 66

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           NG      ++  +   +     R           + S     I + NN PT AGLASSA+
Sbjct: 67  NGSSQDISNARTQACFRDLRSLRSALEDSDSSLPKLSSYPLRIISENNFPTAAGLASSAA 126

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+  +Y +      LS++AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 127 GFAALVRAIANLYELQSNPTELSKIARQGSGSACRSLFGGYVAWEMGQKEDGSDSVAVEV 186

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIID 244
                WP +R  +L +   +K + S   M+IT   S  F Q  +  +   +  +++AI +
Sbjct: 187 APASHWPTMRALILVVSAEKKGVSSTSGMQITVATSKLFKQRAENVVPEHMKEMERAIKE 246

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +V    +   HAT +   PP+ Y    +   +  V D           +T DA
Sbjct: 247 KDFEGFAKVTMMESNSFHATCLDTFPPIFYLNDVSRAAIRAVEDINNAAGKTVAAYTFDA 306

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           GPN  + F  +    +      +         D W+ KD  S+ 
Sbjct: 307 GPNAVIYFEEENLGLVAGALKSVL-----GGVDGWNGKDVESKS 345


>gi|229542021|ref|ZP_04431081.1| diphosphomevalonate decarboxylase [Bacillus coagulans 36D1]
 gi|229326441|gb|EEN92116.1| diphosphomevalonate decarboxylase [Bacillus coagulans 36D1]
          Length = 326

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 138/322 (42%), Positives = 182/322 (56%), Gaps = 10/322 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +NIAL KYWGKRD KL LP+N+SLS++L    T T +    +  AD   LNG+
Sbjct: 2   EATARAHTNIALIKYWGKRDEKLFLPMNSSLSITLDRFYTTTKVAYDPALKADVFFLNGK 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
                 +   K ++F D  R F+    Y  IE+ N +P  AGLASSASG AAL  A  + 
Sbjct: 62  PAIDAET--AKISRFMDKIRAFAGEKRYAYIESQNEVPIAAGLASSASGMAALAAAAVKA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRIGL 198
             I     +LS +AR GSGSACRS Y GF EW  G   +G DS+AVP       +L I  
Sbjct: 120 LGIEVDGRTLSILARQGSGSACRSIYGGFVEWQKGEKADGSDSYAVPILGEDDWNLSILS 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             +  ++KKI SRE M+ T   SPF+  W + +  DLA  K AI  +DF  LG V E NA
Sbjct: 180 CLVESKQKKISSREGMKRTVTTSPFYKAWMETVEKDLAAAKSAIAARDFALLGRVLEANA 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMHAT I+A PP LYWQ  T+  M+ V   R++ I  YFT+DAGPN+K+L   K EET+
Sbjct: 240 LKMHATTISADPPFLYWQSATLDVMQEVALLRERGIEAYFTIDAGPNVKVLCERKDEETV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
                 +     ++     P +
Sbjct: 300 YNALAAVPSVREVLVCHPGPGI 321


>gi|330916537|ref|XP_003297454.1| hypothetical protein PTT_07872 [Pyrenophora teres f. teres 0-1]
 gi|311329848|gb|EFQ94456.1| hypothetical protein PTT_07872 [Pyrenophora teres f. teres 0-1]
          Length = 398

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 110/343 (32%), Positives = 167/343 (48%), Gaps = 25/343 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T T  +   +    D ++
Sbjct: 5   HRASTTAPVNIAVIKYWGKRDPKLNLPTNSSLSVTLAQSDLRTHTTASCSSTYPKEDTLL 64

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSA 126
           LNGQ      +  +   +     R+            S++   I + NN PT AGLASSA
Sbjct: 65  LNGQSQDVSGARTQACFRELRALRKQLEDKDSSLPKLSELPLRIVSENNFPTAAGLASSA 124

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FA 184
           +GFAAL  A+  +Y +P     LSR+AR GSGSACRS + G+  W  G+  +G DS  F 
Sbjct: 125 AGFAALVRAIANLYELPSSPTDLSRIARQGSGSACRSLFGGYVGWEQGSASDGSDSVAFQ 184

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           V   + WP++R  +L +   +K + S   M+IT   S  F     + +   +  +++AI 
Sbjct: 185 VAPASHWPNMRAVILVVSAAKKGVSSTSGMQITVATSSLFQSRATETVPRRMKEMQKAIQ 244

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           D+DF   G+V   ++   HAT +   PP+ Y    +   ++ V         I   +T D
Sbjct: 245 DKDFETFGKVTMMDSNSFHATCLDTFPPIFYLNDVSRATIKVVESINAAAGKIIAAYTFD 304

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLS 344
           AGPN  + +  + E+ +   F  I      +  D W      +
Sbjct: 305 AGPNAVIYYLEENEKEVAGLFKTIL-----NEKDGWQGARGQA 342


>gi|254513287|ref|ZP_05125352.1| diphosphomevalonate decarboxylase [Rhodobacteraceae bacterium
           KLH11]
 gi|221532291|gb|EEE35287.1| diphosphomevalonate decarboxylase [Rhodobacteraceae bacterium
           KLH11]
          Length = 341

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 136/328 (41%), Positives = 184/328 (56%), Gaps = 1/328 (0%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
           +      +    P+  E   A+ PSNIAL KYWGKRD  LNLPLN+SLS+SLGHLG+ TH
Sbjct: 6   QIFFDSVLPNKLPRP-ESYEAYSPSNIALAKYWGKRDQTLNLPLNSSLSISLGHLGSKTH 64

Query: 66  ITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++      D +  +G K+ +QS F +K   F DLFR+   +   I T N IPT +GLASS
Sbjct: 65  VSSATDGVDGVWFDGDKLPNQSRFAQKVLAFADLFRRGQNLPLHIVTKNTIPTASGLASS 124

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASGFAALT A+   + +      LS ++R GSGSA RS + GF  W  G   +G D  A 
Sbjct: 125 ASGFAALTRAISGAFKLALSDAQLSMISRFGSGSASRSIWHGFVCWDRGVRDDGTDCVAR 184

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
              + WP  RI ++ +    K + S + M  T   SP F  W +    D   ++ A++ +
Sbjct: 185 QLPHHWPGFRIAVIPVDTDLKSVPSSDGMRHTVATSPLFEAWPEHAEADCIRVEAAVLAR 244

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPN 305
           DF  LGE  E NAL MHATM+A+ P L Y Q  +   +E +W+AR+  I  Y T+DAG N
Sbjct: 245 DFTVLGETVEANALAMHATMLASRPVLNYLQPASWTCLETIWNARKAGIEAYATMDAGAN 304

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDS 333
           +K+LF       I+  FP+  IIDP   
Sbjct: 305 IKVLFLETNRTQIETLFPQGLIIDPFAD 332


>gi|126139005|ref|XP_001386025.1| hypothetical protein PICST_90752 [Scheffersomyces stipitis CBS
           6054]
 gi|126093307|gb|ABN67996.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 387

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 108/342 (31%), Positives = 162/342 (47%), Gaps = 24/342 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S+  P NIA  KYWGKRD+ LNLP N+S+S++L    L T+T     +  + D + L
Sbjct: 4   FTASSTAPVNIATLKYWGKRDTLLNLPTNSSISVTLSQNDLRTLTTAAASEAFEKDQLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  S   +         R           + S+    I + NN PT AGLASSA+
Sbjct: 64  NGKLESLDSVRTQACLADLRRLRAEVETSDASLPKLSQFKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + GF  W  G  +NG DS AV  
Sbjct: 124 GFAALVSAIAKLYKLPQNMSELSKIARKGSGSACRSLFGGFVAWEMGELENGEDSKAVEV 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
                WP ++  +L + D +K   S   M+ T   S  F     + +      +K+AI  
Sbjct: 184 APLSHWPTMKAAILVVSDDKKDTPSTSGMQQTVATSDLFQHRITEVVPKRFEEMKRAIAA 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDA 302
            DF   GE+  K++   HA  + + PP+ Y    + Q ++ V    +Q   I   +T DA
Sbjct: 244 NDFETFGELTMKDSNSFHAVCLDSYPPIFYLNDTSKQIIKLVHRLNEQEGKIIAAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLS 344
           GPN  + +    E  +              +   W   + ++
Sbjct: 304 GPNAVIYYDEVNEAKVLGLLYSY-----FGAVGGWEKHEEVA 340


>gi|81428518|ref|YP_395518.1| diphosphomevalonate decarboxylase [Lactobacillus sakei subsp. sakei
           23K]
 gi|78610160|emb|CAI55209.1| Diphosphomevalonate decarboxylase [Lactobacillus sakei subsp. sakei
           23K]
          Length = 324

 Score =  350 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 125/320 (39%), Positives = 186/320 (58%), Gaps = 10/320 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           + ++A   +NIAL KYWGK+D+ L +P N+SLSL+L H  T T +T  ++   D II NG
Sbjct: 3   QSATARAHTNIALIKYWGKKDANLIIPQNSSLSLTLDHFYTDTTVTFSETLTRDQIIFNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           Q+   Q+    K +QF DL RQ +    +  +ET+N++P  AGLASSASG+AAL  A  R
Sbjct: 63  QEADEQT--QTKMSQFLDLIRQQAGRSTFASVETTNHVPNAAGLASSASGYAALAAAGSR 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +      LSR+AR GSGSA RS Y GF EW  G +     +  V     W D+++  
Sbjct: 121 AAGLDLNRRDLSRLARRGSGSATRSIYGGFVEWQRGRNDQDSYAIPVQEEIDW-DIQMIA 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + + DR+K++ SR  M      SP++  W +    DL  +K AII +D   +G++AEK+A
Sbjct: 180 IVLNDRKKRVASRAGMASVVATSPYYPSWVETAQADLPKMKDAIIKKDINLVGQLAEKSA 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++MHAT ++A PP  Y++ ET+Q +E V   RQQ +  Y+T+DAGPN+K++ T +    I
Sbjct: 240 MQMHATTLSAVPPFTYFEPETLQAIEVVERLRQQGVSCYYTMDAGPNVKVICTSRETPQI 299

Query: 319 KQ----FFPEITIIDPLDSP 334
                 +F    ++     P
Sbjct: 300 LAALAPYFTAEQLLVAKPGP 319


>gi|255949940|ref|XP_002565737.1| Pc22g18320 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592754|emb|CAP99120.1| Pc22g18320 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 404

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 113/363 (31%), Positives = 171/363 (47%), Gaps = 26/363 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   + +   +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   
Sbjct: 1   MASTSNQSIYRATTTAPVNIAVIKYWGKRDTTLNLPTNSSLSVTLSQRSLRTLTTASCSA 60

Query: 71  S--DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNI 116
           +   AD + LNG     QSS              K          + S     I + NN 
Sbjct: 61  AYPPADTLNLNGSPQDIQSSKRTMACISNLRALRKALEDADSSLPKLSAHPLRIVSENNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+GFAAL  A+  +Y +P+  + LSR+AR GSGSACRS   G+  W  G  
Sbjct: 121 PTAAGLASSAAGFAALVRAVADLYELPQSPKELSRIARQGSGSACRSLMGGYVAWRTGEL 180

Query: 177 QNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
            +G DS A  V   + WP++R  +L +   +K + S E M+ T   S  F +  Q  +  
Sbjct: 181 ADGSDSLAEEVAPASHWPEMRALVLVVSAEKKDVPSTEGMQTTVATSALFAERAQNVVPE 240

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +A I+ AI +++F    E+  +++   HAT + + PP+ Y    +   +  V D  +  
Sbjct: 241 RMAAIETAIKNRNFHDFAEITMRDSNTFHATCLDSWPPIFYMNDVSRAAVRLVHDINRVV 300

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                 +T DAGPN  + +  K  E +      I       + + W         N    
Sbjct: 301 GRTVCAYTFDAGPNAVIYYEDKDSEIVAGTVKAIL----GPNTEGWDGVFYERLANVT-A 355

Query: 352 GIS 354
           G+S
Sbjct: 356 GVS 358


>gi|212528468|ref|XP_002144391.1| diphosphomevalonate decarboxylase [Penicillium marneffei ATCC
           18224]
 gi|210073789|gb|EEA27876.1| diphosphomevalonate decarboxylase [Penicillium marneffei ATCC
           18224]
          Length = 402

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 102/328 (31%), Positives = 164/328 (50%), Gaps = 23/328 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            +++   P NIA+ KYWGKRD+ LNLP N+SLS++L    L T+T  +   +    + D 
Sbjct: 7   FRATTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQRSLRTVTTASCSPNYPAAEGDT 66

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LNG+  +  +S              K+         + S     + + NN PT AGLA
Sbjct: 67  LTLNGKPENINASKRTRACLSSLRALRKELEDADSSLPKLSSYPLRVVSENNFPTAAGLA 126

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LS++AR GSGSACRS   G+  W  GT ++G DS 
Sbjct: 127 SSAAGFAALVRAIADLYELPQSPTDLSKIARQGSGSACRSLQGGYVAWRAGTKEDGSDSV 186

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQ 240
           A  +   + WP++R  +L +   +K + S   M+ T H SP F    + I    +  +++
Sbjct: 187 AEEIAPASHWPEMRALILVVSAEKKDVPSTTGMQTTVHTSPLFATRAEHIVPKRMIGMEE 246

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI  +DF    ++  +++   HA  + + PP+ Y    +   +  V D  +    +   +
Sbjct: 247 AITKRDFAAFADLTMRDSNNFHACCLDSEPPIFYLNDVSRAAIRLVNDINRVAGKVVAAY 306

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEIT 326
           T DAGPN  + +  +  E +   F  I 
Sbjct: 307 TFDAGPNAVIYYLDEASELVGGTFKAIL 334


>gi|18410026|ref|NP_566995.1| mevalonate diphosphate decarboxylase, putative [Arabidopsis
           thaliana]
 gi|332645683|gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
          Length = 419

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 171/354 (48%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V    D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K+   I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV
Sbjct: 130 AAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 250 KNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+   +  +   Q    +    P  S     +          E G+ 
Sbjct: 310 DAGPNAVLI--ARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLD 361


>gi|194704310|gb|ACF86239.1| unknown [Zea mays]
 gi|223944587|gb|ACN26377.1| unknown [Zea mays]
          Length = 420

 Score =  349 bits (897), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 103/336 (30%), Positives = 165/336 (49%), Gaps = 25/336 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 12  ATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 71

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 72  KEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAAGLASS 131

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G A     L ++ ++ E    LS +AR GSGSACRS Y GF +W  G   +G DS AV
Sbjct: 132 AAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAV 191

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
              +   W DL I +  +  ++K+  S   M  +   SP      Q  +   +  +++AI
Sbjct: 192 QLADETHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPGRVLKMEEAI 251

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 252 KNRDFESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTF 311

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           DAGPN  L+   +  +T   F  ++    P    DL
Sbjct: 312 DAGPNAVLI--AQNRKTAAHFLQKLLYYFPPQDNDL 345


>gi|254582390|ref|XP_002497180.1| ZYRO0D17270p [Zygosaccharomyces rouxii]
 gi|186703818|emb|CAQ43507.1| Diphosphomevalonate decarboxylase [Zygosaccharomyces rouxii]
 gi|238940072|emb|CAR28247.1| ZYRO0D17270p [Zygosaccharomyces rouxii]
          Length = 397

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 110/340 (32%), Positives = 171/340 (50%), Gaps = 24/340 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T   T  +   D + L
Sbjct: 4   HIASTTAPVNIATLKYWGKRDKALNLPTNSSISVTLSQEDLRTLTSAATGPELKQDKLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG++ S +S   ++  +     R+           FS     I + NN PT AGLASSA+
Sbjct: 64  NGKEESLESERTQQCLKGLRKLRKELEDKDSNLPKFSNWGLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL +A+ R+Y +P+    LS +AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVVAIARLYQLPQSMSELSEIARQGSGSACRSLFGGYVAWEMGEKEDGSDSKAVEI 183

Query: 188 N--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIID 244
           +    WP ++  +L +   +K   S   M++T   S  F +  +  +     H+K+AI  
Sbjct: 184 SPLEHWPQMKAAILVVNASKKDTPSTSGMQLTVKTSELFQERVKNVVPQRFTHMKEAIEH 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +++ K  E+  K++   HAT + + PP+ Y    + + ++      +      + +T DA
Sbjct: 244 KNWPKFAELTMKDSNSFHATCLDSYPPIFYMNDTSKKIIKLCHAINEFYGKTVVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDS 342
           GPN  L +  + E  +  F  ++    P      W TK S
Sbjct: 304 GPNAVLYYLQENEAKLFAFIYKLFDKVP-----GWETKFS 338


>gi|126304960|ref|XP_001376834.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 398

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 101/329 (30%), Positives = 156/329 (47%), Gaps = 22/329 (6%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
              K     +   P+NIA+ KYWGKRD KL LP+N+SLS++L    L T T   +  D  
Sbjct: 2   AAEKPLVSVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFK 61

Query: 73  ADCIILNGQKISS----QSSFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAG 121
            D I LNG++         S  ++  +     R  S            I + N+ PT AG
Sbjct: 62  EDRIWLNGKEEDVGHHRLQSCLREIRRLARKRRSGSDGDLVPLSYKVHIASVNDFPTAAG 121

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+G+A L   L ++Y +      LS VAR GSGSACRS + GF +W  G   +G D
Sbjct: 122 LASSAAGYACLVYTLAQLYGVE---SELSEVARQGSGSACRSMFGGFVQWHMGERPDGKD 178

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHI 238
           S A  V   + WP+LR+ +L +    K + S   M+ +   S       +  +   +A +
Sbjct: 179 SIAQQVAPESHWPELRVLVLVVSAERKPVSSTSGMQTSVETSSLLKFRAESVVPGRMAEM 238

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPI 296
            + I ++DF   G++  K++ + HAT +   PP+ Y    + Q +  V   +A      +
Sbjct: 239 ARCIKERDFEAFGQLTMKDSNQFHATCLDTFPPICYLNDTSRQIISLVHCFNAYYGKTKV 298

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
            +T DAGPN  +    +  +       ++
Sbjct: 299 AYTFDAGPNAVIFTLEETVDEFVAVIKQV 327


>gi|330799300|ref|XP_003287684.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
 gi|325082304|gb|EGC35790.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
          Length = 388

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 107/348 (30%), Positives = 167/348 (47%), Gaps = 19/348 (5%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADC 75
            +    +   P NIA+ KYWGKRD KL LPLN+SLS +L    L T T I   +    D 
Sbjct: 1   MVLASITCSAPVNIAVIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDA 60

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR---QFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
           I LNG+K    ++ ++   +         Q  K    I + NN PT AGLASSASG+  L
Sbjct: 61  IWLNGKKEDINATRYQNVLKAIRSRATKLQDKKHCVHIVSINNFPTAAGLASSASGYCCL 120

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQ 190
              L +IY +      +S +AR+GSGSACRS Y GF +W  G  ++G DS AV     + 
Sbjct: 121 VYTLAQIYGVD---GDISGIARIGSGSACRSMYGGFVKWEMGEKEDGSDSIAVQVQPESH 177

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++ I +L + D++K+  S + M+ +   SP   +       T +  I++AI ++DF  
Sbjct: 178 WPEMNIIVLVVNDKKKETSSTDGMQKSAATSPMMKERCAVTVPTRMRDIEEAIKNKDFQT 237

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLK 307
            G++  K++   H      +P + Y    +   M  +    +   S+   +T DAGPN  
Sbjct: 238 FGDITMKDSDDFHEVCATTTPAIYYLNDTSRYIMNLIHRYNKLSGSVKCAYTFDAGPNAC 297

Query: 308 LLFTHKIEETIK----QFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
           +    +    +     + FP+  +      P   + +   S K + +L
Sbjct: 298 IYLPEENVVEVLSLFIKHFPDQDLSTYYRGPKE-NVEKIQSYKPNEKL 344


>gi|50311049|ref|XP_455548.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644684|emb|CAG98256.1| KLLA0F10285p [Kluyveromyces lactis]
          Length = 397

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 107/343 (31%), Positives = 170/343 (49%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T  T       D + L
Sbjct: 4   YSASTTAPVNIATLKYWGKRDKVLNLPTNSSISVTLSQEDLRTLTTATTSPDFAKDQLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG++ S  S   +   Q     R+           FS+    I + NN PT AGLASSA+
Sbjct: 64  NGKEESLASERTQHCLQDLRQLRRELEEKDSSLPTFSQWKLHIASENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+    LS++AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALIKAIAKLYELPQSESELSKIARKGSGSACRSLFGGYVAWEMGKLEDGSDSKAVEI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
            +   WP+++  +L +   +K   S   M++T   S  F +     +      +K++I++
Sbjct: 184 GSLNHWPEMKAAILVVSADKKDTPSTSGMQLTVKTSDLFQERINNVVPKRFEQMKKSILE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    E+  K++   HAT + + PP+ Y    + + ++      +      + +T DA
Sbjct: 244 KDFPTFAELTMKDSNSFHATCLDSYPPIFYLNDTSKKVIKLCHAINEFYNETVVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E+ +  F   +       +   W +K +  Q
Sbjct: 304 GPNAVLYYLEQSEDKLFAFLYHL-----FQNVSGWESKFTKEQ 341


>gi|296415239|ref|XP_002837299.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633160|emb|CAZ81490.1| unnamed protein product [Tuber melanosporum]
          Length = 390

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 106/350 (30%), Positives = 161/350 (46%), Gaps = 23/350 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S   P NIA+ KYWGKR  KLNLP N+SLS++L    L T T          + + L
Sbjct: 7   YSASTTAPVNIAVVKYWGKRSVKLNLPTNSSLSVTLSQADLKTHTTAACSSTFTENSLWL 66

Query: 79  NGQKISSQSSF-----------FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSAS 127
           NG+      +             KK         + S+ Y  + + NN PT AGLASSA+
Sbjct: 67  NGEAQDVSGARQTACFRELKALRKKLEDANPSLPKMSEYYVHVVSENNFPTAAGLASSAA 126

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+  +Y +PE    LS++AR GSGSACRS + G+  W  G   +G DS+AV  
Sbjct: 127 GFAALVRAIADLYELPESPTELSKIARQGSGSACRSLFGGYVAWEMGQAVDGSDSYAVEV 186

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
                WP+++  +L +   +K + S   M+ T + S  FT      +   +  +K AI +
Sbjct: 187 APASHWPEMKAAILVVSAAKKSVSSTAGMQATVNTSALFTHRACDVVPKRMEAMKAAIEN 246

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIPI-YFTLDA 302
           +DF +       ++ + HA  +  +PP+ Y    +   +  V      +   +  +T DA
Sbjct: 247 RDFEQFAAHTMADSNQFHAVCLDTTPPIFYMNDVSRAAIRAVEALNTHEGRVVGAYTFDA 306

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           GPN  + +  K EE I  F   +           W+ K +       + G
Sbjct: 307 GPNAVIYYQEKDEEKILGFLGTLL----APEVAEWAGKYAKVTPEGYDNG 352


>gi|171678217|ref|XP_001904058.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937178|emb|CAP61835.1| unnamed protein product [Podospora anserina S mat+]
          Length = 395

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 111/352 (31%), Positives = 169/352 (48%), Gaps = 25/352 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S    + D 
Sbjct: 6   YRASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASFPASEGDA 65

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLAS 124
           ++LNG+      +  +   +     R           + S     + + NN PT AGLAS
Sbjct: 66  LLLNGEPSDISGARTQACLRELRSRRAALEAADPSLPKLSTYPLRLVSENNFPTAAGLAS 125

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A
Sbjct: 126 SAAGFAALVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGDKADGTDSMA 185

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQA 241
             V   + WPD+R  +L +   +K + S   M+ T   S  F +     +  ++A +++A
Sbjct: 186 DQVAEASHWPDMRALVLVVSAAKKGVSSSSGMQQTVATSGLFRERIATVVPENMAIMEKA 245

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFT 299
           I ++DF K  EV  +++   HAT     PP+ Y    +   +  V   + +       +T
Sbjct: 246 IAEKDFEKFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINEKAGRTVAAYT 305

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
            DAGPN  + +  K  E +   F     +        W + D    K +I L
Sbjct: 306 FDAGPNAVIYYQEKDTEAVVGTF---YHVLQGADIGGWKSADIKGLKPTISL 354


>gi|294654829|ref|XP_456912.2| DEHA2A13398p [Debaryomyces hansenii CBS767]
 gi|218512031|sp|Q6BY07|ERG19_DEBHA RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
 gi|199429182|emb|CAG84889.2| DEHA2A13398p [Debaryomyces hansenii]
          Length = 388

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 113/357 (31%), Positives = 183/357 (51%), Gaps = 24/357 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIIL 78
             SSA  P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +    D   D + L
Sbjct: 4   YTSSATAPVNIATLKYWGKRDKSLNLPTNSSISVTLSQNDLRTLTSVAASEDFKEDKLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S +S   K         R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGKLESLESERTKACLADLRTLRKELESNDSSIPKLSQFGVHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL +++ ++Y +P+    +S++AR GSGSACRS + G+  W  G + NG DS AV  
Sbjct: 124 GFAALVVSIAKLYELPQNMSEISKIARKGSGSACRSLFGGYVAWEMGQETNGEDSKAVEV 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
                WP+++  +L + D +K   S   M+ T   S  F     + +      +K +I+ 
Sbjct: 184 APLSHWPNMKAAILVVSDDKKDTPSTSGMQTTVATSDLFQWRIKEVVPKRFDDMKDSILR 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA--RQQSIPIYFTLDA 302
           +DF   G++  K++   HA  + ++PP+ Y    + + ++ + +   R+  I   +T DA
Sbjct: 244 KDFATFGDLTMKDSNSFHAVCLDSTPPIFYLNDTSKKIIKLIHELNKREGKIIAAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIK----QFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           GPN  + +  + E  +     ++F +++  + LD+  L +T D  +     + G+SK
Sbjct: 304 GPNAVIYYEQENESKVLGVIYKYFSKVSGWEKLDTKTLDTTSDIQADPELYK-GVSK 359


>gi|322707809|gb|EFY99387.1| diphosphomevalonate decarboxylase [Metarhizium anisopliae ARSEF 23]
          Length = 391

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 113/358 (31%), Positives = 174/358 (48%), Gaps = 24/358 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  D D ++
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQADLRTLTTASCSASFSDGDSLM 66

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +     R           + S +   I + NN PT AGLASSA
Sbjct: 67  LNGELSDISGARTQACFRELRARRAALEASNASLPKLSTLPLKIVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAAL  A+  +Y +PE    LS +AR GSGSACRS + G+  W  G  ++G DS A  
Sbjct: 127 AGFAALVQAIANLYELPESPSELSLIARQGSGSACRSLFGGYVAWRMGDKEDGSDSMADL 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAII 243
           V   + WP +R  +L +   +K + S   M+ T   S  F Q   Q +  ++  +++AI 
Sbjct: 187 VAPASHWPSMRALILVVSAAKKGVSSTSGMQQTVATSGLFQQRIAQVVPANMDLMEKAIK 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFTLD 301
            +DF K  EV  +++   HA      PP+ Y    +   +  V   +A+       +T D
Sbjct: 247 AKDFAKFAEVTMRDSNSFHACCADTYPPIFYMNDVSRAAIRAVESINAKAGKTIAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD----SLSQKNSIELGISK 355
           AGPN  + +  +   T+   F  +         D  S K          ++++ G+S+
Sbjct: 307 AGPNCVVYYLEEDAPTVLGAFAGVLNGVSGWKDDSSSVKSGAKLEDGIASTLKDGVSR 364


>gi|159024148|gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
          Length = 422

 Score =  348 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 105/363 (28%), Positives = 177/363 (48%), Gaps = 25/363 (6%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS 71
            E + K     +A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V  S
Sbjct: 3   AEQSKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPS 62

Query: 72  -DADCIILNGQKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNN 115
              D + LN ++IS   + ++   +                      +  ++  I++ NN
Sbjct: 63  FQQDRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNN 122

Query: 116 IPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT 175
            PT AGLASSA+GFA L  +L ++ ++ E +  LS +AR GSGSACRS + GF +W+ G 
Sbjct: 123 FPTAAGLASSAAGFACLVFSLAKLMNVQEDNGRLSAIARQGSGSACRSLFGGFVKWVMGK 182

Query: 176 DQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQIS 232
           +++G DS AVP  +   W +L I +  +  R+K+  S   M  T   S        + + 
Sbjct: 183 EEDGSDSIAVPLADEKHWDELVIIIAVVSSRQKETSSTSGMRETVVTSALIDHRAKEVVP 242

Query: 233 TDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-RQ 291
             +  +++AI ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V    R 
Sbjct: 243 KRIVQMEEAIQNRDFPTFAQLTCSDSNQFHAVCMDTSPPIFYMNDTSHRVISCVEKWNRA 302

Query: 292 QSIP-IYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
           +  P + +T DAGPN  L+  ++   T+      +    P +S     +     +    +
Sbjct: 303 EGTPQVAYTFDAGPNAVLIARNRKAATL--MLQRLLFHFPPNSDTDLDSYVIGDKSILKD 360

Query: 351 LGI 353
            GI
Sbjct: 361 AGI 363


>gi|213514480|ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gi|209156004|gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
          Length = 402

 Score =  348 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 101/336 (30%), Positives = 155/336 (46%), Gaps = 28/336 (8%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID 70
           + E + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T +    
Sbjct: 1   MPEVSGKKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSR 60

Query: 71  S-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNI 116
           S   D I LNG++        +   +      +  +                 I + NN 
Sbjct: 61  SFQEDRIWLNGKEEDITQPRLQSCLREIRCLSRKRRSDGEADVDAAGLSHKVHICSVNNF 120

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSA+G+A L   L R+  +      LS V+R GSGSACRS Y GF +W+ G  
Sbjct: 121 PTAAGLASSAAGYACLVYTLSRVMGVE---GELSAVSRQGSGSACRSMYGGFVQWLMGQQ 177

Query: 177 QNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QIST 233
            +G DS A        WP+LR+ +L +    K +GS   M+ +   S          +  
Sbjct: 178 GDGKDSLAQQVEPETHWPELRVLVLVVSAERKPVGSTSGMQTSVETSILLKHRADSVVPA 237

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-- 291
            +  + +A+  +DF    E+  K++ + HAT +   PP+ Y    + + +  V    +  
Sbjct: 238 RMKEMIEAVHKRDFTAFAELTMKDSNQFHATCLDTYPPIFYLNDVSRRVINLVHRYNRHY 297

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEET----IKQFFP 323
           +   + +T DAGPN  +    +  E     +K FFP
Sbjct: 298 RETKVAYTFDAGPNAVIYTLQQNVEEFVQVVKHFFP 333


>gi|13539580|emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
          Length = 401

 Score =  348 bits (893), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 102/346 (29%), Positives = 157/346 (45%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  +     WP LRI +L +   +K+ GS   M+ +   S       +  +   + 
Sbjct: 180 KDSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESGVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF   G++  K++ + HAT +   PP+ Y    + + ++ V      Q   
Sbjct: 240 EMTRCIQEQDFQGFGQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHQGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|255730117|ref|XP_002549983.1| diphosphomevalonate decarboxylase [Candida tropicalis MYA-3404]
 gi|240131940|gb|EER31498.1| diphosphomevalonate decarboxylase [Candida tropicalis MYA-3404]
          Length = 370

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 103/318 (32%), Positives = 160/318 (50%), Gaps = 17/318 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T     +  + D + L
Sbjct: 2   YTASVTAPVNIATLKYWGKRDKNLNLPTNSSISVTLSQDDLRTLTTAAADETFEKDQLWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +         RQ            S++   I + NN PT AGLASSA+
Sbjct: 62  NGKLESLDTPRTQACLADLRQLRQNVESTNSSLPKLSQMKLHIVSENNFPTAAGLASSAA 121

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ +++ +P+    LS++AR GSGSACRS + GF  W  G   +G DS AV  
Sbjct: 122 GFAALITAIAKLFELPQDMSELSKIARKGSGSACRSLFGGFVAWEMGQAADGEDSKAVEV 181

Query: 188 N--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
              + WP +R  +L + D +K   S   M+ T   S  F     + +      +K++I++
Sbjct: 182 APLDHWPSMRAVILVVSDDKKDTPSTTGMQATVQTSDLFAHRITEVVPKRFEEMKKSIVE 241

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
           +DF K  E+  K++   HA  + + PP+ Y    + + ++ V    ++S    +T DAGP
Sbjct: 242 KDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKRIIKLVEGINKESTIAAYTFDAGP 301

Query: 305 NLKLLFTHKIEETIKQFF 322
           N  + +    E+ +    
Sbjct: 302 NAVIYYDAANEDKVLSEL 319


>gi|119188217|ref|XP_001244715.1| hypothetical protein CIMG_04156 [Coccidioides immitis RS]
          Length = 621

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 110/347 (31%), Positives = 166/347 (47%), Gaps = 27/347 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            +SS   P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +  DS    + D 
Sbjct: 227 YRSSTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQANLRAHTTASCSDSYPHAEGDT 286

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           ++LN +  +  +S              +          + S     I + NN PT AGLA
Sbjct: 287 LVLNSKPQNIHASKRTLACLADLRILRRALEDADPSLPRLSAFPLRIVSENNFPTAAGLA 346

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS 
Sbjct: 347 SSAAGFAALVRAVADLYDLPQSPSELSRIARQGSGSACRSLMGGYVAWKSGAKEDGSDSL 406

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQ 240
           A  V   + WP++R  +L + D +K + S E M+ TR  S  F       +   +A +++
Sbjct: 407 AEQVAPASHWPEMRALILVVSDAKKDVPSTEGMQATRATSTLFPFRVTSVVPERMAAMEK 466

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI ++DF    E+  +++   HAT +   PP+ Y    +   +  V D  +        +
Sbjct: 467 AIQNRDFASFAEITMRDSNNFHATCLDTWPPIFYMNDVSRAAVRVVHDVNRAAGETICAY 526

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           T DAGPN  + +  K  + +   F +I   D     + W        
Sbjct: 527 TFDAGPNAVIYYLEKDSDRVLGTFRKILKSD----TEGWGETKPAQD 569


>gi|297820160|ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297323801|gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 419

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 173/354 (48%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V    D D + LNG
Sbjct: 10  VTAKTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV
Sbjct: 130 AAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 250 KNRDFASFTQLTCTDSNQFHAVCVDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+   +  +   Q    +    P  S     +  +       E G+ 
Sbjct: 310 DAGPNAVLI--ARNRKVAVQLLQGLLYYFPPKSDTDMKSYVAGDNSILKEAGLD 361


>gi|242063382|ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gi|241932811|gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
          Length = 420

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 171/353 (48%), Gaps = 26/353 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 12  ATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 71

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 72  KEISLLGGRFQSCLREIRKRARDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAAGLASS 131

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G A     L ++ ++ E    LS +AR GSGSACRS Y GF +W  G   +G DS AV
Sbjct: 132 AAGLACFVFTLGKLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAV 191

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
              +   W DL I +  +  ++K+  S   M  +   SP      Q  + + +  +++AI
Sbjct: 192 QLADETHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPSRVLKMEEAI 251

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 252 KNRDFESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTF 311

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGI 353
           DAGPN  L+   +  +T      ++    P    DL S+     +    + G+
Sbjct: 312 DAGPNAVLI--AQNRKTAAHLLQKLLYYFPPQDKDL-SSYLVGDKSILGDAGV 361


>gi|256985114|ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 gi|160332329|sp|Q99JF5|ERG19_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|74147844|dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gi|148679734|gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
          Length = 401

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 101/346 (29%), Positives = 156/346 (45%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  +     WP LRI +L +   +K+ GS   M+ +   S       +  +   + 
Sbjct: 180 KDSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF    ++  K++ + HAT +   PP+ Y    + + ++ V      Q   
Sbjct: 240 EMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHQGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|14250208|gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
          Length = 401

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 100/346 (28%), Positives = 155/346 (44%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  +     WP LRI +L +   +K+ GS   M+ +   S       +  +   + 
Sbjct: 180 KDSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF    ++  K++ + HAT +   PP+ Y    + + ++ V          
Sbjct: 240 EMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|303316472|ref|XP_003068238.1| diphosphomevalonate decarboxylase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240107919|gb|EER26093.1| diphosphomevalonate decarboxylase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320037997|gb|EFW19933.1| diphosphomevalonate decarboxylase [Coccidioides posadasii str.
           Silveira]
          Length = 403

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 110/351 (31%), Positives = 168/351 (47%), Gaps = 27/351 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            +SS   P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +  DS    + D 
Sbjct: 9   YRSSTTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQANLRAHTTASCSDSYPHAEGDT 68

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           ++LN +  +  +S              +          + S     I + NN PT AGLA
Sbjct: 69  LVLNSKPQNIHASKRTLACLADLRILRRALEDADPSLPRLSAFPLRIVSENNFPTAAGLA 128

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  GT ++G DS 
Sbjct: 129 SSAAGFAALVRAVADLYDLPQSPSELSRIARQGSGSACRSLMGGYVAWRSGTKEDGSDSL 188

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQ 240
           A  V   + WP++R  +L + D +K + S E M+ TR  S  F       +   +A +++
Sbjct: 189 AEQVAPASHWPEMRALILVVSDAKKDVPSTEGMQATRATSTLFPFRVTSVVPERMAAMEK 248

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           A+ ++DF    E+  +++   HAT +   PP+ Y    +   +  V D  +        +
Sbjct: 249 AVQNRDFASFAEITMRDSNNFHATCLDTWPPIFYMNDVSRAAVRVVHDVNRAAGETICAY 308

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
           T DAGPN  + +  K  + +   F +I         + W          S+
Sbjct: 309 TFDAGPNAVIYYLEKDSDRVLGTFRKIL----KPDTEGWGETKPAQDATSL 355


>gi|226504358|ref|NP_001149256.1| LOC100282878 [Zea mays]
 gi|195625824|gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gi|238011262|gb|ACR36666.1| unknown [Zea mays]
          Length = 420

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 102/336 (30%), Positives = 163/336 (48%), Gaps = 25/336 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 12  ATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 71

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 72  KEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAAGLASS 131

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G A     L ++ +  E    LS +AR GSGSACRS Y GF +W  G   +G DS AV
Sbjct: 132 AAGLACFVFTLGKLMNAKEDYGELSSIARQGSGSACRSIYGGFVKWCMGEKDDGSDSIAV 191

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
              +   W DL I +  +  ++K+  S   M  +   SP      Q  +   +  +++AI
Sbjct: 192 QLADETHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPGRVLKMEEAI 251

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 252 KNRDFESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTF 311

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           DAGPN  L+   +  +T      ++    P    DL
Sbjct: 312 DAGPNAVLI--AQNRKTAAHLLQKLLYYFPPQDNDL 345


>gi|13592005|ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 gi|2498339|sp|Q62967|ERG19_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|1322245|gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
          Length = 401

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 101/346 (29%), Positives = 151/346 (43%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N SLS++L    L T T   +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFS-------------KVYFLIETSNNIPTK 119
            D I LNG++        +   +      +                    + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLARVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLA 236
            DS A  +     WP LR+ +L +   +K  GS   M+ +   S       + I    + 
Sbjct: 180 KDSIARQIAPEWHWPQLRVLILVVSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF    ++  K++ + HAT +   PP+ Y    + + ++ V          
Sbjct: 240 EMTRCIQEQDFQAFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNAHHGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|215261394|pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 gi|215261395|pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
          Length = 414

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 100/338 (29%), Positives = 154/338 (45%), Gaps = 27/338 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNG 80
            +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D   D I LNG
Sbjct: 24  VTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNG 83

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTKAGLASSAS 127
           ++        +   +      +  +                 + + NN PT AGLASSA+
Sbjct: 84  REEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAA 143

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A  +
Sbjct: 144 GYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQI 200

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIID 244
                WP LRI +L +   +K+ GS   M+ +   S       +  +   +  + + I +
Sbjct: 201 APEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQE 260

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDA 302
           QDF    ++  K++ + HAT +   PP+ Y    + + ++ V           + +T DA
Sbjct: 261 QDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDA 320

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
           GPN  +       +T+ +F   +    P  +      K
Sbjct: 321 GPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 355


>gi|21593039|gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
          Length = 404

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 105/352 (29%), Positives = 172/352 (48%), Gaps = 26/352 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  S D D + LNG
Sbjct: 2   VTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLNG 61

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 62  KEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV
Sbjct: 122 AAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAV 181

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 182 QLVDDKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAI 241

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+    +  I +T 
Sbjct: 242 KNRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTF 301

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           DAGPN  ++   +  +   +    +    P   PD       L   + ++  
Sbjct: 302 DAGPNAVMI--ARNRKVAVELLQGLLYCFP-PKPDTDMKSYVLGDTSIVKEA 350


>gi|15224931|ref|NP_181404.1| MVD1 (MEVALONATE DIPHOSPHATE DECARBOXYLASE 1); diphosphomevalonate
           decarboxylase/ protein homodimerization [Arabidopsis
           thaliana]
 gi|2288887|emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|3250736|emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|3786002|gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|31711704|gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 gi|110736665|dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gi|330254480|gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
          Length = 412

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 105/352 (29%), Positives = 172/352 (48%), Gaps = 26/352 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V  S D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV
Sbjct: 130 AAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLVDDKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+    +  I +T 
Sbjct: 250 KNRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           DAGPN  ++   +  +   +    +    P   PD       L   + ++  
Sbjct: 310 DAGPNAVMI--ARNRKVAVELLQGLLYCFP-PKPDTDMKSYVLGDTSIVKEA 358


>gi|51980639|gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gi|149038387|gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
          Length = 401

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 101/346 (29%), Positives = 152/346 (43%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFS-------------KVYFLIETSNNIPTK 119
            D I LNG++        +   +      +                    + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLSLGYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLARVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLA 236
            DS A  +     WP LR+ +L +   +K  GS   M+ +   S       + I    + 
Sbjct: 180 KDSIARQIAPEWHWPQLRVLILVVSAEKKPTGSTVGMQTSVATSTLLKFRAESIVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF    ++  K++ + HAT +   PP+ Y    + + ++ V          
Sbjct: 240 EMTRCIQEQDFQAFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNAHHGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|168044045|ref|XP_001774493.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674205|gb|EDQ60717.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 426

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 107/354 (30%), Positives = 171/354 (48%), Gaps = 26/354 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD KL LP+N+S+S++L   HL   T +      + D + LNG+
Sbjct: 14  TARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERDRLWLNGK 73

Query: 82  KISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S +   ++   +                      +S ++  I + NN PT AGLASSA
Sbjct: 74  EVSVEGERYRNCLREMRARATDVVIESSGKVITKEVWSTLHIHIASENNFPTAAGLASSA 133

Query: 127 SGFAALTLALFRIYSIPEKSE-SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L  +L ++ ++ EK E  L+ +ARLGSGSACRS Y GF +W  G + +G DS A 
Sbjct: 134 AGFACLVYSLAQLMNVKEKYEGELTAIARLGSGSACRSLYGGFVKWNMGKEADGKDSIAT 193

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAI 242
                  W DL I +  +  R+K+  S   M+ +   SP      +++    +  +++AI
Sbjct: 194 QLAEQSHWEDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEMVPKRIGQMEKAI 253

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
              DF +   +   ++ + HAT +  SPP+ Y    + + +  V  W+       + +T 
Sbjct: 254 KSMDFAEFARITCADSNQFHATCLDTSPPIFYLNDSSRRLIGLVERWNRHAGEPQVAYTF 313

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  +    K +E   Q    +    P  +    S      Q      G++
Sbjct: 314 DAGPNAVMF--AKNKEVAVQLLKRLLYQFPPSAEADLSRYVLGDQSVLKSAGVT 365


>gi|21593243|gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis
           thaliana]
          Length = 419

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 103/354 (29%), Positives = 170/354 (48%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
            +A  P+NIA+ KYWGKR     LP+N+S+S++L   HL T+T + V    D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRHEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K+   I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV
Sbjct: 130 AAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 250 KNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+   +  +   Q    +    P  S     +          E G+ 
Sbjct: 310 DAGPNAVLI--ARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLD 361


>gi|224286774|gb|ACN41090.1| unknown [Picea sitchensis]
          Length = 422

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 101/355 (28%), Positives = 173/355 (48%), Gaps = 26/355 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD KL LP+N+S+S +L   HL   T + V  S  +D + LNG
Sbjct: 12  VTARAPTNIAVIKYWGKRDEKLILPINDSISFTLDPDHLSATTTVAVSPSFTSDRMWLNG 71

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           +++S     ++   +                      + +++  I + NN PT AGLASS
Sbjct: 72  KEVSLGGERYQNCLREIRSRGNDVVDEKNGIVIRKEDWQRLHLHIASYNNFPTAAGLASS 131

Query: 126 ASGFAALTLALFRIYSIPEKSE-SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           A+GFA L  +L ++  + EK +  L+ +AR GSGSACRS Y G  +W  G + +G DS A
Sbjct: 132 AAGFACLVYSLAKLMDVKEKYQGELTAIARRGSGSACRSLYGGVVKWQMGKETDGSDSIA 191

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQA 241
           V       W +L I +  +  R+K+  S   M  +   S      + + +   +  +++A
Sbjct: 192 VQLATEKHWEELVILVAVVSSRQKETSSTTGMSQSVETSELLRHRSQEVVPKRVLQMEEA 251

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFT 299
           I ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T
Sbjct: 252 IANRDFGSFAKITCADSNQFHAVCLDTSPPIFYMNDTSHRIINCVERWNRSEGTPQVAYT 311

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
            DAGPN  +   ++    +      +    P DS   +S+          E+G++
Sbjct: 312 FDAGPNAVMYAPNRKVAGLL--LQRLLFYFPPDSSKTFSSYVIGDTSILEEIGVN 364


>gi|225560523|gb|EEH08804.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus G186AR]
          Length = 406

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 110/341 (32%), Positives = 162/341 (47%), Gaps = 27/341 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADC 75
            ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +          D 
Sbjct: 8   YRASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQGSLRAYTTASCSPTYPTDAGDS 67

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LN Q  + + S              ++         + S     I + NN PT AGLA
Sbjct: 68  LTLNSQPQNIKDSKRTLACLSDLRSLRRELENANPSLPKLSGFPLRIVSENNFPTAAGLA 127

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSF
Sbjct: 128 SSAAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRMGVLEDGSDSF 187

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
           A  V   + WP++R  +L + D +K + S + M+ T   S  F    +  +   +A I+ 
Sbjct: 188 AEEVAPASHWPEMRALILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIES 247

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI ++DF    E+  K++   HAT +   PP  Y    +   +  V D  +        +
Sbjct: 248 AIKNRDFASFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAY 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           T DAGPN  + +  K  E +   F  I   +     + W  
Sbjct: 308 TFDAGPNAVIYYLDKDSEHVIGTFKSILKAE----TEGWDG 344


>gi|39963452|ref|XP_364905.1| hypothetical protein MGG_09750 [Magnaporthe oryzae 70-15]
 gi|145015469|gb|EDK00006.1| hypothetical protein MGG_09750 [Magnaporthe oryzae 70-15]
          Length = 385

 Score =  346 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 168/353 (47%), Gaps = 27/353 (7%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI----DSDAD 74
             +++   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  T       +  D
Sbjct: 6   TFRATTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLAQSDLRTLTTATCSSDRPAAQGD 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLA 123
            +ILNG++     +  +   +     R           + S     I T NN PT AGLA
Sbjct: 66  SLILNGEESDVSGARTQACFRELRARRRVLEDADSSLPKLSTFALKIVTENNFPTAAGLA 125

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LS++AR GSGSACRS + G+  W  GT  +G DS 
Sbjct: 126 SSAAGFAALVRAIADLYQLPDSPAELSKIARQGSGSACRSLFGGYVAWREGTAADGSDSL 185

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQ 240
           A  V   + WP++R  +L     +K + S   M+ T   S  F Q   + +  ++  +++
Sbjct: 186 AEQVAPASHWPEMRAIVLVASAMKKGVSSTSGMQQTVATSTLFKQRIAEVVPANMKTMEE 245

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYF 298
           AI ++DF    EV  +++   HAT     PP+ Y    +   +  V             +
Sbjct: 246 AIQNRDFASFAEVTMRDSNSFHATCADTYPPIFYMNDTSRAAIRAVEAINAAAGRTIAAY 305

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
           T DAGPN  + F  +  + +   F +I     + S D W           +E+
Sbjct: 306 TFDAGPNAVVYFLEQDAKVVVGSFAKI-----VGSVDGWKEGAKDFAAQGVEI 353


>gi|74218080|dbj|BAE42019.1| unnamed protein product [Mus musculus]
          Length = 401

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 100/346 (28%), Positives = 155/346 (44%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  +     WP LRI +L +   +K+ GS   M+ +   S       +  +   + 
Sbjct: 180 KDSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSI 294
            + + I +QDF    ++  K++ + HAT +   PP+ Y    + + ++ V          
Sbjct: 240 EMTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHLGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|301755146|ref|XP_002913420.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate
           decarboxylase-like [Ailuropoda melanoleuca]
          Length = 400

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 106/358 (29%), Positives = 163/358 (45%), Gaps = 28/358 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKSLVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFS-------------KVYFLIETSNNIPTK 119
            D I LNG++        +   +      +                    I + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRRLARKRSSAGEEXPLPLSLSYKVHIASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L  AL R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYALARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGERADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K +GS   M+ +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKPMGSTAGMQTSVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + + ++DF   G++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMTRCVQERDFQGFGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIVHLVHRFNAHHGQT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNSIEL 351
            + +T DAGPN  +       +T+ +F   +    P +S  D +     +      + 
Sbjct: 299 KVAYTFDAGPNAVVFTLD---DTVPEFVAAVRHCFPPESNGDKFLKGLPIRPAPLSDE 353


>gi|328876171|gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
          Length = 415

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 102/319 (31%), Positives = 153/319 (47%), Gaps = 14/319 (4%)

Query: 15  ECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS- 71
             N  +    +   P NIA  KYWGKRD  L LPLN+SLS +L    L T T     +S 
Sbjct: 19  NNNNSMLASVTCTAPVNIATIKYWGKRDENLILPLNSSLSGTLHQDDLKTTTTAVASESF 78

Query: 72  DADCIILNGQKISSQSSFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASG 128
           + D + LNG+K    S  ++   +            K +  I + NN PT AGLASSASG
Sbjct: 79  EEDALWLNGKKEDVNSVRYQNVLKTIRSRATKLMDKKHFVHICSINNFPTAAGLASSASG 138

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF- 187
           +A L   L ++Y +      +S +ARLGSGSACRS + GF +W  GT  +G DS AV   
Sbjct: 139 YACLVYVLAQLYGVE---GDVSSIARLGSGSACRSMFGGFVKWEMGTKADGSDSIAVQVA 195

Query: 188 -NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIIDQ 245
             + WPD+ I +L + D++K+  S + M+ +   S    +     +   +  I++AI + 
Sbjct: 196 PESHWPDMNIIVLVVNDKKKETSSTDGMQRSAQTSAMMKERCATTVPERMVTIERAIQEH 255

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
           DF   G++  K++   H       PP+ Y    +   M  +    +   S+   +T DAG
Sbjct: 256 DFQTFGDITMKDSDDFHEVCATTDPPIYYLNDTSRYIMNLIHRYNKLAGSVRCAYTFDAG 315

Query: 304 PNLKLLFTHKIEETIKQFF 322
           PN  +    +    +   F
Sbjct: 316 PNACIYLPQESVAEVLSLF 334


>gi|257871001|ref|ZP_05650654.1| diphosphomevalonate decarboxylase [Enterococcus gallinarum EG2]
 gi|257805165|gb|EEV33987.1| diphosphomevalonate decarboxylase [Enterococcus gallinarum EG2]
          Length = 339

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 131/341 (38%), Positives = 184/341 (53%), Gaps = 10/341 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
            K  A   +NIAL KYWGK +  L LP+NNSLSL+L    T T +T  +    D   L+ 
Sbjct: 2   YKGKARAYTNIALIKYWGKENETLILPMNNSLSLTLDAFYTETSVTFSEEYTQDRFFLDD 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           ++ S   +  KK + F DL R  +    +  + + N +PT AGLASSASG AAL  A   
Sbjct: 62  KQQS--EAATKKISAFLDLVRAKANCPFFAQVNSRNFVPTAAGLASSASGLAALAGACNA 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +      LSR+AR GSGSACRS + GF EW  G D +   +  +       +L +  
Sbjct: 120 ALDLQLSQTELSRLARRGSGSACRSIFGGFVEWHTG-DDDTSYATPIASEGWEKELSMLF 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D+EK + SR+ M  T   S +++ W +    DL  +KQAI ++DF  LGE  E NA
Sbjct: 179 ILINDKEKDVSSRDGMRRTVETSSYYSGWLESTPHDLKKLKQAIREKDFQLLGETTEANA 238

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMHAT +AA+PP  YW  E+++ M+ V   RQ+ +  YFT+DAGPN+K+L   K EE I
Sbjct: 239 LKMHATTMAATPPFTYWSPESLRAMDCVRSLRQKGLACYFTMDAGPNVKVLCQRKDEEAI 298

Query: 319 ----KQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
               K+ F    +I       L     +++  +    G+SK
Sbjct: 299 LTQLKKDFHPEQLIVAHAGQGLVDLPMTVTDPSMTNEGVSK 339


>gi|190408959|gb|EDV12224.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae
           RM11-1a]
 gi|259148994|emb|CAY82238.1| Mvd1p [Saccharomyces cerevisiae EC1118]
 gi|323303229|gb|EGA57028.1| Mvd1p [Saccharomyces cerevisiae FostersB]
 gi|323331783|gb|EGA73196.1| Mvd1p [Saccharomyces cerevisiae AWRI796]
 gi|323335756|gb|EGA77037.1| Mvd1p [Saccharomyces cerevisiae Vin13]
 gi|323346764|gb|EGA81045.1| Mvd1p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323352485|gb|EGA84986.1| Mvd1p [Saccharomyces cerevisiae VL3]
          Length = 396

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 106/343 (30%), Positives = 172/343 (50%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  +  +      +++AI++
Sbjct: 184 ADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 341


>gi|115495513|ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 gi|122144236|sp|Q0P570|ERG19_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|112362156|gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 gi|296477937|gb|DAA20052.1| diphosphomevalonate decarboxylase [Bos taurus]
          Length = 400

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 103/346 (29%), Positives = 160/346 (46%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 62  EDRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYKVHVASENNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVD---SDLSEVARRGSGSACRSLYGGFVEWQMGERPDG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V   + WP+LR+ +L +    K +GS   M+ +   S       +  +   +A
Sbjct: 179 KDSVACQVAPESHWPELRVLILVVSAERKPMGSTAGMQTSVETSALLKFRAEALVPPRMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +++F   G++  K++ + HAT +   PP+ Y    + + ++ V          
Sbjct: 239 EMTRCIRERNFQAFGQLTMKDSNQFHATCLDTFPPISYLSDTSRRIIQLVHRFNAHHGQT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P +S      K
Sbjct: 299 KVAYTFDAGPNAVVFTLD---DTVAEFVAAVRHSFPPESNGDKFLK 341


>gi|207341552|gb|EDZ69577.1| YNR043Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 396

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 105/343 (30%), Positives = 171/343 (49%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   +    + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAAIAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  +  +      +++AI++
Sbjct: 184 ADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 341


>gi|256273360|gb|EEU08298.1| Mvd1p [Saccharomyces cerevisiae JAY291]
          Length = 396

 Score =  345 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 107/343 (31%), Positives = 172/343 (50%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  + I       +++AI++
Sbjct: 184 ADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHIVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 341


>gi|297827457|ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327450|gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 412

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 107/352 (30%), Positives = 173/352 (49%), Gaps = 26/352 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T ++V  S D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVSVSPSFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRSRADDLEDKEKGIKIEKKDWQKLHLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL ++ ++ E    LS +AR GSGSACRS + GF +W  G  ++G DS AV
Sbjct: 130 AAGFACLVFALAKLMNVNEDPSQLSAIARQGSGSACRSLFGGFVKWNMGNKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  REK+  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLVDDKHWDDLVIIIAVVSSREKETSSTSGMRESVETSLLLQHRAKEVVPVRILQMEEAI 249

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+    +  I +T 
Sbjct: 250 KNRDFTSFTKLTCSDSNQFHAVCMDTSPPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTF 309

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELG 352
           DAGPN  L+   +  +   +    +    P   PD       L   + ++  
Sbjct: 310 DAGPNAVLI--ARNRKVAVELMQGLLYCFP-PKPDTDMKSYVLGDTSIVKEA 358


>gi|332265764|ref|XP_003281885.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate
           decarboxylase-like [Nomascus leucogenys]
          Length = 370

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 103/341 (30%), Positives = 155/341 (45%), Gaps = 27/341 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTK 119
            D I LNG++        +   +                           + + NN PT 
Sbjct: 62  EDRIWLNGREEDMGQPRLQACLREIRCLARKRRNSWDGDPLPSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMARCIQERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAMSWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
            + +T DAGPN  +       +T+ +F   +    P  S +
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTVAEFVAAVRHSFPPGSNE 336


>gi|109129490|ref|XP_001089404.1| PREDICTED: diphosphomevalonate decarboxylase [Macaca mulatta]
          Length = 401

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 103/355 (29%), Positives = 159/355 (44%), Gaps = 28/355 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + +     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEQPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRNAWDGDPLSSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQTDG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP      +  +   +A
Sbjct: 179 KDSVARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAEAVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMTRCIRERDFPGFAQLTMKDSNQFHATCLDTFPPISYLNAVSWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNS 348
            + +T DAGPN  +       +T+ +F   +    P  S  D +     +     
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTVAEFVAAVRHSFPPGSNGDAFLKGLQVRPAPL 350


>gi|307275320|ref|ZP_07556463.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2134]
 gi|306507954|gb|EFM77081.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2134]
          Length = 341

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 126/334 (37%), Positives = 179/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             ILNG   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILNGILQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|50285813|ref|XP_445335.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524639|emb|CAG58241.1| unnamed protein product [Candida glabrata]
          Length = 396

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 109/342 (31%), Positives = 174/342 (50%), Gaps = 26/342 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
           +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  +   D + LNG
Sbjct: 5   ASTTAPVNIATLKYWGKRDAKLNLPTNSSISVTLAQEDLRTLTSAATSSEFKEDKLWLNG 64

Query: 81  QKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSASGF 129
           ++ S  S   +         R             S+    I + NN PT AGLASSA+GF
Sbjct: 65  KEESLSSERTQNCLADLRALRRQLEEKDSSLPPMSQWKLHIVSENNFPTAAGLASSAAGF 124

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           AAL +A+ ++Y +P+ +  +S++AR GSGSACRS + G+  W  G   +G DS AV    
Sbjct: 125 AALVMAIAKLYELPQSASDISKIARKGSGSACRSLFGGYVAWEMGEKADGSDSKAVEVAP 184

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQD 246
              WP+++  +L +   +K   S   M++T + S  F +     +      +K+AI+D+D
Sbjct: 185 LEHWPNMKAAVLVVSADKKDTPSTSGMQLTVNTSDLFKERITNVVPKRFEAMKKAILDKD 244

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM---ERVWDARQQSIPIYFTLDAG 303
           F    E+  K++   HAT + + PP+ Y    + + +     + +   ++I + +T DAG
Sbjct: 245 FPTFAELTMKDSNSFHATCLDSFPPIFYINDTSKKIIKLCHLINEFYGETI-VAYTYDAG 303

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           PN  L +  + EE +  F   +         D W +K +  +
Sbjct: 304 PNSVLYYLEENEEKLFAFIYTL-----FSKVDGWQSKYNSEE 340


>gi|6324371|ref|NP_014441.1| Mvd1p [Saccharomyces cerevisiae S288c]
 gi|1706682|sp|P32377|MVD1_YEAST RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Ergosterol biosynthesis protein 19; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase; Short=MDD;
           Short=MDDase
 gi|1235684|gb|AAC49252.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae]
 gi|1292890|emb|CAA66158.1| diphosphomevalonate decarboxylase [Saccharomyces cerevisiae]
 gi|1302550|emb|CAA96324.1| MVD1 [Saccharomyces cerevisiae]
 gi|285814690|tpg|DAA10584.1| TPA: Mvd1p [Saccharomyces cerevisiae S288c]
          Length = 396

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 106/343 (30%), Positives = 172/343 (50%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  +  +      +++AI++
Sbjct: 184 ADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 341


>gi|332846640|ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase isoform 4 [Pan
           troglodytes]
          Length = 400

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 104/355 (29%), Positives = 157/355 (44%), Gaps = 28/355 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTK 119
            D I LNG++        +   +                           + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNS 348
            + +T DAGPN  +       +T+ +F   +    P  S  D +     +     
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTVAEFVAAVRHGFPPGSNGDTFLKGLQVRPAPL 350


>gi|151944571|gb|EDN62849.1| mevalonate pyrophosphate decarboxylase [Saccharomyces cerevisiae
           YJM789]
          Length = 396

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 106/343 (30%), Positives = 172/343 (50%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  +  +      +++AI++
Sbjct: 184 ADSSNWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTAEQ 341


>gi|294781313|ref|ZP_06746659.1| diphosphomevalonate decarboxylase [Enterococcus faecalis PC1.1]
 gi|307267978|ref|ZP_07549366.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4248]
 gi|307278402|ref|ZP_07559477.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0860]
 gi|294451649|gb|EFG20105.1| diphosphomevalonate decarboxylase [Enterococcus faecalis PC1.1]
 gi|306504908|gb|EFM74103.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0860]
 gi|306515619|gb|EFM84146.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4248]
 gi|315032468|gb|EFT44400.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0017]
 gi|315034298|gb|EFT46230.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0027]
 gi|329577895|gb|EGG59316.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1467]
          Length = 341

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 179/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGTLQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|240280082|gb|EER43586.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus H143]
 gi|325088803|gb|EGC42113.1| diphosphomevalonate decarboxylase [Ajellomyces capsulatus H88]
          Length = 406

 Score =  344 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 111/341 (32%), Positives = 163/341 (47%), Gaps = 27/341 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADC 75
            ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +          D 
Sbjct: 8   YRASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPTYPTDAGDS 67

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LN Q  + + S              ++         + S     I + NN PT AGLA
Sbjct: 68  LTLNSQPQNIKDSKRTLACLSDLRSLRRELENANSSLPKLSGFPLRIVSENNFPTAAGLA 127

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSF
Sbjct: 128 SSAAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRMGVLEDGSDSF 187

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
           A  V   + WP++R  +L + D +K + S + M+ T   S  F    +  +   +A I+ 
Sbjct: 188 AEEVAPASHWPEMRALILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIES 247

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI ++DF    E+  K++   HAT +   PP  Y    +   +  V D  +    I   +
Sbjct: 248 AIKNRDFASFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGEIICAY 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           T DAGPN  + +  K  E +   F  I   +     + W  
Sbjct: 308 TFDAGPNAVIYYLGKDSEHVIGTFKSILKAE----TEGWDG 344


>gi|320593831|gb|EFX06234.1| diphosphomevalonate decarboxylase [Grosmannia clavigera kw1407]
          Length = 927

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 113/365 (30%), Positives = 178/365 (48%), Gaps = 36/365 (9%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHIT----VIDSDADC 75
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +        D D 
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQSDLRTLTTASTSSLFAGQDGDT 66

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLAS 124
           ++LNG++     +  +   +     R           + S     + + NN PT AGLAS
Sbjct: 67  LLLNGEQSDVSGARTQACFRALRSRRAALEAADPSLPKLSTYPLRVVSENNFPTAAGLAS 126

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           SA+GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G   +G DS A
Sbjct: 127 SAAGFAALVRAIADLYELPDTPSQLSLIARQGSGSACRSVFGGYVAWRMGEAVDGSDSLA 186

Query: 185 --VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQA 241
             V   + WPD+R  +L +   +K + S   M+ T   S  F Q   + +S  +A ++QA
Sbjct: 187 EQVAPASAWPDMRALILVVSAAKKGVSSSSGMQQTVATSGLFKQRVAEVVSGHMAKMEQA 246

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFT 299
           I D+DF    EV  +++   HAT     PP+ Y    +   +  V   +A+   +   +T
Sbjct: 247 IADRDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAVRAVEAINAKAGRVVAAYT 306

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK---------NSIE 350
            DAGPN  + +  +  + +   F  I       + D W      + +         ++++
Sbjct: 307 FDAGPNAVVYYLEQDADVVLATFAGIL-----GAVDGWKNGLPSTAQATELDATVASTLK 361

Query: 351 LGISK 355
            G+S+
Sbjct: 362 TGVSR 366


>gi|327388366|gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
          Length = 421

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 100/336 (29%), Positives = 164/336 (48%), Gaps = 25/336 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD  L LP+N+S+S++L   HL T T + V  S  +D + LNG
Sbjct: 13  VTAKSPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPSFRSDRMWLNG 72

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                      +  ++  I + NN PT AGLASS
Sbjct: 73  KEISLAGGRYQNCLREIRSRASCFEDEKKGISIRKEDWENLHLHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  AL  +  + E   ++S +AR GSGSACRS Y GF +W  G D +G DS A+
Sbjct: 133 AAGFACLVFALGNLMCVKEDLGAISAIARQGSGSACRSLYGGFVKWNTGYDVSGRDSIAM 192

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
                + W DL I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 193 QLASESHWDDLVIIIAVVSSRQKETSSTAGMRESVETSTLLQYRFKEVVPKRILQMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF     +   ++ + HA  +   PP+ Y    + + +  +  W+  + +  + +T 
Sbjct: 253 RNKDFTTFARLTCADSNQFHAVCLDTCPPIFYMNDTSHRIINYMEKWNQLEGTPQVAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           DAGPN  L+   +  +T +     +    P    +L
Sbjct: 313 DAGPNAVLI--ARNRKTAEALLQRLLFYFPPPGAEL 346


>gi|327287778|ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase-like [Anolis
           carolinensis]
          Length = 406

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 102/347 (29%), Positives = 161/347 (46%), Gaps = 32/347 (9%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCI 76
                +   P NIA+ KYWGKRD KL LP+N+SLS++L    L T T   +  D   D +
Sbjct: 6   PLSMVTCTAPINIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTEDRL 65

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSK------------------VYFLIETSNNIPT 118
            LNG++        +   +      +  +                      I + NN PT
Sbjct: 66  WLNGKESDIGHPRLQSCLREIRRLARKRRSGDTKGPEGGEPSPLSLTYKVHIASENNFPT 125

Query: 119 KAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
            AGLASSA+G+A L   L ++Y +      LS VAR+GSGSACRS + GF +W+ G D +
Sbjct: 126 AAGLASSAAGYACLVYTLAKLYGVE---GDLSEVARMGSGSACRSMFGGFVQWVKGEDAD 182

Query: 179 GMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-L 235
           G +S A        WP++R+ +L +   +K IGS   M+ +   S       +++  + +
Sbjct: 183 GKESIAEQVAPETHWPEMRVLILVVSAEKKPIGSTAGMQTSVETSHLLKHRAEKLVPEYM 242

Query: 236 AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QS 293
           A + + I  +DF   GE+  K++ ++HAT +   PP+ Y    + Q +  V         
Sbjct: 243 AQMTRHIRRRDFEAFGELTMKDSNQLHATCLDTFPPIFYLNDISKQVVRLVHRFNDHYGK 302

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
             + +T DAGPN  +       ET+ +F   +    P ++      K
Sbjct: 303 TKVAYTFDAGPNAVVFMME---ETVAEFVEVVKRSFPPENNGGQFLK 346


>gi|30584105|gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic
           construct]
 gi|61372632|gb|AAX43880.1| mevalonate (diphospho) decarboxylase [synthetic construct]
          Length = 401

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 104/355 (29%), Positives = 157/355 (44%), Gaps = 28/355 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTK 119
            D I LNG++        +   +                           + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNS 348
            + +T DAGPN  +       +T+ +F   +    P  S  D +     +     
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL 350


>gi|4505289|ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 gi|1706681|sp|P53602|ERG19_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|218681762|pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate
           Decarboxylase
 gi|218681763|pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate
           Decarboxylase
 gi|1235682|gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gi|12652543|gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gi|30582699|gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gi|60655429|gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|119587196|gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gi|123994097|gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|124126813|gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gi|261858458|dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
          Length = 400

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 104/355 (29%), Positives = 157/355 (44%), Gaps = 28/355 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTK 119
            D I LNG++        +   +                           + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDSLSQKNS 348
            + +T DAGPN  +       +T+ +F   +    P  S  D +     +     
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL 350


>gi|310800466|gb|EFQ35359.1| diphosphomevalonate decarboxylase [Glomerella graminicola M1.001]
          Length = 391

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 111/363 (30%), Positives = 172/363 (47%), Gaps = 24/363 (6%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--D 72
             K   ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  +   S  +
Sbjct: 2   ADKKVYRASTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLSQADLRTLTTASCSASYSE 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAG 121
            D +ILNG+      +  +   +     R           + S +   I T NN PT AG
Sbjct: 62  GDSLILNGEASDISGARTQACFRELRTRRAALEEKDSSLPKLSAMPLKIVTENNFPTAAG 121

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSA+GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G   NG D
Sbjct: 122 LASSAAGFAALVRAIADLYELPDSPSELSLIARQGSGSACRSLFGGYVAWRMGDKANGTD 181

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHI 238
           S A  V   + WP++R  +L +   +K + S   M+ T   S  F Q   + +   +A +
Sbjct: 182 SKADLVAEASHWPNMRALILVVSAAKKGVSSTSGMQQTVATSGLFKQRVAEVVPKHMAEM 241

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPI 296
           + AI  +DF +  EV  K++   H++     PP+ Y    +   +  V            
Sbjct: 242 EDAIARRDFAQFAEVTMKDSNSFHSSCSDTYPPIFYMNDVSRAAIRAVEQINAAAGKTVA 301

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPL--DSPDLWSTKDSLSQ--KNSIELG 352
            +T DAGPN  + +  +   T+   F  +        +  +   +  +L +     ++ G
Sbjct: 302 AYTFDAGPNAVIYYLEEDAATVVGAFSPVLASVSGWKEGVESLKSSVALDETVAGILKSG 361

Query: 353 ISK 355
           +S+
Sbjct: 362 VSR 364


>gi|149701783|ref|XP_001488083.1| PREDICTED: similar to Diphosphomevalonate decarboxylase (Mevalonate
           pyrophosphate decarboxylase) (Mevalonate
           (diphospho)decarboxylase) [Equus caballus]
          Length = 400

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 103/346 (29%), Positives = 159/346 (45%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDLLPLSLSYKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGQRADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLA 236
            DS A  V     WP+LR+ +L +   +K  GS   M+ +   SP      +  +   +A
Sbjct: 179 KDSVARQVAPELHWPELRVLILVVSAEKKLTGSTVGMQTSVETSPLLRFRAEALVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + ++++DF   G++  K++ + HAT +   PP+ Y    +   +  V          
Sbjct: 239 EMARCVMERDFQAFGQLTMKDSNQFHATCLDTFPPISYLNDTSRCIIHLVHRFNAHHGQT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P +S      K
Sbjct: 299 KVAYTFDAGPNAVIFTLD---DTMAEFVAAVRHSFPPESNGDKFLK 341


>gi|55925435|ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 gi|82179976|sp|Q5U403|ERG19_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|55154472|gb|AAH85325.1| Zgc:100824 [Danio rerio]
          Length = 400

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 112/363 (30%), Positives = 166/363 (45%), Gaps = 31/363 (8%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID 70
           + E   +  E  +   P NIA+ KYWGKRD  L LP+N SLS++L   HL T T I    
Sbjct: 1   MSENILQDLEMVTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSR 60

Query: 71  S-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK----------VYFLIETSNNIPTK 119
           S   DCI LNG++        +          Q  K              I + NN PT 
Sbjct: 61  SFHKDCIWLNGKEQDISHPRLQSCLLEIRRLAQRRKNTGDPASDVSNKVHICSVNNFPTA 120

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L +++++      LS VAR GSGSACRS Y GF +W  G   +G
Sbjct: 121 AGLASSAAGYACLVYTLSQLFNVE---GELSGVARQGSGSACRSLYGGFVQWKLGEQSDG 177

Query: 180 MDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A    ++  WP+LR+ +L +   +K +GS   M  +   S          +   + 
Sbjct: 178 KDSIAEQVASELYWPELRVLILVVSAEQKSVGSTSGMHTSVETSHLLKYRADAVVPGRME 237

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSI 294
            + +AI  +DF K GE+  K++ + HA  +   PP+ Y    + Q +  V    Q     
Sbjct: 238 EMIRAIRLRDFPKFGELTMKDSNQFHAICLDTYPPIFYLNNISHQIISLVHRYNQYYGET 297

Query: 295 PIYFTLDAGPNLKLL----FTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
            + +T DAGPN  +     +  +  E ++ FFP      P  + + +     +   +  E
Sbjct: 298 RVAYTFDAGPNAVIYSLQDYLPEFVEVVRHFFP------PEVNEEEFFKGLPVCPADLSE 351

Query: 351 LGI 353
             I
Sbjct: 352 EMI 354


>gi|227517822|ref|ZP_03947871.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX0104]
 gi|229546747|ref|ZP_04435472.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX1322]
 gi|229548839|ref|ZP_04437564.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           ATCC 29200]
 gi|293383781|ref|ZP_06629688.1| diphosphomevalonate decarboxylase [Enterococcus faecalis R712]
 gi|293388743|ref|ZP_06633236.1| diphosphomevalonate decarboxylase [Enterococcus faecalis S613]
 gi|300859603|ref|ZP_07105691.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TUSoD
           Ef11]
 gi|307286710|ref|ZP_07566796.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0109]
 gi|307290919|ref|ZP_07570809.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0411]
 gi|312901555|ref|ZP_07760828.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0470]
 gi|312907003|ref|ZP_07765999.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 512]
 gi|312952830|ref|ZP_07771692.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0102]
 gi|312978739|ref|ZP_07790466.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 516]
 gi|227074712|gb|EEI12675.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX0104]
 gi|229306068|gb|EEN72064.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           ATCC 29200]
 gi|229308096|gb|EEN74083.1| possible diphosphomevalonate decarboxylase [Enterococcus faecalis
           TX1322]
 gi|291078857|gb|EFE16221.1| diphosphomevalonate decarboxylase [Enterococcus faecalis R712]
 gi|291081900|gb|EFE18863.1| diphosphomevalonate decarboxylase [Enterococcus faecalis S613]
 gi|295113905|emb|CBL32542.1| diphosphomevalonate decarboxylase [Enterococcus sp. 7L76]
 gi|300850421|gb|EFK78170.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TUSoD
           Ef11]
 gi|306497989|gb|EFM67516.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0411]
 gi|306502188|gb|EFM71472.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0109]
 gi|310626988|gb|EFQ10271.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 512]
 gi|310629346|gb|EFQ12629.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0102]
 gi|311288446|gb|EFQ67002.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DAPTO 516]
 gi|311291350|gb|EFQ69906.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0470]
 gi|315027088|gb|EFT39020.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2137]
 gi|315029772|gb|EFT41704.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4000]
 gi|315145810|gb|EFT89826.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX2141]
 gi|315148060|gb|EFT92076.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX4244]
 gi|315149662|gb|EFT93678.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0012]
 gi|315152975|gb|EFT96991.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0031]
 gi|315155206|gb|EFT99222.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0043]
 gi|315157534|gb|EFU01551.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0312]
 gi|315163038|gb|EFU07055.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0645]
 gi|315165237|gb|EFU09254.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1302]
 gi|315174854|gb|EFU18871.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1346]
 gi|327534483|gb|AEA93317.1| diphosphomevalonate decarboxylase [Enterococcus faecalis OG1RF]
          Length = 341

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 179/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGILQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|312904462|ref|ZP_07763621.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0635]
 gi|310632160|gb|EFQ15443.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0635]
 gi|315577315|gb|EFU89506.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0630]
          Length = 341

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 179/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGILQNEKQT--KKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|302795167|ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gi|300153115|gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
          Length = 403

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 108/355 (30%), Positives = 165/355 (46%), Gaps = 27/355 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD  L LPLN+S+S++L    L   T ++     DAD + LN +
Sbjct: 13  TARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDK 72

Query: 82  KISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S  S  +    +                      +  +   I + NN PT AGLASSA
Sbjct: 73  EVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L   + ++  I E     LS +AR GSGSACRS + GF +W  G   +G DS AV
Sbjct: 133 AGFACLVFTVAQLMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMGKRDDGKDSIAV 192

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
           P      W DLRI +  +  R+K++ S   M+ +   SP       + +   +  +++A+
Sbjct: 193 PLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKRITEMEEAL 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             +DF    ++   ++ + HAT +  SPP+ Y    + + +  V  W+  + S    +T 
Sbjct: 253 SKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPN  +    K    +           P       S+    S +    LGI K
Sbjct: 313 DAGPNAVIFVPQKSGGALLHRL---LYEFPPPEGMNLSSYVVGSTELLEALGIDK 364


>gi|195355405|ref|XP_002044182.1| GM22575 [Drosophila sechellia]
 gi|194129471|gb|EDW51514.1| GM22575 [Drosophila sechellia]
          Length = 354

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 104/331 (31%), Positives = 160/331 (48%), Gaps = 20/331 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIIL 78
              +   P NIAL KYWGKR  +L LP+N+S+S++L    L   T +T  +S + + + L
Sbjct: 2   FSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFERNRMWL 61

Query: 79  NGQKISSQS-SFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAGLASSASGFA 130
           NG+++  +  S  ++  +        +            I + NN PT AGLASSA+G+A
Sbjct: 62  NGEEVPFEEGSRLQRCLKEVHRLAVANGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYA 121

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFN 188
            L  +L R+Y IP   E L+ VAR GSGSACRS Y GF +W  G   +G DS A  +  +
Sbjct: 122 CLVYSLSRLYDIPLS-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPS 180

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDF 247
           + WP++ + +L + D  KK  S   M+     S       +Q +   +  +++AI   DF
Sbjct: 181 DHWPNMHVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVEQVVPDRITRLREAIASHDF 240

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA--RQQSIPIYFTLDAGPN 305
               E+  K++ + HA  +   PP +Y    + + +  V D   R  S    +T DAGPN
Sbjct: 241 QAFAEITMKDSNQFHAVALDTYPPCVYMNDVSHRIVSFVHDYNDRMGSYHAAYTFDAGPN 300

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
             L    +    +      I  + P D  D 
Sbjct: 301 ACLYVLAEH---VPHLLSAIQKVFPNDLADG 328


>gi|51013755|gb|AAT93171.1| YNR043W [Saccharomyces cerevisiae]
          Length = 396

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 106/343 (30%), Positives = 172/343 (50%), Gaps = 24/343 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
             +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T  + + D + L
Sbjct: 4   YTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATAPEFERDTLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG+  S  +   +   +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  ++G DS AV  
Sbjct: 124 GFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSSFGGYVAWEMGKAEDGHDSMAVQI 183

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
            +   WP ++  +L + D +K + S + M++T   S  F +  +  +      +++AI++
Sbjct: 184 ADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKRFEVMRKAIVE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF    +    ++   HAT + + PP+ Y    + + +       Q      + +T DA
Sbjct: 244 KDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           GPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 304 GPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 341


>gi|327294609|ref|XP_003232000.1| diphosphomevalonate decarboxylase [Trichophyton rubrum CBS 118892]
 gi|326465945|gb|EGD91398.1| diphosphomevalonate decarboxylase [Trichophyton rubrum CBS 118892]
          Length = 402

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 174/365 (47%), Gaps = 28/365 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   N +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAAANDQRVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSS 60

Query: 71  S----DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSN 114
                D D + LN +  S Q S              ++         + S     I + N
Sbjct: 61  KYPTADGDSLTLNNKPHSIQGSPRTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI- 231
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-R 290
              +  I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R
Sbjct: 241 PERMTAIEKSIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINR 300

Query: 291 QQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
                +  +T DAGPN  + +  K  + +   F  I       + + W + D     N +
Sbjct: 301 AAGRSVCAYTFDAGPNAVIYYLEKDADCVLGTFKSIL----TSATEGWESADIK-NTNLL 355

Query: 350 ELGIS 354
           E  I 
Sbjct: 356 EQSID 360


>gi|307271902|ref|ZP_07553170.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0855]
 gi|306511408|gb|EFM80410.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0855]
 gi|315172005|gb|EFU16022.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1342]
          Length = 341

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 125/334 (37%), Positives = 179/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGILQNEKQT--KKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVKKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|258612252|ref|ZP_05711813.1| diphosphomevalonate decarboxylase [Listeria monocytogenes F6900]
 gi|293596646|ref|ZP_06684296.1| diphosphomevalonate decarboxylase [Listeria monocytogenes J2818]
 gi|258610105|gb|EEW22713.1| diphosphomevalonate decarboxylase [Listeria monocytogenes F6900]
 gi|293591124|gb|EFF99458.1| diphosphomevalonate decarboxylase [Listeria monocytogenes J2818]
          Length = 339

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 127/331 (38%), Positives = 186/331 (56%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  
Sbjct: 13  EKVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEQKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++    
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERA 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  + +    +   ++      +     D 
Sbjct: 308 NENIVAEKLSGLAKNVLICHAGKEASVVSDE 338


>gi|194894289|ref|XP_001978042.1| GG17907 [Drosophila erecta]
 gi|190649691|gb|EDV46969.1| GG17907 [Drosophila erecta]
          Length = 388

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 105/330 (31%), Positives = 156/330 (47%), Gaps = 20/330 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIILN 79
             +   P NIAL KYWGKR   L LP+N+S+S++L    L   T +T  +  + + + LN
Sbjct: 3   SVTCVAPVNIALIKYWGKRHEDLILPVNDSISMTLSTDELCAKTTVTASETFERNRMWLN 62

Query: 80  GQKISSQS-SFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAGLASSASGFAA 131
           G+++  +  S  ++  +                     I + NN PT AGLASSA+G+A 
Sbjct: 63  GEEVPFEEGSRLQRCLKEVHRLAVAKGSQKVPPSWKLHIASVNNFPTAAGLASSAAGYAC 122

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNN 189
           L  +L R+Y IP   E L+ VAR GSGSACRS Y GF +W  G   NG DS A  +  ++
Sbjct: 123 LVYSLSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDNGSDSVAKQIAPSD 181

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFI 248
            WPD+ + +L + D  KK  S   M+ +   S        Q +   +  ++QAI   DF 
Sbjct: 182 HWPDMHVLILVVNDARKKTASTRGMQQSVKTSQLIKHRVDQVVPDRITKLRQAIRSHDFQ 241

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA--RQQSIPIYFTLDAGPNL 306
              E+  K++ + HA  +   PP +Y    +   +  V D   R  S    +T DAGPN 
Sbjct: 242 TFAEITMKDSNQFHAVALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPNA 301

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
            L    +    +      +  + P D  D 
Sbjct: 302 CLYVLAEN---VPHLLSAVQKVFPNDLTDG 328


>gi|9937387|gb|AAG02441.1|AF290093_2 mevalonate diphosphate decarboxylase [Enterococcus faecalis]
          Length = 331

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 125/327 (38%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  ILNG 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILNGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|169848281|ref|XP_001830848.1| diphosphomevalonate decarboxylase [Coprinopsis cinerea
           okayama7#130]
 gi|116508017|gb|EAU90912.1| diphosphomevalonate decarboxylase [Coprinopsis cinerea
           okayama7#130]
          Length = 415

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 96/331 (29%), Positives = 149/331 (45%), Gaps = 28/331 (8%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGT---ITHITVIDSDADCI 76
              +++A  P NIA+ KYWGKRD+ L LP N+SLS++L         T       D D +
Sbjct: 4   PIYEATASAPVNIAVIKYWGKRDTSLILPTNSSLSVTLSQDHLRSTTTSRASSSFDKDRL 63

Query: 77  ILNGQKISSQS-SFFKKTTQFCDLFR------------QFSKVYFLIETSNNIPTKAGLA 123
            LNGQ+   +  S  +   +     R            + S +   I + NN PT AGLA
Sbjct: 64  WLNGQEDVIKPGSRLETCIREMKKLRKELVEDKDANAPKLSTLPVHIASYNNFPTAAGLA 123

Query: 124 SSASGFAALTLALFRIYSIP---EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           SSASGFAAL  +L  +Y++        +LS +AR GSGSACRS + GF  W  G+   G 
Sbjct: 124 SSASGFAALVSSLAHLYTLTPPLTSPSTLSLIARQGSGSACRSLFGGFVAWEMGSTPTGT 183

Query: 181 DSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAH 237
           DS AV   +   WP++   +  + D +K   S   M+ T   S       +  +   +  
Sbjct: 184 DSLAVQIADEAHWPEMHALICVVSDDKKGTSSTAGMQRTVETSTLLQHRIKDVVPRRMDE 243

Query: 238 IKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------ 291
           + +AI ++DF     +   ++   HA  +   PP+ Y    +   +  + +  +      
Sbjct: 244 MIRAIKEKDFDSFARITMADSNSFHAVALDTEPPIFYMNDVSRAIIALIVELNRVSLEKG 303

Query: 292 QSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +     +T DAGPN  +    K  + + Q  
Sbjct: 304 EGYKAAYTYDAGPNAVIYTLDKNVKEVIQLI 334


>gi|66816267|ref|XP_642143.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
 gi|74856777|sp|Q54YQ9|ERG19_DICDI RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate (diphospho)decarboxylase; Short=MDDase;
           AltName: Full=Mevalonate pyrophosphate decarboxylase
 gi|60470496|gb|EAL68476.1| diphosphomevalonate decarboxylase [Dictyostelium discoideum AX4]
          Length = 391

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 100/315 (31%), Positives = 150/315 (47%), Gaps = 14/315 (4%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADC 75
            +    +   P NIA+ KYWGKRD  + LPLN+SLS +L    L T T I   +    D 
Sbjct: 1   MVLASVTCTAPVNIAVIKYWGKRDENIILPLNSSLSGTLHQDDLKTTTTIVASEDYTEDE 60

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAAL 132
           + LNG+K    +  ++   +            K    I + NN PT AGLASSASG+  L
Sbjct: 61  LYLNGKKEDINAVRYQNVLKMIRSRATKLMDKKHCVHIASINNFPTAAGLASSASGYCCL 120

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQ 190
              L ++Y +      +S +ARLGSGSACRS Y GF +W  GT  +G DS AV     + 
Sbjct: 121 VFTLAQMYGVD---GDISGIARLGSGSACRSMYGGFVKWEMGTKDDGSDSIAVQVQPESH 177

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WPD+ I +L + D++K+  S + M+ +   S    +         +  I++AI  +DF  
Sbjct: 178 WPDMNIIVLVVNDKKKETSSTDGMQKSAATSVMMKERCAVTVPNRMRDIEEAINKKDFQT 237

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLK 307
            G++  K++   H      +PP+ Y    +   M  +    +   SI   +T DAGPN  
Sbjct: 238 FGDITMKDSDDFHEVCATTTPPIYYLNDTSRYIMNLIHRYNKLSGSIKCAYTFDAGPNAC 297

Query: 308 LLFTHKIEETIKQFF 322
           +    +    +   F
Sbjct: 298 IYLPAESTTEVLSLF 312


>gi|302500200|ref|XP_003012094.1| hypothetical protein ARB_01602 [Arthroderma benhamiae CBS 112371]
 gi|291175650|gb|EFE31454.1| hypothetical protein ARB_01602 [Arthroderma benhamiae CBS 112371]
          Length = 402

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 174/365 (47%), Gaps = 28/365 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   N +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAAANDQRVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSS 60

Query: 71  S----DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSN 114
                D D + LN +  S Q S              ++         + S     I + N
Sbjct: 61  KYPTADGDSLTLNNKPHSIQGSPRTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI- 231
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-R 290
              +  I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R
Sbjct: 241 PERMTAIEKSIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINR 300

Query: 291 QQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
                +  +T DAGPN  + +  K  + +   F  I       + + W + D     N +
Sbjct: 301 AAGRSVCAYTFDAGPNAVIYYLEKDADCVLGTFKSIL----TSATEGWESADIK-NTNLL 355

Query: 350 ELGIS 354
           E  I 
Sbjct: 356 EQSID 360


>gi|302661342|ref|XP_003022340.1| hypothetical protein TRV_03551 [Trichophyton verrucosum HKI 0517]
 gi|291186280|gb|EFE41722.1| hypothetical protein TRV_03551 [Trichophyton verrucosum HKI 0517]
          Length = 402

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 174/365 (47%), Gaps = 28/365 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   N +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAATNDQRVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSS 60

Query: 71  S----DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSN 114
                D D + LN +  S Q S              ++         + S     I + N
Sbjct: 61  KYPTADGDSLTLNNKPHSIQGSPRTLACLADLRSLRQQIESSDPSLPKLSTYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI- 231
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-R 290
              +  I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R
Sbjct: 241 PERMTAIEKSIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINR 300

Query: 291 QQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
                +  +T DAGPN  + +  K  + +   F  I       + + W + D     N +
Sbjct: 301 AAGRSVCAYTFDAGPNAVIYYLEKDADCVLGTFKSIL----TSATEGWESADIK-NTNLL 355

Query: 350 ELGIS 354
           E  I 
Sbjct: 356 EKSID 360


>gi|71022191|ref|XP_761326.1| hypothetical protein UM05179.1 [Ustilago maydis 521]
 gi|46097820|gb|EAK83053.1| hypothetical protein UM05179.1 [Ustilago maydis 521]
          Length = 427

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 107/342 (31%), Positives = 161/342 (47%), Gaps = 31/342 (9%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS--DADCII 77
            +++   P NIA+ KYWGK+D+ L LP N+SLS++L   HL ++T      S    D + 
Sbjct: 6   YQATCSAPVNIAVIKYWGKKDTTLILPTNDSLSVTLDQDHLRSVTTARADASFGSQDRLW 65

Query: 78  LNGQKISSQSS-FFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASS 125
           LNG++ + ++    ++        RQ            S+    + + NN PT AGLASS
Sbjct: 66  LNGEEEAIKADGRLRRCIDEMRKLRQAKESKDSNLAKLSEWAVHVCSENNFPTAAGLASS 125

Query: 126 ASGFAALTLALFRIY--SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           ASGFAAL  +L  +Y       S  LSR+AR GSGSACRS + G+  W  G   +G DS 
Sbjct: 126 ASGFAALIASLAALYELQPEVSSSELSRIARQGSGSACRSLFGGYVAWQGGEHPSGQDSL 185

Query: 184 AVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQ 240
           AV       WPDL+  +  + D +K   S   M+ T   SP       + +   +  I +
Sbjct: 186 AVQVAPQSHWPDLQALICVVSDAKKGTPSTAGMQRTVQTSPLLQHRIKEVVPQRMIKISE 245

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------QSI 294
           AI  QDF    E+   ++   HA  +  +PP+ Y    +   ++ V +  +      +  
Sbjct: 246 AIQKQDFNTFAEITMADSNNFHACCLDTAPPIFYMNDVSRAIVQLVEELNRANEADGKGK 305

Query: 295 PIYFTLDAGPNLKLLFTHKI----EETIKQFFPEITIIDPLD 332
            + +T DAGPN  L           +TI+ +FP     D  D
Sbjct: 306 LVAYTYDAGPNAVLYAPKDNMPRILQTIRHYFPNADFDDTFD 347


>gi|296231782|ref|XP_002761300.1| PREDICTED: diphosphomevalonate decarboxylase [Callithrix jacchus]
          Length = 400

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 103/339 (30%), Positives = 156/339 (46%), Gaps = 27/339 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAVVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAAISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFC-------------DLFRQFSKVYFLIETSNNIPTK 119
            D + LNG++        +   Q               DL          + + NN PT 
Sbjct: 62  EDRVWLNGREEDVGQPRLQACLQEIRRLARKRRNTWDGDLPPSSLNCKVHVASENNFPTA 121

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L  +Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 122 AGLASSAAGYACLAYTLACVYGVE---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 178

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
            DS A  V   + WP+LR+ +L +   +K +GS   M+ +   SP      +  +   +A
Sbjct: 179 KDSIARQVAPESHWPELRVLILVVSAEKKLMGSTVGMQASVKTSPLLRFRAESVVPARMA 238

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I ++DF    ++  +++ + HAT +   PP+ Y    + + +  V          
Sbjct: 239 EMTRCIQERDFRGFAQLTMQDSNQFHATCLDTFPPISYLSHISWRIIHLVHRFNAHHGDT 298

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
            + +T DAGPN  +       +T+  F   +    P  S
Sbjct: 299 KVAYTFDAGPNAVIFTLE---DTMADFVAAVRHTFPPGS 334


>gi|301625700|ref|XP_002942038.1| PREDICTED: diphosphomevalonate decarboxylase [Xenopus (Silurana)
           tropicalis]
          Length = 394

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 99/333 (29%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIIL 78
           +K +   P NIA+ KYWGKR+ +L LP+N+SLS++L    L T T      +   D I L
Sbjct: 2   KKVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTKAGLASS 125
           NG++ +      +   +                   +       I + NN PT AGLASS
Sbjct: 62  NGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSRILNDKVHICSVNNFPTAAGLASS 121

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+G+A L   L ++Y +      LS +AR GSGSACRS Y GF +W+ G   +G DS A 
Sbjct: 122 AAGYACLVYTLAKLYGVE---GELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK 178

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
            V   + WP+LR+ +L     +K +GS   M+ +   SP         +   +  + ++I
Sbjct: 179 QVEPESHWPELRVLILVATAEKKHVGSTAGMQTSVETSPLLKLRADLVVPERMEAMIESI 238

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTL 300
             +DF   GE+  K++ + HAT +   PP+ Y    + + +  V           + ++ 
Sbjct: 239 RKKDFKAFGELTMKDSNQFHATCLDTYPPIFYLNSVSQRVISVVHQYNTYYGQTKVAYSF 298

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           DAGPN  +        T+ +F   +    P +S
Sbjct: 299 DAGPNAVIFMLE---PTVNEFVEVVKHCFPPES 328


>gi|291230240|ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus
           kowalevskii]
          Length = 405

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 98/319 (30%), Positives = 155/319 (48%), Gaps = 22/319 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIILN 79
             +   P NIA+ KYWGKRD +L LP N+SLS SL   HL + T  ++      D + LN
Sbjct: 14  SVTCTAPINIAVIKYWGKRDEQLILPTNSSLSASLDQDHLKSTTTASISKEFKRDRLWLN 73

Query: 80  GQKISSQSSFFK-----------KTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
           G++ S ++   +           K     D   +       I + NN PT AGLASSA+G
Sbjct: 74  GKEESIENPRIQNCLIEIRRRARKRKHNDDSKSEMLNWSVHICSENNFPTAAGLASSAAG 133

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VP 186
           +A L   L ++Y I         +AR GSGSACRS Y GF +W  G  +NG DS A  V 
Sbjct: 134 YACLVYTLSKLYDINGDVSD---IARRGSGSACRSIYGGFVQWTVGEKKNGSDSIAKVVA 190

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQ 245
             + WP++R+ +L + D++K   S   M  + + S F     +  + + +  + +AI ++
Sbjct: 191 DVDHWPEMRVLVLVVSDQKKHTSSTNGMRNSVNTSDFLRYRAEHVVPSRMEEMIKAIEEK 250

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
           D+ K  E+  K++ +MHA  +   PP+ Y    + + +  +    +    + + +T DAG
Sbjct: 251 DYQKFAELTIKDSNQMHAVCLDTYPPISYMNDTSRKIINMIHAFNKYQGELKVAYTYDAG 310

Query: 304 PNLKLLFTHKIEETIKQFF 322
           PN  L    +    +    
Sbjct: 311 PNAVLYLLDEHVPDVVSLI 329


>gi|255973972|ref|ZP_05424558.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T2]
 gi|256761657|ref|ZP_05502237.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T3]
 gi|256957240|ref|ZP_05561411.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DS5]
 gi|257077786|ref|ZP_05572147.1| diphosphomevalonate decarboxylase [Enterococcus faecalis JH1]
 gi|255966844|gb|EET97466.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T2]
 gi|256682908|gb|EEU22603.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T3]
 gi|256947736|gb|EEU64368.1| diphosphomevalonate decarboxylase [Enterococcus faecalis DS5]
 gi|256985816|gb|EEU73118.1| diphosphomevalonate decarboxylase [Enterococcus faecalis JH1]
          Length = 331

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGT 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|195478959|ref|XP_002100713.1| GE17215 [Drosophila yakuba]
 gi|194188237|gb|EDX01821.1| GE17215 [Drosophila yakuba]
          Length = 391

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 102/330 (30%), Positives = 154/330 (46%), Gaps = 20/330 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIILN 79
             +   P NIAL KYWGKR   L LP+N+S+S++L    L   T +T  +  + + + LN
Sbjct: 3   SVTCVAPVNIALIKYWGKRHEDLILPVNDSISMTLSTDELCAKTTVTASETFERNRMWLN 62

Query: 80  GQKISSQS-SFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAGLASSASGFAA 131
           G+++  +  S  ++  +                     I + NN PT AGLASSA+G+A 
Sbjct: 63  GEEVPFEEGSRLQRCLKEVHRLAVAKGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYAC 122

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-- 189
           L  +L R+Y IP   E L+ VAR GSGSACRS Y GF +W  G   +G DS A       
Sbjct: 123 LVYSLSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVAKQIAPSA 181

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFI 248
            WPD+ + +L + D  KK  S   M+ +   S        Q +   +  +++AI   DF 
Sbjct: 182 HWPDMHVLILVVNDARKKTASTRGMQQSVKTSQLIKHRVDQVVPDRINQLREAIASHDFQ 241

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNL 306
              E+  K++ + HA  +   PP +Y    + + +  V D  +   S    +T DAGPN 
Sbjct: 242 TFAEITMKDSNQFHAVALDTYPPCVYMNDVSHRIVSFVHDYNESMGSYHAAYTFDAGPNA 301

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
            L    +    +      +  + P D  D 
Sbjct: 302 CLYVLAEN---VPHLLSAVQRVFPNDLADG 328


>gi|289433384|ref|YP_003463256.1| mevalonate diphosphate decarboxylase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289169628|emb|CBH26162.1| mevalonate diphosphate decarboxylase [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 323

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 189/326 (57%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  +LNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLKQDRFMLNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K T+F D  R+   +    LI + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVTRFIDKMREEFGITAKALIISENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  + +S++AR GSGSA RS Y  F  W  G   +G DSFA+PF  +  D + + +
Sbjct: 117 AGRNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAIPFTKKLSDKMSMVI 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+ +DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFKEWVAAAETDLEEMKQAILAEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V   R++ IP YFT+DAGPN+K++   K E+ +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDEVRALREEGIPAYFTMDAGPNVKVICERKNEKIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
            +   E+   ++      +     D 
Sbjct: 297 AEKLSELAKNVLICHAGKEASVVSDE 322


>gi|302821362|ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gi|300139887|gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
          Length = 403

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 108/355 (30%), Positives = 164/355 (46%), Gaps = 27/355 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQ 81
           +A  PSNIA+ KYWGKRD  L LPLN+S+S++L    L   T ++     DAD + LN +
Sbjct: 13  TARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDK 72

Query: 82  KISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASSA 126
           ++S  S  +    +                      +  +   I + NN PT AGLASSA
Sbjct: 73  EVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSA 132

Query: 127 SGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           +GFA L   +  +  I E     LS +AR GSGSACRS + GF +W  G   +G DS AV
Sbjct: 133 AGFACLVFTVAELMGIKESFPGELSTIARRGSGSACRSLHGGFVKWEMGKRADGKDSIAV 192

Query: 186 PFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
           P      W DLRI +  +  R+K++ S   M+ +   SP       + +   +  +++A+
Sbjct: 193 PLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKRITEMEEAL 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             +DF    ++   ++ + HAT +  SPP+ Y    + + +  V  W+  + S    +T 
Sbjct: 253 SKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           DAGPN  +    K    +           P       S+    S +    LGI K
Sbjct: 313 DAGPNAVIFVPQKSGGALLHRL---LYEFPPPEGMNLSSYVVGSTELLEALGIDK 364


>gi|328958132|ref|YP_004375518.1| diphosphomevalonate decarboxylase [Carnobacterium sp. 17-4]
 gi|328674456|gb|AEB30502.1| diphosphomevalonate decarboxylase [Carnobacterium sp. 17-4]
          Length = 328

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 129/329 (39%), Positives = 189/329 (57%), Gaps = 11/329 (3%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           K++        +NIAL KYWGKRD  L LP ++SLSL+L    T T ++  +S   D   
Sbjct: 3   KLSNARKVRAYTNIALIKYWGKRDDALILPTSSSLSLTLDAFYTETSVSFDESIGKDTFY 62

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLA 135
           LN       ++   K ++F +LFR+ + V    +I+++N +PT AGLASSASG AAL  A
Sbjct: 63  LNDTLQDEAATL--KVSRFLNLFRETADVKTPAIIKSTNYVPTAAGLASSASGMAALAGA 120

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
                 +    + LS  AR GSGSA RS Y GF EW  GT    +DS+AV  ++   D+ 
Sbjct: 121 ANLATGLNLSPQELSIFARQGSGSATRSIYGGFVEWQKGTT--SLDSYAVKIDDAAWDIG 178

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           + ++ +   +K++ SRE M+ T   SPF++ W +  + DL +IK+AI DQDF  +GE+ E
Sbjct: 179 MLVVVVNKNQKELSSREGMKQTVATSPFYSGWVESTAVDLVNIKKAIRDQDFELVGEITE 238

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
            N +KMH TM+ A+PP+ YW+ +++  M+ V   R+Q IP YFT+DAGPN+K+L      
Sbjct: 239 SNGMKMHGTMLGANPPISYWEPDSVVAMQLVRQLRKQGIPCYFTMDAGPNVKVLCRLSDS 298

Query: 316 ETIK----QFFPEITIIDPLDSPDLWSTK 340
           + IK     +F E  +I      DL    
Sbjct: 299 QKIKTAFLNYFNEEQLIISGPGSDLKEVT 327


>gi|331224857|ref|XP_003325100.1| diphosphomevalonate decarboxylase MVD1 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
 gi|309304090|gb|EFP80681.1| diphosphomevalonate decarboxylase MVD1 [Puccinia graminis f. sp.
           tritici CRL 75-36-700-3]
          Length = 427

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 101/367 (27%), Positives = 158/367 (43%), Gaps = 39/367 (10%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHIT----------VI 69
           ++ +   P NIA+ KYWGKRD KL LP N+SLS++L    L + T             V 
Sbjct: 3   KEITCSAPVNIAVIKYWGKRDKKLILPTNSSLSVTLDQHDLRSTTTARLLEPSHKNGQVG 62

Query: 70  DSDADCIILNGQKISS-QSSFFKKTTQFCDLFRQFSKVY--------------FLIETSN 114
           + + D + LNG +    + S      +     +   ++                LI + N
Sbjct: 63  EEEEDQLWLNGARQPIEKDSRLSNCLKELRKLKAHFELQQPKTEASLPESRRALLIASEN 122

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSASGFAAL   + ++Y +P +   LS++AR GSGSACRS + GF  W  G
Sbjct: 123 NFPTAAGLASSASGFAALVYTISKLYELPIEMTELSKIARQGSGSACRSIFGGFVSWEMG 182

Query: 175 TDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QI 231
              +G DS AV       WPDL   +  + DR+K   S   M+ +   S       +  +
Sbjct: 183 AASDGSDSMAVSVAERSDWPDLEALICVVSDRKKGTSSTSGMDGSVQTSELLQHRIEKVV 242

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ 291
              +  +K AI  +DF     +   ++ + HA  +   PP+ Y    +   +  + +  +
Sbjct: 243 PERMKRMKSAIKQKDFDSFAALTMADSNQFHAVCLDTQPPIFYLNDVSRSIIAVIEELNR 302

Query: 292 ------QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                       +T DAGPN  +    +     ++    I    PL   D ++   +   
Sbjct: 303 ASKAEGDGCLAAYTFDAGPNAVIYAPKRNM---RKLLNLILHYFPLPDSDPFTDPKAYFD 359

Query: 346 KNSIELG 352
            +    G
Sbjct: 360 LSKETPG 366


>gi|326479090|gb|EGE03100.1| diphosphomevalonate decarboxylase [Trichophyton equinum CBS 127.97]
          Length = 402

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 175/365 (47%), Gaps = 28/365 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI- 69
           +   N +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAAANDQRVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSA 60

Query: 70  ---DSDADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSN 114
               +D D + LN +  S Q S              +          + S     I + N
Sbjct: 61  KYPPADGDSLTLNNKPHSIQGSPRTLACLADLRSLRQLIESSDPSLPKLSTYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI- 231
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-R 290
              +  I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R
Sbjct: 241 PERMTAIEKSIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDLNR 300

Query: 291 QQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
                +  +T DAGPN  + +  K  + +   F  I       + + W + +     NS+
Sbjct: 301 AAGRSVCAYTFDAGPNAVIYYLEKDADCVLGAFKSIL----TSATEGWESANIK-NTNSL 355

Query: 350 ELGIS 354
           E  I 
Sbjct: 356 EQSID 360


>gi|70727400|ref|YP_254316.1| mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68448126|dbj|BAE05710.1| mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 327

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 121/323 (37%), Positives = 182/323 (56%), Gaps = 5/323 (1%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK D  L +P+NNSLS++L    T T +T  ++   D +ILNG+ ++
Sbjct: 7   ARAHTNIALIKYWGKADEALIIPMNNSLSVTLDRFYTETRVTFDETLTEDQLILNGEAVN 66

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           ++ S   K  ++ ++ R+ + +  + LIE+ N +PT AGLASSAS +AAL  A      +
Sbjct: 67  AKES--AKIQRYMEMIRKEAGISEHALIESENFVPTAAGLASSASAYAALAGACNEALQL 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+AR GSGSA RS Y GF EW  G D     +  V  +    +L +  + I 
Sbjct: 125 GLSDKDLSRLARRGSGSASRSIYGGFAEWEKGNDDETSFAHRVEADGWENELAMVFVVIN 184

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           ++ KK+ SR  M +TR  S F+  W   +  DL  IK+AI  +DF ++GEV E N L+MH
Sbjct: 185 NKSKKVSSRSGMSLTRDTSRFYQYWLDNVEPDLKEIKEAIAQKDFKRMGEVIEANGLRMH 244

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT + A PP  Y   E+   M  V + R+  +P YFT+DAGPN+K+L   K ++ I   F
Sbjct: 245 ATNLGAQPPFTYLVPESYDAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKNQQAIVDKF 304

Query: 323 PEITIIDPLDSPDLWSTKDSLSQ 345
            +      + + D+  +   + +
Sbjct: 305 LQEFDQSQIITSDITQSGVEIIK 327


>gi|227555014|ref|ZP_03985061.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis HH22]
 gi|227175840|gb|EEI56812.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis HH22]
 gi|315574184|gb|EFU86375.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0309B]
 gi|315581673|gb|EFU93864.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX0309A]
          Length = 341

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 124/334 (37%), Positives = 178/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +        D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVIFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGILQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|28571205|ref|NP_573068.3| CG8239 [Drosophila melanogaster]
 gi|17862156|gb|AAL39555.1| LD10857p [Drosophila melanogaster]
 gi|28381624|gb|AAF48505.3| CG8239 [Drosophila melanogaster]
 gi|220943024|gb|ACL84055.1| CG8239-PA [synthetic construct]
 gi|220953128|gb|ACL89107.1| CG8239-PA [synthetic construct]
          Length = 388

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 105/331 (31%), Positives = 157/331 (47%), Gaps = 20/331 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIIL 78
              +   P NIAL KYWGKR  +L LP+N+S+S++L    L   T +T  +S + + + L
Sbjct: 2   FSVTCVAPVNIALIKYWGKRHEELILPVNDSISMTLSTDELCAKTTVTASESFETNRMWL 61

Query: 79  NGQKISSQS-SFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAGLASSASGFA 130
           NG+++  +  S  ++           S            I + NN PT AGLASSA+G+A
Sbjct: 62  NGEEVPFEESSRLQRCLNEVHRLAVASGSQKVPPTWKLHIASVNNFPTAAGLASSAAGYA 121

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFN 188
            L  +L R+Y IP   E L+ VAR GSGSACRS Y GF +W  G   +G DS A  +  +
Sbjct: 122 CLVYSLSRLYDIPLN-EELTTVARQGSGSACRSLYGGFVQWHRGALDDGSDSVARQIAPS 180

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDF 247
           + WP++ + +L + D  KK  S   M+     S        Q +   +  +++AI   DF
Sbjct: 181 DHWPNMHVLILVVNDARKKTASTRGMQQAVKTSQLIKHRVDQVVPDRIIRLREAIASHDF 240

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA--RQQSIPIYFTLDAGPN 305
               E+  K++ + HA  +   PP +Y    +   +  V D   R  S    +T DAGPN
Sbjct: 241 QAFAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVSFVHDYNERMGSYHAAYTFDAGPN 300

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
             L    +    +      I  + P D  D 
Sbjct: 301 ACLYVLAEH---VPHLLSAIQKVFPNDLADG 328


>gi|258568314|ref|XP_002584901.1| diphosphomevalonate decarboxylase [Uncinocarpus reesii 1704]
 gi|237906347|gb|EEP80748.1| diphosphomevalonate decarboxylase [Uncinocarpus reesii 1704]
          Length = 403

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 106/339 (31%), Positives = 156/339 (46%), Gaps = 27/339 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            +SS   P NIA+ KYWGKRD  LNLP N+SLS++L    L   T  +  DS      D 
Sbjct: 9   YRSSTTAPVNIAVIKYWGKRDETLNLPTNSSLSVTLSQADLRAHTTASCSDSYPHAQGDT 68

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LNG     ++S              +          + S     I + NN PT AGLA
Sbjct: 69  LTLNGTPQDIRASKRTLACLSDLRILRRALEDANPSLPRLSAFPLRIVSENNFPTAAGLA 128

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G+  +G DS 
Sbjct: 129 SSAAGFAALVRAVADLYELPQSPSELSRIARQGSGSACRSLMGGYVAWRAGSKGDGSDSI 188

Query: 184 AVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQ 240
           A        WP++R  +L +   +K + S + M+ T   S  F    + I    +A ++ 
Sbjct: 189 AEQVAPAGHWPEMRALILVVSAAKKDVPSTKGMQSTFTTSTLFPTRAKSIVPERMAAMET 248

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI + DF    E+  +++   HAT +   PP+ Y    +   +  V +  +        +
Sbjct: 249 AIRNWDFKSFAEITMRDSNNFHATCLDTWPPIFYINDVSRAAINLVHEVNRIAGKAICAY 308

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
           T DAGPN  + +  K    +   F +I         + W
Sbjct: 309 TFDAGPNAVIYYLEKDSMQVLGTFRQIL----KPETEGW 343


>gi|257415465|ref|ZP_05592459.1| diphosphomevalonate decarboxylase [Enterococcus faecalis AR01/DG]
 gi|257157293|gb|EEU87253.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ARO1/DG]
          Length = 331

 Score =  341 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDTHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIVEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|255971353|ref|ZP_05421939.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T1]
 gi|256854253|ref|ZP_05559617.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis T8]
 gi|256960027|ref|ZP_05564198.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Merz96]
 gi|257081146|ref|ZP_05575507.1| diphosphomevalonate decarboxylase [Enterococcus faecalis E1Sol]
 gi|257083815|ref|ZP_05578176.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Fly1]
 gi|257086240|ref|ZP_05580601.1| diphosphomevalonate decarboxylase [Enterococcus faecalis D6]
 gi|257421147|ref|ZP_05598137.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis X98]
 gi|255962371|gb|EET94847.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T1]
 gi|256709813|gb|EEU24857.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis T8]
 gi|256950523|gb|EEU67155.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Merz96]
 gi|256989176|gb|EEU76478.1| diphosphomevalonate decarboxylase [Enterococcus faecalis E1Sol]
 gi|256991845|gb|EEU79147.1| diphosphomevalonate decarboxylase [Enterococcus faecalis Fly1]
 gi|256994270|gb|EEU81572.1| diphosphomevalonate decarboxylase [Enterococcus faecalis D6]
 gi|257162971|gb|EEU92931.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis X98]
 gi|323480083|gb|ADX79522.1| diphosphomevalonate decarboxylase [Enterococcus faecalis 62]
          Length = 331

 Score =  341 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|281200311|gb|EFA74532.1| diphosphomevalonate decarboxylase [Polysphondylium pallidum PN500]
          Length = 399

 Score =  341 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 109/340 (32%), Positives = 159/340 (46%), Gaps = 20/340 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIIL 78
              +   P NIA  KYWGKRD KL LPLN+SLS +L    L T T     +    D I L
Sbjct: 3   SSITCTAPVNIATIKYWGKRDEKLILPLNSSLSGTLHQDDLKTTTTAVASENFTEDAIWL 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG+K    ++ ++   +            K +  I + NN PT AGLASSASG+A L   
Sbjct: 63  NGKKEDINTTRYQNVLRMIRSRATKLMDKKHFVHICSINNFPTAAGLASSASGYACLVYV 122

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L ++Y +   S  +S +AR+GSGSACRS Y GF +W  G + +G DS AV       WP+
Sbjct: 123 LAQLYGV---SGDISAIARIGSGSACRSVYGGFVKWEMGAESDGSDSIAVQVAPETHWPE 179

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIIDQDFIKLGE 252
           + I +L + D++K+  S + M+ +   SP   +     +   +  I+ AI  +DF   G+
Sbjct: 180 MNIIVLVVNDKKKETSSTDGMQRSAATSPMMKERCATIVPQRMRDIEAAIQARDFQTFGD 239

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLF 310
           +  K++   H       P + Y    +   M  V    +    I   +T DAGPN  +  
Sbjct: 240 ITMKDSDDFHEVCATTDPAIYYLNDTSRYIMNLVHKYNKMSGKIKCAYTFDAGPNACIYL 299

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
             +        F +          DL ST    S K++IE
Sbjct: 300 PEENVVEALALFTK-----HFPGSDL-STYYRGSDKSNIE 333


>gi|256617771|ref|ZP_05474617.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ATCC 4200]
 gi|257089313|ref|ZP_05583674.1| diphosphomevalonate decarboxylase [Enterococcus faecalis CH188]
 gi|256597298|gb|EEU16474.1| diphosphomevalonate decarboxylase [Enterococcus faecalis ATCC 4200]
 gi|256998125|gb|EEU84645.1| diphosphomevalonate decarboxylase [Enterococcus faecalis CH188]
          Length = 331

 Score =  341 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|50252009|dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa
           Japonica Group]
 gi|215769195|dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222622023|gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
          Length = 421

 Score =  341 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 102/336 (30%), Positives = 164/336 (48%), Gaps = 25/336 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 13  ATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 72

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G A     L ++ ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV
Sbjct: 133 AAGLACFVFTLGKLMNVKEDHGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAV 192

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
              +   W DL I +  +  ++K+  S   M  +   SP      Q  +   +  +++AI
Sbjct: 193 QLADEAHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPERVLKMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
             ++F     +   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 253 KSRNFESFARLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNQSEGTPQVAYTF 312

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           DAGPN  L+  ++   TI     ++    P    DL
Sbjct: 313 DAGPNAVLIAPNRKNATIL--LQKLLYYFPPQDNDL 346


>gi|260943830|ref|XP_002616213.1| hypothetical protein CLUG_03454 [Clavispora lusitaniae ATCC 42720]
 gi|238849862|gb|EEQ39326.1| hypothetical protein CLUG_03454 [Clavispora lusitaniae ATCC 42720]
          Length = 385

 Score =  341 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 100/329 (30%), Positives = 159/329 (48%), Gaps = 19/329 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIIL 78
             +S   P NIA  KYWGKRD  LNLP N+S+S++L    L T+T +   +    D + L
Sbjct: 4   FTASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDLRTLTSVATSEEFSKDNLWL 63

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG +   +        +     R+            S+    I + NN PT AGLASSA+
Sbjct: 64  NGVEEGIKGERTIACLKDLRRLRKELEEQDSSLPKLSEWGLHIVSENNFPTAAGLASSAA 123

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAAL +A+ ++Y +P+    +S++AR GSGSACRS + G+  W  G  +NG DS AV  
Sbjct: 124 GFAALVVAIAKLYKLPQSMSEISKIARKGSGSACRSLFGGYVAWEMGDLENGEDSKAVEV 183

Query: 188 N--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIID 244
                WP ++  +L + D +K   S   M+ T   S  F     + +      +K++I +
Sbjct: 184 APLEHWPTMKAAILVVSDDKKDTPSTTGMQSTVATSDLFQWRIKEVVPKRFEQMKKSIAE 243

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDA 302
           +DF   GE+  K++   HA  + + PP+ Y    + + ++ +    +Q   I   +T DA
Sbjct: 244 RDFQTFGELTMKDSNSFHAVCLDSYPPIFYLNDTSKKIIKLIHKLNEQEGKIIAAYTFDA 303

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPL 331
           GPN  + +  +    +     +     P 
Sbjct: 304 GPNAVIYYEEENVTKVLGLIHKYFHQVPG 332


>gi|315167962|gb|EFU11979.1| diphosphomevalonate decarboxylase [Enterococcus faecalis TX1341]
          Length = 341

 Score =  341 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 124/334 (37%), Positives = 178/334 (53%), Gaps = 11/334 (3%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DAD 74
              K+     A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +        D
Sbjct: 6   RGEKVMLSGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVIFDAHYSED 65

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
             IL+G   + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL
Sbjct: 66  VFILDGILQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A      +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   
Sbjct: 124 AGACNVALGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWEN 183

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           +L +  + I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE
Sbjct: 184 ELAMLFILINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           + E N L+MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   
Sbjct: 244 IIEANGLRMHGTTLGAIPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEK 303

Query: 313 KIEETIKQFF------PEITIIDPLDSPDLWSTK 340
           K  E +K F        ++         +L+ TK
Sbjct: 304 KNLEALKTFLSEHFSKEQLVPAFAGPGIELFETK 337


>gi|149241985|pdb|2HK2|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 gi|149241986|pdb|2HK2|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Monoclinic Form)
 gi|149241989|pdb|2HK3|A Chain A, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
 gi|149241990|pdb|2HK3|B Chain B, Crystal Structure Of Mevalonate Diphosphate Decarboxylase
           From Staphylococcus Aureus (Orthorhombic Form)
          Length = 331

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 7   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 66

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 67  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 124

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 125 ALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 184

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 185 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 244

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 245 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 304

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 305 IDKLLTQFDNNQIIDSDIIATGIEIIE 331


>gi|21282275|ref|NP_645363.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49485457|ref|YP_042678.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57651466|ref|YP_185522.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87162286|ref|YP_493276.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88194352|ref|YP_499145.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151220766|ref|YP_001331588.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161508830|ref|YP_001574489.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141881|ref|ZP_03566374.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450955|ref|ZP_05699007.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5948]
 gi|262049685|ref|ZP_06022552.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus D30]
 gi|282925434|ref|ZP_06333089.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9765]
 gi|284023606|ref|ZP_06378004.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 132]
 gi|294849236|ref|ZP_06789979.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9754]
 gi|297208693|ref|ZP_06925121.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300912784|ref|ZP_07130226.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381809|ref|ZP_07364456.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|21203712|dbj|BAB94411.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49243900|emb|CAG42325.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57285652|gb|AAW37746.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87128260|gb|ABD22774.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87201910|gb|ABD29720.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150373566|dbj|BAF66826.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160367639|gb|ABX28610.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|257861375|gb|EEV84184.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5948]
 gi|259162228|gb|EEW46803.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus D30]
 gi|269940163|emb|CBI48539.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282592528|gb|EFB97539.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9765]
 gi|294823768|gb|EFG40194.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9754]
 gi|296886638|gb|EFH25543.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|298693921|gb|ADI97143.1| Diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300885888|gb|EFK81091.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302750481|gb|ADL64658.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304339595|gb|EFM05542.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|315196518|gb|EFU26867.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139842|gb|EFW31704.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320141825|gb|EFW33653.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|329313312|gb|AEB87725.1| Mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329729931|gb|EGG66323.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 327

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|256964278|ref|ZP_05568449.1| diphosphomevalonate decarboxylase [Enterococcus faecalis HIP11704]
 gi|256954774|gb|EEU71406.1| diphosphomevalonate decarboxylase [Enterococcus faecalis HIP11704]
          Length = 331

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 177/327 (54%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +T       D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVTFDAHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQANCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVKKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|9937373|gb|AAG02431.1|AF290089_2 mevalonate diphosphate decarboxylase [Staphylococcus haemolyticus]
          Length = 327

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 120/328 (36%), Positives = 182/328 (55%), Gaps = 5/328 (1%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
            +   A   +NIAL KYWGK D  L +P+NNSLS++L    T T +T  ++   D +ILN
Sbjct: 2   KKSGKARAHTNIALIKYWGKADEALIIPMNNSLSVTLDRFYTETRVTFDETLTEDQLILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G+ ++++ S   K  ++ ++ R+ + +  + LIE+ N +PT AGLASSAS +AAL  A  
Sbjct: 62  GEAVNAKES--AKIQRYMEMIRKEAGISEHALIESENFVPTAAGLASSASAYAALAGACN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
               +    + LSR+AR GSGSA RS Y GF EW  G D     +  V  +    +L + 
Sbjct: 120 EALQLGLSDKDLSRLARRGSGSASRSIYGGFAEWEKGNDDETSFAHRVEADGWENELAMV 179

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+AI  +DF ++GEV E N
Sbjct: 180 FVVINNKSKKVSSRSGMSLTRDTSRFYQYWLDNVEPDLKETKEAIAQKDFKRMGEVIEAN 239

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
            L+MHAT + A PP  Y   E+   M  V + R+  +P YFT+DAGPN+K+L   K ++ 
Sbjct: 240 GLRMHATNLGAQPPFTYLVPESYDAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKNQQA 299

Query: 318 IKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           I   F +      + + D+  +   + +
Sbjct: 300 IVDKFLQEFDQSQIITSDITQSGVEIIK 327


>gi|328790375|ref|XP_001121619.2| PREDICTED: diphosphomevalonate decarboxylase-like [Apis mellifera]
          Length = 386

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 97/319 (30%), Positives = 153/319 (47%), Gaps = 18/319 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIILNG 80
            +   P NIA+ KYWGKRD  L LP N+S+S +L   HL   T + +      D I LNG
Sbjct: 4   VTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLNG 63

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK----VYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           ++    +   +            S         I + NN PT AGLASSA+G+A L +AL
Sbjct: 64  REEDIMNIRLQNCLTEIKKRAGDSNHMDQWKIHICSENNFPTSAGLASSAAGYACLVIAL 123

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
            ++Y +      ++ +AR+GSGSACRS   GF  W  G+  +G DS A      + WP++
Sbjct: 124 AKLYEVK---GDITAIARVGSGSACRSILGGFVRWYMGSQTDGTDSIAKQIVPASYWPEM 180

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEV 253
           RI +L + + +K + S   M+     S F     + I    +  I+QAI+ +DF    E 
Sbjct: 181 RILILVVNEAKKNVSSAIGMKRGMETSDFLNFRVKHIVPDRVKSIEQAILQKDFKTFAEH 240

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFT 311
             K++ +MHA  +   PP +Y    +   ++ +    +  + + + +T DAGPN  L   
Sbjct: 241 TMKDSNQMHAACLDTYPPCVYMNDISHAIVDLIHAYNETVKEVKVAYTFDAGPNATLYLL 300

Query: 312 HKIEETIKQFFPEITIIDP 330
            +    + +F   +    P
Sbjct: 301 EEN---VTEFLGVLDYFFP 316


>gi|328859785|gb|EGG08893.1| hypothetical protein MELLADRAFT_74468 [Melampsora larici-populina
           98AG31]
          Length = 412

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 110/354 (31%), Positives = 164/354 (46%), Gaps = 36/354 (10%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDSDA-DCIIL 78
           ++ +   P NIA+ KYWGKRD++L LP N+SLS++L    L + T   +IDS+  D + L
Sbjct: 3   KEVTCSAPVNIAVVKYWGKRDNELILPTNSSLSVTLDQDDLRSTTTARLIDSEGADQLWL 62

Query: 79  NGQKISSQS-SFFKKTTQFCDLFR----------------QFSKVYFLIETSNNIPTKAG 121
           NG ++     S   +        R                  S+   +I + NN PT AG
Sbjct: 63  NGAQVEITPGSRLARCLDELRQLRAQSEATSPKDVKDAQLPESRRALVIASENNFPTAAG 122

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSASGFAAL   + +++ +    E LSR+AR GSGSACRS   GF  W  GT  +G D
Sbjct: 123 LASSASGFAALAFTVAQLFELQMSPERLSRIARQGSGSACRSLLGGFVAWDMGTAADGGD 182

Query: 182 SFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHI 238
           S A  V     WPDL   +  + D +K   S   M  T   S       +  +   +A +
Sbjct: 183 SGARMVAPQAHWPDLEAMICVVSDSKKGTSSTGGMAATVATSALLQHRIKDVVPARMAAM 242

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------Q 292
           ++AI  +DF K   +   ++ + HA  +  +PP+ Y    +   +  V +  +      Q
Sbjct: 243 EEAIASRDFEKFSALTIADSNQFHAVCLDTTPPIFYLNDVSRAIIAVVEELNRSSRALGQ 302

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEE----TIKQFFPEITIIDPLDSPDLWSTKDS 342
                +T DAGPN  +       +    TI  FFP   + DP + P  +    +
Sbjct: 303 GTLATYTFDAGPNAVIYAPRANMKTIVSTILNFFP---LADPFNDPKGYLADKT 353


>gi|258455093|ref|ZP_05703055.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5937]
 gi|257862733|gb|EEV85499.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A5937]
          Length = 327

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWFDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|26354448|dbj|BAC40852.1| unnamed protein product [Mus musculus]
 gi|74191909|dbj|BAE32901.1| unnamed protein product [Mus musculus]
          Length = 401

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 101/346 (29%), Positives = 155/346 (44%), Gaps = 27/346 (7%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
                +   +   P NIA+ KYWGKRD  L LP+N+SLS++L    L T T + +  D  
Sbjct: 3   SEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFT 62

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTK 119
            D I LNG++        +   +      +  +                 + + NN PT 
Sbjct: 63  EDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTA 122

Query: 120 AGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           AGLASSA+G+A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G
Sbjct: 123 AGLASSAAGYACLAYTLAQVYGVE---GDLSEVARRGSGSACRSLYGGFVEWQMGEQADG 179

Query: 180 MDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT-QWTQQISTDLA 236
            DS A  +     WP LRI +L +   +K+ GS   M+ +   S     Q    +   + 
Sbjct: 180 KDSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFQAESVVPERMK 239

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSI 294
            + + I +QDF    ++  K++ + H T +   PP+ Y    + + ++ V      Q   
Sbjct: 240 EMTRCIQEQDFQGFAQLTMKDSNQFHVTCLDTFPPISYLNDTSRRIIQLVHRFNTHQGQT 299

Query: 295 PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            + +T DAGPN  +       +T+ +F   +    P  +      K
Sbjct: 300 KVAYTFDAGPNAVIFTLE---DTVAEFVAAVRHSFPPAANGDKFLK 342


>gi|15923581|ref|NP_371115.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15926269|ref|NP_373802.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148267051|ref|YP_001245994.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150393099|ref|YP_001315774.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156978920|ref|YP_001441179.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253316616|ref|ZP_04839829.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|255005384|ref|ZP_05143985.2| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257427378|ref|ZP_05603777.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257430010|ref|ZP_05606394.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257432712|ref|ZP_05609072.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257435616|ref|ZP_05611664.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M876]
 gi|257793173|ref|ZP_05642152.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9781]
 gi|258407658|ref|ZP_05680793.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9763]
 gi|258420346|ref|ZP_05683291.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9719]
 gi|258436525|ref|ZP_05689183.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9299]
 gi|258442341|ref|ZP_05691104.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A8115]
 gi|258446287|ref|ZP_05694445.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6300]
 gi|258450054|ref|ZP_05698151.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6224]
 gi|269202213|ref|YP_003281482.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282895030|ref|ZP_06303252.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8117]
 gi|282904969|ref|ZP_06312827.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282907925|ref|ZP_06315759.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282910234|ref|ZP_06318038.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282913427|ref|ZP_06321216.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282915916|ref|ZP_06323681.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus D139]
 gi|282918380|ref|ZP_06326117.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C427]
 gi|282923345|ref|ZP_06331025.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282928727|ref|ZP_06336322.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A10102]
 gi|283769746|ref|ZP_06342638.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus H19]
 gi|283957392|ref|ZP_06374845.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293500474|ref|ZP_06666325.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293509419|ref|ZP_06668130.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M809]
 gi|293524006|ref|ZP_06670693.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|295406969|ref|ZP_06816772.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8819]
 gi|296275506|ref|ZP_06858013.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297246130|ref|ZP_06929985.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8796]
 gi|297590518|ref|ZP_06949157.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|9937365|gb|AAG02425.1|AF290087_2 mevalonate diphosphate decarboxylase [Staphylococcus aureus]
 gi|13700483|dbj|BAB41780.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14246359|dbj|BAB56753.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147740120|gb|ABQ48418.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945551|gb|ABR51487.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156721055|dbj|BAF77472.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|257275571|gb|EEV07044.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257279207|gb|EEV09808.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257282127|gb|EEV12262.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284807|gb|EEV14926.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M876]
 gi|257787145|gb|EEV25485.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9781]
 gi|257840738|gb|EEV65196.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9763]
 gi|257843660|gb|EEV68064.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9719]
 gi|257848796|gb|EEV72782.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A9299]
 gi|257852070|gb|EEV76002.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A8115]
 gi|257854881|gb|EEV77826.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6300]
 gi|257856673|gb|EEV79577.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus A6224]
 gi|262074503|gb|ACY10476.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282314213|gb|EFB44603.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C101]
 gi|282317514|gb|EFB47886.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C427]
 gi|282320212|gb|EFB50557.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus D139]
 gi|282322459|gb|EFB52781.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325626|gb|EFB55934.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282328170|gb|EFB58449.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282331794|gb|EFB61305.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282589610|gb|EFB94697.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A10102]
 gi|282762613|gb|EFC02751.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8117]
 gi|283459893|gb|EFC06983.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus H19]
 gi|283790843|gb|EFC29658.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285816292|gb|ADC36779.1| Diphosphomevalonate decarboxylase [Staphylococcus aureus 04-02981]
 gi|290920969|gb|EFD98030.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095479|gb|EFE25740.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291467516|gb|EFF10031.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus M809]
 gi|294968200|gb|EFG44226.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8819]
 gi|297176976|gb|EFH36232.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A8796]
 gi|297576817|gb|EFH95532.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|312438988|gb|ADQ78059.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312829086|emb|CBX33928.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315128901|gb|EFT84899.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|315193960|gb|EFU24354.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|329724387|gb|EGG60898.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 327

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|120437951|ref|YP_863637.1| diphosphomevalonate decarboxylase [Gramella forsetii KT0803]
 gi|117580101|emb|CAL68570.1| diphosphomevalonate decarboxylase [Gramella forsetii KT0803]
          Length = 380

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 85/353 (24%), Positives = 154/353 (43%), Gaps = 30/353 (8%)

Query: 5   LRHILHRYIGE--CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGT 62
           +R     +I         + + +   PSNIAL KYWGK   +  +P N S+S +L H  +
Sbjct: 19  MRMTQMEFIPSEYTTNIESGEFTWQSPSNIALIKYWGK--LENQIPANPSISFTLDHCKS 76

Query: 63  ITHITVIDSDA-----DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETS 113
            T +     +            G++          FF++   +C         YF I + 
Sbjct: 77  TTTLKFKKKENPGNFDFDFFFEGKEKEDFKPKIRKFFERIEAYCPY---LKDYYFEIHSE 133

Query: 114 NNIPTKAGLASSASGFAALTLALFRIY-------SIPEKSESLSRVARLGSGSACRSFYR 166
           N+ P  +G+ASSASG +AL L L ++           + +   S +ARLGSGSA RS   
Sbjct: 134 NSFPHSSGIASSASGMSALALCLMQLEKELNPKIDKEQFNRKASFLARLGSGSASRSIAG 193

Query: 167 GFCEWICGTDQNGMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHS 221
               W                +    +  + + +  +L +   EK++ S        H  
Sbjct: 194 ELVVWGKHEYIESSSDLYAIEYPHQVHKNFKNYQDTILLVDKGEKQVSSTIG-HDLMHGH 252

Query: 222 PFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQ 281
           PF  +  +Q + +L  +   +   D     ++ E+ AL +HA M+++ P  +  +  T++
Sbjct: 253 PFAEKRFEQANENLKKLIPVLKSGDLSAFIKIVEREALSLHAMMMSSQPYFILMKPNTLE 312

Query: 282 GMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
            + ++W+ R+ + IP  FTLDAG N+ LL+  K ++ + +F     ++   ++
Sbjct: 313 IINKIWEFREATKIPACFTLDAGANVHLLYPDKHKDEVLEFIKNELVVYCQNA 365


>gi|16802059|ref|NP_463544.1| hypothetical protein lmo0011 [Listeria monocytogenes EGD-e]
 gi|47097294|ref|ZP_00234852.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498297|ref|ZP_03666646.1| hypothetical protein LmonF1_00820 [Listeria monocytogenes Finland
           1988]
 gi|224503065|ref|ZP_03671372.1| hypothetical protein LmonFR_11181 [Listeria monocytogenes FSL
           R2-561]
 gi|254830696|ref|ZP_05235351.1| hypothetical protein Lmon1_05029 [Listeria monocytogenes 10403S]
 gi|254899674|ref|ZP_05259598.1| hypothetical protein LmonJ_07671 [Listeria monocytogenes J0161]
 gi|284803254|ref|YP_003415119.1| hypothetical protein LM5578_3011 [Listeria monocytogenes 08-5578]
 gi|284996395|ref|YP_003418163.1| hypothetical protein LM5923_2960 [Listeria monocytogenes 08-5923]
 gi|16409370|emb|CAC98226.1| lmo0011 [Listeria monocytogenes EGD-e]
 gi|47014339|gb|EAL05314.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|284058816|gb|ADB69757.1| hypothetical protein LM5578_3011 [Listeria monocytogenes 08-5578]
 gi|284061862|gb|ADB72801.1| hypothetical protein LM5923_2960 [Listeria monocytogenes 08-5923]
          Length = 323

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 184/326 (56%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSNA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++     E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERANENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
            +    +   ++      +     D 
Sbjct: 297 AEKLSGLAKNVLICHAGKEASVVSDE 322


>gi|39645379|gb|AAH63907.1| mvd-prov protein [Xenopus (Silurana) tropicalis]
          Length = 402

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 98/333 (29%), Positives = 156/333 (46%), Gaps = 27/333 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIIL 78
           +K +   P NIA+ KYWGK++ +L LP+N+SLS++L    L T T      +   D I L
Sbjct: 10  KKVTCTAPVNIAVIKYWGKQNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWL 69

Query: 79  NGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTKAGLASS 125
           NG++ +      +   +                   +       I + NN PT AGLASS
Sbjct: 70  NGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSRILNDKVHICSVNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+G+A L   L ++Y +      LS +AR GSGSACRS Y GF +W+ G   +G DS A 
Sbjct: 130 AAGYACLVYTLAKLYGVE---GELSEIARQGSGSACRSMYGGFVQWVMGERDDGKDSLAK 186

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
            V   + WP+LR+ +L     +K +GS   M+ +   SP         +   +  + ++I
Sbjct: 187 QVEPESHWPELRVLILVATAEKKHVGSTAGMQTSVETSPLLKLRADLVVPERMEAMIESI 246

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTL 300
             +DF   GE+  K++ + HAT +   PP+ Y    + + +  V           + ++ 
Sbjct: 247 RKKDFKAFGELTMKDSNQFHATCLDTYPPIFYLNSVSQRVISVVHQYNTYYGQTKVAYSF 306

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           DAGPN  +        T+ +F   +    P +S
Sbjct: 307 DAGPNAVIFMLE---PTVNEFVEVVKHCFPPES 336


>gi|323442137|gb|EGA99771.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus O46]
          Length = 327

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|315056619|ref|XP_003177684.1| diphosphomevalonate decarboxylase [Arthroderma gypseum CBS 118893]
 gi|311339530|gb|EFQ98732.1| diphosphomevalonate decarboxylase [Arthroderma gypseum CBS 118893]
          Length = 402

 Score =  340 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 111/351 (31%), Positives = 170/351 (48%), Gaps = 27/351 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID 70
           +   N +I  ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAAANDQIVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSA 60

Query: 71  S----DADCIILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSN 114
                D D + LN +  S Q S              K+         + S     I + N
Sbjct: 61  KYPAADGDTLTLNNKPHSVQGSPRTLACLADLRSLRKQVESSDPSLPKLSAYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVANLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAG 180

Query: 175 TDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI- 231
             ++G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F +  Q I 
Sbjct: 181 EKEDGSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPRRAQSIV 240

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-R 290
              +  I+++I ++DF    E+  +++   HAT +   PP  Y    +   +  V D  R
Sbjct: 241 PERMTAIERSIQERDFEAFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINR 300

Query: 291 QQSIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
                +  +T DAGPN  + +  K  + +   F  I         + W + 
Sbjct: 301 AAGRSVCAYTFDAGPNAVIYYLEKDTDCVLGTFKSILTSAN----EGWESS 347


>gi|258422778|ref|ZP_05685681.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9635]
 gi|257847009|gb|EEV71020.1| diphosphomevalonate decarboxylase [Staphylococcus aureus A9635]
          Length = 327

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEEFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYVEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|82750296|ref|YP_416037.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus RF122]
 gi|82655827|emb|CAI80229.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus RF122]
          Length = 327

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 MRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|195456994|ref|XP_002075379.1| GK17667 [Drosophila willistoni]
 gi|194171464|gb|EDW86365.1| GK17667 [Drosophila willistoni]
          Length = 396

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 102/329 (31%), Positives = 156/329 (47%), Gaps = 24/329 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIIL 78
              +   P NIAL KYWGKR+ +L LP+N+S+S++L    +   T I +     A+ + L
Sbjct: 2   HTVTCIAPVNIALIKYWGKRNEELILPINDSISMTLNANEMCAKTTISSWETFKANRMWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFS----------KVYFLIETSNNIPTKAGLASSASG 128
           NG++++ + +   +  +  D  R+ +               I + NN PT AGLASSA+G
Sbjct: 62  NGEEVTFEEN--ARLMRCLDGVRRLAVANGALKVPLNWKVHIASRNNFPTAAGLASSAAG 119

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF- 187
           +A L   L R+Y IP   E L+ VAR GSGSACRS Y GF  W  G   +G DS A    
Sbjct: 120 YACLVYTLARLYGIPIN-EELTAVARQGSGSACRSLYGGFVRWHSGVLDDGSDSVAKQVV 178

Query: 188 -NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQ 245
             + WP++ I +L + D  KK  S + M+     S       +  +      + +AI  +
Sbjct: 179 SPDHWPNMHILILVVNDARKKTPSTKGMQRAVTTSALIQHRAKVVVPRRTEELTEAIQLR 238

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
           DF    E+  K++ + HA  +   PP +Y    +   +  V    +   S+   +T DAG
Sbjct: 239 DFNSFAEITMKDSNQFHAIALDTYPPCVYMNDVSHSIVNFVHAYNEAVGSLQAAYTFDAG 298

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           PN  L    +    + Q    I +  P D
Sbjct: 299 PNACLYVLEEN---VPQLLAAIQLAFPND 324


>gi|225708030|gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
          Length = 398

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 105/352 (29%), Positives = 163/352 (46%), Gaps = 25/352 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNG 80
            +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T +    S + D I LNG
Sbjct: 12  VTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLRTTTTVACSRSFEEDRIWLNG 71

Query: 81  QKISSQSSFFKKTTQFCDLF---------RQFSKVYFLIETSNNIPTKAGLASSASGFAA 131
           ++        +   +                     F I + NN PT AGLASSA+G+A 
Sbjct: 72  REEDITLPRLQSCLREVRRLARKRHSDGDPAGLSHKFHICSVNNFPTAAGLASSAAGYAC 131

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ- 190
           L  +L R+  +      LS VAR GSGSACRS Y GF +W  G  ++G DS A     + 
Sbjct: 132 LVYSLARVLGVE---GELSVVARQGSGSACRSMYGGFVQWTMGQREDGKDSIAQQVAPET 188

Query: 191 -WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFI 248
            WP+LR+ +L +    K +GS   M+ +   S       +  +   +  + +A+  +DF 
Sbjct: 189 NWPELRVLVLVVSAERKLVGSTSGMQTSVETSSLLKHRAECVVPGRMEQMIRAVKKRDFA 248

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNL 306
              E+  K++ + HAT +   PP+ Y    + + +  V    +      + ++ DAGPN 
Sbjct: 249 TFAELTMKDSNQFHATCLDTYPPVFYLNDVSRRIINLVHRYNRHCGETRVAYSFDAGPNA 308

Query: 307 KLLFTHKIEETIKQ----FFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
            +    +      Q    FFP  T  +      L  T  +LS++    +G+ 
Sbjct: 309 VIFTLQEHTAEFFQVGGTFFPPETNGEQFL-KGLPITGVTLSEELKEAIGME 359


>gi|283469882|emb|CAQ49093.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 327

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 IVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|255025416|ref|ZP_05297402.1| hypothetical protein LmonocytFSL_02134 [Listeria monocytogenes FSL
           J2-003]
          Length = 323

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 184/326 (56%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLTQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSNA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWENGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++     E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERANENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
            +    +   ++      +     D 
Sbjct: 297 AEKLSGLAKNVLICHAGKEASVVSDE 322


>gi|313640107|gb|EFS04731.1| diphosphomevalonate decarboxylase [Listeria seeligeri FSL S4-171]
          Length = 323

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 187/326 (57%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  +LNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLKQDRFMLNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K T+F D  R+   +    LI + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVTRFIDKMREEFGITAKALIISENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  + +S++AR GSGSA RS Y  F  W  G   +G DSFA+PF  +  D +   +
Sbjct: 117 AGRNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAIPFTKKLSDKMXXXI 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF  W     TDL  +KQAI+ +DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFKDWVAAAETDLEEMKQAILAEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V   R++ IP YFT+DAGPN+K++   K E+ +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDAVRALREEGIPAYFTMDAGPNVKVICERKNEKIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
            +   E+   ++      +     D 
Sbjct: 297 AEKLSELAKNVLICHAGKEASVVSDE 322


>gi|225711458|gb|ACO11575.1| Diphosphomevalonate decarboxylase [Caligus rogercresseyi]
          Length = 390

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 100/337 (29%), Positives = 156/337 (46%), Gaps = 13/337 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIILNG 80
            +   P NIA+ KYWGKRD +L LP+N+S SL+L    +   T I      + D I LN 
Sbjct: 6   VTCIAPVNIAVIKYWGKRDEELILPINDSFSLTLDTKEMRAKTTIMTSPEFEKDQIWLND 65

Query: 81  QKISSQSSFFKKTTQFCDLFRQ--FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           ++ S ++   ++         Q         I + NN PT AGLASSA+G+A L  AL +
Sbjct: 66  KEESMENPRLQRCLGEIRKRSQASHKNWKIRICSENNFPTAAGLASSAAGYACLVYALSK 125

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRI 196
           I+ I      +S +ARLGSGSACRS   GF  W  G+   G DSF+     ++ W D+++
Sbjct: 126 IFEIN---GDISALARLGSGSACRSTLGGFVRWHMGSSPEGTDSFSESLFSSDHWNDIKV 182

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAE 255
            +  + D  +K+ S E M      S       ++ +   +  I +A+ ++DF    E+  
Sbjct: 183 LICVVSDSREKVPSSEGMRNGVKTSSLLKYRAEEDVPRRMETIIEAVKNKDFESFAEIVM 242

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP--IYFTLDAGPNLKLLFTHK 313
           K++ + HA  +   PP  Y    +      V +   +     + +T DAGPN  L     
Sbjct: 243 KDSNQFHAICMDTYPPNPYLNDTSHAISSLVHEINAKYRKNMVCYTYDAGPNACLFMPSS 302

Query: 314 IEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
             + +  +        P  S + +    SLS +N  E
Sbjct: 303 SLDLLAGYLQHFFPRSPDSSDEAFFLGKSLSPRNLTE 339


>gi|253732970|ref|ZP_04867135.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|253729150|gb|EES97879.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus TCH130]
          Length = 327

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DL   K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLTEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|290892049|ref|ZP_06555046.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J2-071]
 gi|290558643|gb|EFD92160.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J2-071]
          Length = 339

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 129/331 (38%), Positives = 190/331 (57%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++   D  
Sbjct: 13  EKVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEQKTD-----AKVARFIDKMREEFGIPAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   +
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERE 307

Query: 314 IEETIKQFFPEIT--IIDPLDSPDLWSTKDS 342
            E  +      +T  ++      +     D 
Sbjct: 308 NENIVADKLSGLTKNVLICHAGKEASVVSDE 338


>gi|29375487|ref|NP_814641.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis V583]
 gi|29342947|gb|AAO80711.1| mevalonate diphosphate decarboxylase [Enterococcus faecalis V583]
          Length = 331

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 176/327 (53%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +        D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVIFDAHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAVPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|49482821|ref|YP_040045.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|295427133|ref|ZP_06819769.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|49240950|emb|CAG39617.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|295128921|gb|EFG58551.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus EMRSA16]
          Length = 327

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEGLIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|253731202|ref|ZP_04865367.1| possible diphosphomevalonate decarboxylase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
 gi|253724943|gb|EES93672.1| possible diphosphomevalonate decarboxylase [Staphylococcus aureus
           subsp. aureus USA300_TCH959]
          Length = 327

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 180/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DL   K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLTEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|257424709|ref|ZP_05601136.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257272279|gb|EEV04402.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 55/2053]
          Length = 327

 Score =  339 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K  I D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAVIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|54292590|gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
          Length = 430

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 104/354 (29%), Positives = 169/354 (47%), Gaps = 26/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNG 80
            +A  P+NIA+ KYWGKRD KL LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 15  VTARAPTNIAVIKYWGKRDEKLILPINDSISVTLDPDHLSATTTVAVSPSFSSDRMWLNG 74

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           +++S     ++   +                      +  ++  I + NN PT AGLASS
Sbjct: 75  KEVSLGGERYQNCLREIRSRGRDVVDEKSGTLIKKEDWQTLHLHIASHNNFPTAAGLASS 134

Query: 126 ASGFAALTLALFRIYSIPEKS-ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           A+GFA L  AL ++  I E+    LS +AR GSGSACRS Y GF +W  G +++G DS A
Sbjct: 135 AAGFACLVYALAKLMDIEERYAGELSAIARQGSGSACRSLYGGFVKWDMGKERDGSDSIA 194

Query: 185 VPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQA 241
           V       W +L I +  +  R+K+  S   M  +   S        + +   +  +++A
Sbjct: 195 VQLATEEHWEELVILVAVVSSRQKETSSTTGMRESVETSELLHHRAQEVVPKRIVQMQEA 254

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFT 299
           I + DF     +   ++ + HA  + ASPP+ Y    + + +  +  W+  + +  + +T
Sbjct: 255 IANHDFASFARITCVDSNQFHAVCLDASPPIFYMNDTSHRIINCIEKWNRFEGTPQVSYT 314

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGI 353
            DAGPN  +    +    +      +    P DS    S+          E+G+
Sbjct: 315 FDAGPNAVICAPSRKVAGLL--LQRLLYYFPPDSSKELSSYVIGDTSILGEIGL 366


>gi|46137817|ref|XP_390600.1| hypothetical protein FG10424.1 [Gibberella zeae PH-1]
          Length = 382

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 107/325 (32%), Positives = 161/325 (49%), Gaps = 20/325 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   +  D D + 
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDAKLNLPTNSSLSVTLSQDDLRTLTTASCSSTFTDGDSLT 66

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +     R           + S     I + NN PT AGLASSA
Sbjct: 67  LNGESSDISGARTQACFRELRSRRAALEQADSSLPKLSSYPLKIVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAAL  A+  +Y +P+    LS +AR GSGSACRS + G+  W  G  ++G DS A  
Sbjct: 127 AGFAALVQAIAFLYELPDSPSDLSLIARQGSGSACRSLFGGYVAWRMGEKEDGSDSKADL 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           V   + WP++R  +L     +K + S   M+ T   S  F +     +  ++A +++AI 
Sbjct: 187 VAPASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFKERITNVVPANMALMEEAIK 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW--DARQQSIPIYFTLD 301
           D+DF K  EV  + +   HAT     PP+ Y    +   +  V   + +       +T D
Sbjct: 247 DKDFPKFAEVTMRESNSFHATCADTYPPIFYMNDISRAAIRAVECINEKVGRTVAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEIT 326
           AGPN  + +  K  + I   F +  
Sbjct: 307 AGPNCVIYYEEKDADIIVGAFYQAL 331


>gi|326432730|gb|EGD78300.1| diphosphomevalonate decarboxylase [Salpingoeca sp. ATCC 50818]
          Length = 400

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 101/330 (30%), Positives = 160/330 (48%), Gaps = 21/330 (6%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS 71
            +       +++   P NIA+ KYWGKRD+KL LP+N+SLS +L    L   T +    S
Sbjct: 3   AKRAKTGVVRATTTAPVNIAVIKYWGKRDTKLLLPINSSLSGTLDQEQLHARTTVAASSS 62

Query: 72  -DADCIILNGQKISSQSSFFKKTTQFC-------DLFRQFSKVYFLIETSNNIPTKAGLA 123
            +AD I LNG++    +   +             D        +  I + NN PT AGLA
Sbjct: 63  FEADEIWLNGKQEDISNQRLQNVLGAVRALAAKKDPEHPLKDAHIKIASVNNFPTAAGLA 122

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+G+A L  AL  ++ + +  + L+ +AR+GSGSACRS   GF  W  GT  +G DS 
Sbjct: 123 SSAAGYACLVAALAELFGVQD--QELTAIARVGSGSACRSLMGGFVRWEKGTRDDGADSL 180

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
           A  V   + WPD+++ +L +   +K + S   M+ T   S       +  +   +  I++
Sbjct: 181 ASQVVPESHWPDMQVLILVVNAGKKGVSSTSGMQSTVKTSALINHRAEVVVPQRMKDIEK 240

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYF 298
           AI D+DF   G +  +++ + HAT +   PP+ Y    + Q ++ +         I   +
Sbjct: 241 AIQDRDFQTFGRITMQDSNQFHATCLDTYPPIFYMNDVSRQIVQILTQYNDAAGEIRAAY 300

Query: 299 TLDAGPNLKLLFTHKIEETIK----QFFPE 324
           T DAGPN  +    +  + I      +FP 
Sbjct: 301 TYDAGPNCVIYCLKQHVQEILSLVCHYFPS 330


>gi|329729707|gb|EGG66108.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 327

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 180/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++P   Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPSFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|323339819|ref|ZP_08080088.1| diphosphomevalonate decarboxylase [Lactobacillus ruminis ATCC
           25644]
 gi|323092692|gb|EFZ35295.1| diphosphomevalonate decarboxylase [Lactobacillus ruminis ATCC
           25644]
          Length = 319

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 116/321 (36%), Positives = 178/321 (55%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D +L +P+N S+SL+L H  T T +    +   D   L+G+
Sbjct: 2   KKTARAHTNIALVKYWGKADEELIIPMNGSVSLTLDHFYTDTTVEFDPALTEDVFCLDGK 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
                     K  +F +L R  +K   +  I++ N++PT AGLASSAS +AAL L+    
Sbjct: 62  -----QKHDPKVAKFMNLVRNLAKKETFARIDSINHVPTAAGLASSASAYAALALSATSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS + GF EW  GTD     +  +     W ++ +  +
Sbjct: 117 AGLNLTRKDLSRLARRGSGSATRSIFGGFVEWHKGTDDLTSFAEPIEEETDW-EICMIAI 175

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I   EKKI SR  M+     SP++ +W +    DL  +KQAI ++DF  LGEV+E +A+
Sbjct: 176 VINGHEKKISSRHGMQQVVKTSPYYHEWVKTAEEDLKLVKQAIKNRDFSLLGEVSEASAM 235

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE---- 315
           KMHA  ++A P   Y+  E+I  M+++ + R Q IP Y+T+DAGPN+K++   +      
Sbjct: 236 KMHALNMSAKPHFSYFMPESILAMQKIEELRSQGIPCYYTMDAGPNVKVICEKQNVAFII 295

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           + + +FF +  ++     P  
Sbjct: 296 DELSKFFAKENLLVANPGPGA 316


>gi|257418497|ref|ZP_05595491.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T11]
 gi|257160325|gb|EEU90285.1| diphosphomevalonate decarboxylase [Enterococcus faecalis T11]
          Length = 331

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 176/327 (53%), Gaps = 11/327 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
              A   +NIAL KYWGK + +  LP+N+SLSL+L    T T +        D  IL+G 
Sbjct: 3   SGKARAHTNIALIKYWGKANEEYILPMNSSLSLTLDAFYTETTVIFDAHYSEDVFILDGI 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             + + +  KK  +F +L RQ +    +  +E+ N +PT AGLASSASG AAL  A    
Sbjct: 63  LQNEKQT--KKVKEFLNLVRQQADCTWFAKVESQNFVPTAAGLASSASGLAALAGACNVA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +   ++ LSR+AR GSGSACRS + GF +W  G       +  +P NN   +L +  +
Sbjct: 121 LGLNLSAKDLSRLARRGSGSACRSIFGGFAQWNKGHSDETSFAENIPANNWENELAMLFI 180

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I D EK + SR+ M+ T   S F+  W   +  DL+ + +AI  +DF +LGE+ E N L
Sbjct: 181 LINDGEKDVSSRDGMKRTVETSSFYQGWLDNVEKDLSQVHEAIKTKDFPRLGEIIEANGL 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MH T + A PP  YW   ++Q M  V  AR + IP YFT+DAGPN+K+L   K  E +K
Sbjct: 241 RMHGTTLGAIPPFTYWSPGSLQAMALVRQARAKGIPCYFTMDAGPNVKVLVEKKNLEALK 300

Query: 320 QFF------PEITIIDPLDSPDLWSTK 340
            F        ++         +L+ TK
Sbjct: 301 TFLSEHFSKEQLVPAFAGPGIELFETK 327


>gi|300767358|ref|ZP_07077270.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300495177|gb|EFK30333.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 336

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 124/332 (37%), Positives = 181/332 (54%), Gaps = 10/332 (3%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADC 75
              I +  +A   +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D 
Sbjct: 8   GKDIVKTVTAKAHTNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQ 67

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALT 133
           I  N Q + +  S   + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL 
Sbjct: 68  IYFNHQHLPTGKS--ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALA 125

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD 193
            A  R   +   +  LSR+AR GSGSA RS + GF EW  G D     +  +     W D
Sbjct: 126 GAASRAAGLQLDAADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-D 184

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           +++  + +   +K I S + M      SP++  W     TDL  ++QAI D+D   +G++
Sbjct: 185 IQMIAVVLKATKKPISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQI 244

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           AE NA++MHA  ++A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +
Sbjct: 245 AETNAMRMHALNLSAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQ 304

Query: 314 IEETI----KQFFPEITIIDPLDSPDLWSTKD 341
             +TI    +Q F    +I     P +  T+ 
Sbjct: 305 DTDTIMTGLQQHFDADQLIVAKPGPGITITEK 336


>gi|116871434|ref|YP_848215.1| mevalonate diphosphate decarboxylase [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|116740312|emb|CAK19430.1| mevalonate diphosphate decarboxylase [Listeria welshimeri serovar
           6b str. SLCC5334]
          Length = 323

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 125/326 (38%), Positives = 189/326 (57%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +     S  D  ILNG+
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDKNSAQDTFILNGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +    +I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGITSKAIITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFA+PF N+  D + + +
Sbjct: 117 AGRDDTKEYISRLARFGSGSASRSVFGDFVIWEKGQQPDGNDSFAIPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +K+AI+++DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKKAILNEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
            +    +   ++      +     D 
Sbjct: 297 AEKLSGLAKNVLICHAGKEASVISDE 322


>gi|261207165|ref|ZP_05921854.1| mevalonate diphosphate decarboxylase [Enterococcus faecium TC 6]
 gi|289565286|ref|ZP_06445737.1| diphosphomevalonate decarboxylase [Enterococcus faecium D344SRF]
 gi|294615073|ref|ZP_06694959.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1636]
 gi|9937394|gb|AAG02446.1|AF290095_2 mevalonate diphosphate decarboxylase [Enterococcus faecium]
 gi|260078793|gb|EEW66495.1| mevalonate diphosphate decarboxylase [Enterococcus faecium TC 6]
 gi|289162942|gb|EFD10791.1| diphosphomevalonate decarboxylase [Enterococcus faecium D344SRF]
 gi|291592015|gb|EFF23638.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1636]
          Length = 325

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 180/322 (55%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 VLINDQKKEVSSRNGMRRTVETSNFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW   +++ M+ V   R+Q IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPNSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|47093021|ref|ZP_00230800.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 4b
           H7858]
 gi|47018589|gb|EAL09343.1| diphosphomevalonate decarboxylase [Listeria monocytogenes str. 4b
           H7858]
          Length = 339

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 127/331 (38%), Positives = 189/331 (57%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++   D  
Sbjct: 13  EKVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEQKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   +
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERE 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  +      +   ++      +     D 
Sbjct: 308 NENIVADKLSGLAKNVLICHAGKEASVVSDE 338


>gi|69246578|ref|ZP_00604008.1| Diphosphomevalonate decarboxylase [Enterococcus faecium DO]
 gi|257878884|ref|ZP_05658537.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,230,933]
 gi|257881520|ref|ZP_05661173.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,502]
 gi|257885792|ref|ZP_05665445.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,501]
 gi|257890742|ref|ZP_05670395.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,410]
 gi|258615044|ref|ZP_05712814.1| mevalonate diphosphate decarboxylase [Enterococcus faecium DO]
 gi|293560305|ref|ZP_06676802.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1162]
 gi|293567762|ref|ZP_06679103.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1071]
 gi|294620918|ref|ZP_06700119.1| diphosphomevalonate decarboxylase [Enterococcus faecium U0317]
 gi|314938976|ref|ZP_07846241.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a04]
 gi|314943473|ref|ZP_07850240.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133C]
 gi|314948234|ref|ZP_07851628.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0082]
 gi|314951594|ref|ZP_07854640.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133A]
 gi|314991543|ref|ZP_07857019.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133B]
 gi|314994876|ref|ZP_07860003.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a01]
 gi|68195186|gb|EAN09642.1| Diphosphomevalonate decarboxylase [Enterococcus faecium DO]
 gi|257813112|gb|EEV41870.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,230,933]
 gi|257817178|gb|EEV44506.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,502]
 gi|257821648|gb|EEV48778.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,501]
 gi|257827102|gb|EEV53728.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,410]
 gi|291589347|gb|EFF21154.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1071]
 gi|291599529|gb|EFF30545.1| diphosphomevalonate decarboxylase [Enterococcus faecium U0317]
 gi|291605755|gb|EFF35192.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1162]
 gi|313590858|gb|EFR69703.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a01]
 gi|313593827|gb|EFR72672.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133B]
 gi|313596288|gb|EFR75133.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133A]
 gi|313597845|gb|EFR76690.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133C]
 gi|313641685|gb|EFS06265.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0133a04]
 gi|313645367|gb|EFS09947.1| diphosphomevalonate decarboxylase [Enterococcus faecium TX0082]
          Length = 325

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 181/322 (56%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 VLINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|289551605|ref|YP_003472509.1| Diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659059|ref|ZP_07911925.1| diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           M23590]
 gi|289181136|gb|ADC88381.1| Diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495870|gb|EFU84199.1| diphosphomevalonate decarboxylase [Staphylococcus lugdunensis
           M23590]
          Length = 327

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 183/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIA+ KYWGK+D  L +P+NNSLS++L    T T +T   S ++D +ILNG
Sbjct: 3   KSGKARAHTNIAVIKYWGKKDEALIIPMNNSLSVTLERFYTETQVTFNHSYNSDQLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           + +S+  +  +K  +F D+ R  + +  + LIE++N++PT AGLASSAS +AAL  A   
Sbjct: 63  EHVSATEN--QKIQRFMDIVRAKAGITMHALIESTNHVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSA RS + GF EW  G D     +  +   +   DL +  
Sbjct: 121 ALELQMTDKDLSRLARRGSGSASRSIFGGFVEWHKGYDDLTSYAEQIDAKDWEKDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I  + KK+ SR  M +T+  S F+  W   +  DLA  K AI  +DF + GE  E N 
Sbjct: 181 IVINKQSKKVSSRAGMSLTKETSRFYQYWLDYVEQDLADAKAAIKTKDFQRFGETIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y   E+   ME V   R+  IP YFT+DAGPN+K++   K  + +
Sbjct: 241 LRMHATNLGAQPPFTYLVPESYLAMEIVHQCRENGIPCYFTMDAGPNVKVIVEKKNLQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           +  F E      + S D+ S+   + +
Sbjct: 301 QSAFEETFETSQIMSSDIISSGVEIIK 327


>gi|260558443|ref|ZP_05830639.1| mevalonate diphosphate decarboxylase [Enterococcus faecium C68]
 gi|260075617|gb|EEW63923.1| mevalonate diphosphate decarboxylase [Enterococcus faecium C68]
          Length = 325

 Score =  338 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 181/322 (56%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 VLINDQKKEVSSRNGMRRTVETSNFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|282903182|ref|ZP_06311073.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282596137|gb|EFC01098.1| diphosphomevalonate decarboxylase [Staphylococcus aureus subsp.
           aureus C160]
          Length = 327

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G +     +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYNDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK  SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKAPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|293556924|ref|ZP_06675485.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1039]
 gi|294617089|ref|ZP_06696756.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1679]
 gi|291596647|gb|EFF27873.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1679]
 gi|291601008|gb|EFF31299.1| diphosphomevalonate decarboxylase [Enterococcus faecium E1039]
          Length = 325

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 128/322 (39%), Positives = 181/322 (56%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++ +L LP+NNSLSL+L    T T +   DS   D   L+G
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDAFYTETEVIFSDSYMVDEFYLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGLSLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 VLINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  ++++ M+ V   R++ IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKKGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|258611417|ref|ZP_05711501.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N3-165]
 gi|258599813|gb|EEW13138.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N3-165]
          Length = 339

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 127/331 (38%), Positives = 186/331 (56%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  
Sbjct: 13  EKVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFAVDKFYTKTTVEWDEKLTQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEQKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQAI+D+DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFKNWVSAAEIDLEEMKQAILDEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++    
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERA 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  + +    +   ++      +     D 
Sbjct: 308 NENIVAEKLSGLAKNVLICHAGKEASVVSDE 338


>gi|229824272|ref|ZP_04450341.1| hypothetical protein GCWU000282_01577 [Catonella morbi ATCC 51271]
 gi|229786245|gb|EEP22359.1| hypothetical protein GCWU000282_01577 [Catonella morbi ATCC 51271]
          Length = 333

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 125/331 (37%), Positives = 184/331 (55%), Gaps = 12/331 (3%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DS 71
           + + N +    ++    +NIAL KYWGKRD  L LP+ +SLSL+L    T T +T     
Sbjct: 1   MIQPN-QPKGSATYRAHTNIALIKYWGKRDQALFLPVTSSLSLTLDAFYTDTQVTFDTQL 59

Query: 72  DADCIILNGQKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGF 129
             D  IL+GQ+  +      K + F D FR F+      L+ ++N++PT AGLASSAS +
Sbjct: 60  AHDRFILDGQEQETSQ--VAKVSAFLDRFRAFAQTDCRALVTSTNHVPTAAGLASSASAY 117

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           AAL  A      +      LS +AR GSGSA RS + GF  W  G  ++   S+A PF  
Sbjct: 118 AALACATNAALGLDLSQRQLSILARQGSGSASRSLFGGFVIWHAGQGEDSDSSYAEPFEA 177

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
              DL + ++ +    KKI SR+ M +T   SPF+  W  +++ DLA I+ AI+  D   
Sbjct: 178 AEWDLAMLVVMVNKGTKKISSRQGMALTMETSPFYALWPDEVAKDLAAIQPAILAHDLAS 237

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLL 309
           +G++AE NA+KMHATMIAA+P   YW+ ++++ M+ V   RQ+    YFT+DAGPN+K+L
Sbjct: 238 VGQIAEHNAMKMHATMIAANPSFSYWEADSLKAMDLVRQLRQEGFTAYFTMDAGPNVKVL 297

Query: 310 FTHKIEETIKQFF------PEITIIDPLDSP 334
                 E I+  F       ++ +  P  +P
Sbjct: 298 CPASQAEAIRDRFMTEFDSKQLAVAYPGPAP 328


>gi|323439454|gb|EGA97176.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus O11]
          Length = 327

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 124/327 (37%), Positives = 181/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   LNG
Sbjct: 3   KSGKARTHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFWLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|16799090|ref|NP_469358.1| hypothetical protein lin0011 [Listeria innocua Clip11262]
 gi|16412432|emb|CAC95244.1| lin0011 [Listeria innocua Clip11262]
          Length = 339

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 126/331 (38%), Positives = 189/331 (57%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++   D  
Sbjct: 13  EKVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN ++ +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEQKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+++DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILEEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q  +++ M+ V + R+  IP YFT+DAGPN+K++   +
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPLSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERE 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  + +    +   ++      +     D 
Sbjct: 308 NENIVAEKLSGLAKNVLICHAGKEASVISDE 338


>gi|6822071|emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis
           thaliana]
          Length = 413

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 102/354 (28%), Positives = 167/354 (47%), Gaps = 31/354 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
            +A  P+NIA+ KYWGKRD    LP+N+S+S++L   HL T+T + V    D D + LNG
Sbjct: 10  VTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNG 69

Query: 81  QKISSQSSFFKKTTQFCD---------------LFRQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS   S ++   +                    + + K+   I + NN PT AGLASS
Sbjct: 70  KEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASS 129

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS + GF +W  G+ ++G DS AV
Sbjct: 130 AAGFACLVFSLAKLMNVDEDPSHLSAIARQGSGSACRSLFGGFVKWTMGSKEDGSDSVAV 189

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +        +  S   M  +   S        + +   +  +++AI
Sbjct: 190 QLADEKHWDDLVIIIAV------ETSSTSGMRESVETSLLLQHRAKEVVPKRILQMEEAI 243

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTL 300
            ++DF    ++   ++ + HA  +  SPP+ Y    + + +  V  W+  + +  + +T 
Sbjct: 244 KNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTF 303

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+   +  +   Q    +    P  S     +          E G+ 
Sbjct: 304 DAGPNAVLI--ARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLD 355


>gi|195026352|ref|XP_001986237.1| GH20637 [Drosophila grimshawi]
 gi|193902237|gb|EDW01104.1| GH20637 [Drosophila grimshawi]
          Length = 393

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 99/331 (29%), Positives = 160/331 (48%), Gaps = 25/331 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             ++   P N+AL KYWGKR+ +L LP+N+S+S++L    +   T +   +S   + + L
Sbjct: 2   FTATCVAPVNMALVKYWGKRNEELILPINDSISMTLDANEMCAKTTVAASESFKENRMWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFS-----------KVYFLIETSNNIPTKAGLASSAS 127
           NG +   Q++   +  +  D  ++ +                I + NN PT AGLASSA+
Sbjct: 62  NGDEQPFQAN--ARLQRCLDGVQRLALAHGGAHRFPLSWKVHIASHNNFPTAAGLASSAA 119

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           G+A L   L R+Y +P   E L+ +AR GSGSACRS Y GF +W  G+  +G DS AV  
Sbjct: 120 GYACLVYTLARLYDVPLD-EQLTTIARQGSGSACRSLYGGFVQWQRGSSADGSDSIAVQL 178

Query: 188 NN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
           +    WP++ + +L + D  KK GS   M+     S        Q +      +K AI  
Sbjct: 179 SPATHWPNMHMLILVVNDARKKTGSTSGMQRAVETSALIQHRATQVVPQRSKELKVAIEK 238

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDA 302
           +DF     +  K + ++HA  +   PP +Y    +   +  V +  ++  S+ + +T DA
Sbjct: 239 RDFNAFATITMKESNQLHAIALDTFPPCVYMNDVSHSIVNFVHEYNEEAGSLHVAYTFDA 298

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           GPN  L    +    +      I +  P D+
Sbjct: 299 GPNGCLYVLDEH---VPHLLAAIQLAFPNDA 326


>gi|213964930|ref|ZP_03393129.1| diphosphomevalonate decarboxylase [Corynebacterium amycolatum SK46]
 gi|213952466|gb|EEB63849.1| diphosphomevalonate decarboxylase [Corynebacterium amycolatum SK46]
          Length = 325

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 128/328 (39%), Positives = 180/328 (54%), Gaps = 13/328 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCII 77
              ++A    NIAL KYWGKRD  + LP   SLSL+LG   T T +++ID     AD   
Sbjct: 2   TTTATAVAHPNIALIKYWGKRDEAVQLPATGSLSLTLGIAPTTTTVSLIDDPSVTADSGT 61

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LNGQ++  +     +  +F DL R+ +    +  + ++N IPT AGLASSASGF AL LA
Sbjct: 62  LNGQEMVGKD--LSRVQKFLDLVRERAGSTSFAEVNSTNEIPTGAGLASSASGFGALALA 119

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             + Y +    E LS +AR GSGSACRS + G  EW+ G   +   S AV   +   DL 
Sbjct: 120 AAKAYGLDYTPEQLSALARRGSGSACRSIFGGLVEWLPG--DDDASSHAVALPDSGLDLS 177

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           + +  +    KKI SR AM  T   SPFF  W +Q+  D+  +K AI   DF  +GE+AE
Sbjct: 178 LVVAVLAPGRKKIDSRAAMRRTVETSPFFPAWVEQVPRDIEDMKAAIAAADFTAVGELAE 237

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
            NA++MHATM+ A PP+ YW  +++  ++ V   R +    Y T+DAGPN+K+L      
Sbjct: 238 ANAMRMHATMLGALPPVRYWNPDSVAALDLVATLRDEGTECYATMDAGPNVKVLCRSGDA 297

Query: 316 ETI----KQFFPEITIIDPLDSPDLWST 339
           ETI    +  F +I ++     P  +  
Sbjct: 298 ETIADRFRAEFEDIDVLVSGSGPGAYLV 325


>gi|224475737|ref|YP_002633343.1| mevalonate diphosphate decarboxylase [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420344|emb|CAL27158.1| mevalonate diphosphate decarboxylase [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 331

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 121/326 (37%), Positives = 179/326 (54%), Gaps = 9/326 (2%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKIS 84
           A   +NIAL KYWGK D  L +P+NNS+SL+L    T T +T     + D   LNG+K +
Sbjct: 7   ARAHTNIALIKYWGKADETLIIPMNNSISLTLDKFYTETRVTFDPTFEEDTFFLNGEKAN 66

Query: 85  SQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +  +K + + D+ R+ +  +    I+++N +PT AGLASSAS FAAL  A      +
Sbjct: 67  EKET--QKISAYLDIVRKQAGTHTKASIDSTNFVPTAAGLASSASAFAALAAACNEALEM 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+AR GSGSACRS + GF EW  G D     S  +   +   +L +  + I 
Sbjct: 125 RLSDKDLSRLARRGSGSACRSIFGGFAEWEKGHDDASSYSHPIDAEHWEDELSMIFVVIN 184

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           ++ KK+ SR  M +TR+ S F+  W  ++  D+   K AI D+DF +LGEV E N L+MH
Sbjct: 185 NKSKKVKSRAGMSLTRNTSRFYQYWLDRVEADIEEAKAAIKDKDFKRLGEVFEANGLRMH 244

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ-- 320
           AT + A PP  Y   ++ + M  V D R+  IP YFT+DAGPN+K+L   K ++ +    
Sbjct: 245 ATNLGAEPPFTYLVSDSYEAMSLVHDCREAGIPAYFTMDAGPNVKVLVQKKDQQAVIDKL 304

Query: 321 --FFPEITIIDPLDSPDLWSTKDSLS 344
             +F    II       +    +  +
Sbjct: 305 TSYFDPEQIIASNIGTGVEILNEEDA 330


>gi|293596254|ref|ZP_06684161.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J1-194]
 gi|293596797|ref|ZP_06684343.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HPB2262]
 gi|293582403|gb|EFF94435.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HPB2262]
 gi|293594007|gb|EFG01768.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           J1-194]
          Length = 339

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 128/331 (38%), Positives = 187/331 (56%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    +   D  
Sbjct: 13  EKVVMKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN +  +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEHKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   +
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERE 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  +      +   ++      +     D 
Sbjct: 308 NENIVADKLSGLAKNVLICHAGKEASVVSDE 338


>gi|228475116|ref|ZP_04059843.1| diphosphomevalonate decarboxylase [Staphylococcus hominis SK119]
 gi|228270880|gb|EEK12277.1| diphosphomevalonate decarboxylase [Staphylococcus hominis SK119]
          Length = 327

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 127/328 (38%), Positives = 185/328 (56%), Gaps = 5/328 (1%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
            +   A   +NIAL KYWGK D  L +P+NNSLS++L    T TH+T  DS   D +ILN
Sbjct: 2   KKSGKARAHTNIALIKYWGKADENLIIPMNNSLSVTLERFYTETHVTFDDSLTEDQLILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + ++++ S   K  ++ D+ R+ + +  Y LIE+ N +PT AGLASSAS +AAL  A  
Sbjct: 62  KEAVNAKES--AKIQRYMDMIRKEAGISTYALIESDNFVPTAAGLASSASAYAALAGACN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
               +    + LSR+AR GSGSA RS Y GF EW  G D     +  +  +    DL + 
Sbjct: 120 EALDLNLSDKDLSRLARRGSGSASRSIYGGFAEWEKGYDDKTSYAHQIESDGFENDLAMI 179

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I ++ KK+ SR  M +TR  S F+  W   +  DL  +KQAI  +DF ++GEV E N
Sbjct: 180 FVVINNKSKKVSSRSGMSLTRDTSRFYQYWLDHVEEDLKVVKQAIAQKDFKRMGEVIEAN 239

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
            L+MHAT + A PP  Y   E+ + M  V + R+  +P YFT+DAGPN+K+L   K ++ 
Sbjct: 240 GLRMHATNLGAQPPFTYLVPESYEAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKHQQA 299

Query: 318 IKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           I   F E+   D + + D+      + +
Sbjct: 300 IVNQFLEVFNKDQIITSDITHAGVEIIK 327


>gi|254556624|ref|YP_003063041.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum JDM1]
 gi|308180570|ref|YP_003924698.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|254045551|gb|ACT62344.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum JDM1]
 gi|308046061|gb|ADN98604.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 325

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 180/327 (55%), Gaps = 10/327 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +  +A   +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D I  N 
Sbjct: 2   KTVTAKAHTNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQIYFNH 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           Q + +  S   + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL  A  R
Sbjct: 62  QHLPTGKS--ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALAGAASR 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +   +  LSR+AR GSGSA RS + GF EW  G D     +  +     W D+++  
Sbjct: 120 AAGLQLDAADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-DIQMIA 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + +   +K I S + M      SP++  W     TDL  ++QAI D+D   +G++AE NA
Sbjct: 179 VVLKATKKPISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQIAETNA 238

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++MHA  ++A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +  +TI
Sbjct: 239 MRMHALNLSAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQDTDTI 298

Query: 319 ----KQFFPEITIIDPLDSPDLWSTKD 341
               +Q F    +I     P +  T+ 
Sbjct: 299 MTGLQQHFDADQLIVAKPGPGITITEK 325


>gi|28378415|ref|NP_785307.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum WCFS1]
 gi|28271251|emb|CAD64155.1| diphosphomevalonate decarboxylase [Lactobacillus plantarum WCFS1]
          Length = 325

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 180/327 (55%), Gaps = 10/327 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +  +A   +NIAL KYWGK+D+ L LP N S+SL+L H  T T +T  +  D D I  N 
Sbjct: 2   KTVTAKAHTNIALVKYWGKKDAALMLPQNGSISLTLDHFYTQTSVTFDEHLDTDQIYFNH 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           Q + +  S   + +QF DL RQ S    Y  ++T N++PT AGLASSASGFAAL  A  R
Sbjct: 62  QHLPTGKS--ARISQFLDLIRQRSGQTNYATVKTENHVPTSAGLASSASGFAALAGAASR 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +   +  LSR+AR GSGSA RS + GF EW  G D     +  +     W D+++  
Sbjct: 120 AAGLQLDAADLSRLARRGSGSATRSIFGGFVEWHAGHDDQSSYAEVLQDPVDW-DIQMIA 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + +   +K I S + M      SP++  W     TDL  ++QAI D+D   +G++AE NA
Sbjct: 179 VVLKATKKTISSTDGMARVVATSPYYPAWITTAETDLKRMRQAIADRDLTTVGQIAETNA 238

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           ++MHA  ++A P   Y+  +T+  ++ V D R   I  Y+TLDAGPN+K++   +  +TI
Sbjct: 239 MRMHALNLSAEPAFNYFTADTLTAIQAVNDLRSHGINCYYTLDAGPNVKIICAGQDTDTI 298

Query: 319 ----KQFFPEITIIDPLDSPDLWSTKD 341
               +Q F    +I     P +  T+ 
Sbjct: 299 MTGLQQHFDADQLIVAKPGPGITITEK 325


>gi|299820831|ref|ZP_07052720.1| diphosphomevalonate decarboxylase [Listeria grayi DSM 20601]
 gi|299817852|gb|EFI85087.1| diphosphomevalonate decarboxylase [Listeria grayi DSM 20601]
          Length = 323

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 127/320 (39%), Positives = 183/320 (57%), Gaps = 11/320 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K+ A   +N+AL KYWGKRD  L LP N+SLSL++    T T +   +S   D  +LNG+
Sbjct: 2   KAIARAHTNVALIKYWGKRDETLMLPANSSLSLTVDQFYTTTALEWDESLQKDSFVLNGK 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           ++        K ++F  + RQ  ++  +  I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  EVED-----AKVSRFLSIMRQQFQLTSFARISSENHVPTAAGLASSASAFAALALAGSAA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQW-PDLRIGL 198
               +  + LS++ARLGSGSA RS Y     W  G   +G DSF VPF ++   DL I +
Sbjct: 117 AGRNDDRKYLSKLARLGSGSASRSLYGDLVIWEKGNRDDGEDSFGVPFTSELTKDLAIVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D  KK+ SR  M+ T   SPFF  W Q+   DL  +K+A    DFI +GE+ E NA
Sbjct: 177 AVVSDEVKKVPSRLGMQSTVATSPFFPTWVQEAEKDLVAMKEAFAAADFITIGEITEHNA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A+PP  Y+Q +++Q M++V + R Q I  YFT+DAGPN+K+L   K E+ +
Sbjct: 237 MKMHATTLGANPPFTYFQPKSLQVMDKVRELRLQGIAAYFTMDAGPNVKVLCERKNEKLV 296

Query: 319 KQFFPEI--TIIDPLDSPDL 336
                ++   +       + 
Sbjct: 297 ASELTKVVKDVFICHAGEEA 316


>gi|332376218|gb|AEE63249.1| unknown [Dendroctonus ponderosae]
          Length = 386

 Score =  336 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 102/322 (31%), Positives = 153/322 (47%), Gaps = 18/322 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCIILNG 80
            +   P NIA+ KYWGKRD  L LP+N+S+S SL    +   T I        +   LNG
Sbjct: 4   VTCVAPVNIAVIKYWGKRDENLILPINDSISASLSTDIMCAKTTIMASPLLKENKFWLNG 63

Query: 81  QKISSQSSFF----KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           ++ +  S  F    K     CD           I + NN PT AGLASSA+G+A L  AL
Sbjct: 64  REQTFDSPRFSNCIKAIRARCDETLPQFNWKISICSENNFPTAAGLASSAAGYACLVHAL 123

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDL 194
            ++Y I      +S +AR GSGSACRS Y G+ +W  G    G DS A  +   + WP++
Sbjct: 124 AQLYEIK---GEISDIARQGSGSACRSIYGGWVQWHKGDLPTGADSIATQIAPADHWPEM 180

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEV 253
           RI +L + D  KK  S   M+ T   S       +  ++     +K+AI D+D+    E+
Sbjct: 181 RIIVLVVNDCRKKYSSTSGMKTTTETSTLVKFRAESVVNQRAKAMKKAIEDKDYESFAEI 240

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFT 311
             K++ +MHA  +   PP +Y    +   +  V      ++   + +T DAGPN  +   
Sbjct: 241 TMKDSNQMHAICLDTFPPCVYMNDTSHAIVNLVHSYNEYKKGQKVAYTFDAGPNACIYLL 300

Query: 312 HKIEETIKQFFPEITIIDPLDS 333
                 ++QF   +  + P  +
Sbjct: 301 QS---EVEQFISVVNHVFPKPA 319


>gi|147857960|emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
          Length = 451

 Score =  336 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 99/353 (28%), Positives = 168/353 (47%), Gaps = 36/353 (10%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNG 80
           ++A  P+NIA+ KYWGKRD  L L +N+S+S++L   HL T T + V     +D + LNG
Sbjct: 13  TTAQTPTNIAVIKYWGKRDEGLILAVNDSISVTLDPQHLCTTTTVAVSPMFQSDRMWLNG 72

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     ++   +                    + + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFA L  +L ++ ++ E    LS +AR GSGSACRS Y GF +W+ G ++NG DS AV
Sbjct: 133 AAGFACLVFSLAKLMNVQEDQGKLSAIARQGSGSACRSLYGGFVKWVMGNEENGSDSIAV 192

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W +L I +  +  R+K+  S   M  +   S        + +   +  +++AI
Sbjct: 193 QLQDEKHWDELVIIIAVVSSRQKETSSTSGMRDSVETSLLLQHRAKEVVPKRIIEMEEAI 252

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA 302
            ++DF     +   ++ + HA  +  SPP+ Y    + +              + +T DA
Sbjct: 253 KNRDFPSFARLTCXDSNQFHAVCLDTSPPIFYMNDTSHR-------------QVAYTFDA 299

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           GPN  L+   +  +        +    P  S    ++     +    ++G+ +
Sbjct: 300 GPNAVLI--ARDRKVAANLLQRLLYYFPPHSDTDLNSYVIGDKSILGDVGVEE 350


>gi|302332303|gb|ADL22496.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus subsp.
           aureus JKD6159]
          Length = 327

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 122/327 (37%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D  +LNG
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFMLNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  +
Sbjct: 63  EKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  ++   +L +  
Sbjct: 121 ALDLQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESDHFEDELAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N 
Sbjct: 181 VVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEENG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ I
Sbjct: 241 LRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQI 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                     + +   D+ +T   + +
Sbjct: 301 IDKLLTQFDNNQIIDSDIIATGIEIIE 327


>gi|217965923|ref|YP_002351601.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HCC23]
 gi|217335193|gb|ACK40987.1| diphosphomevalonate decarboxylase [Listeria monocytogenes HCC23]
 gi|307569534|emb|CAR82713.1| diphosphomevalonate decarboxylase [Listeria monocytogenes L99]
          Length = 323

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 127/326 (38%), Positives = 187/326 (57%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++   D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
                 +   ++      +     D 
Sbjct: 297 ADKLSGLAKNVLICHAGKEASVVSDE 322


>gi|46906236|ref|YP_012625.1| diphosphomevalonate decarboxylase [Listeria monocytogenes serotype
           4b str. F2365]
 gi|46879500|gb|AAT02802.1| diphosphomevalonate decarboxylase [Listeria monocytogenes serotype
           4b str. F2365]
          Length = 323

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 187/326 (57%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   ++   D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDENLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
                 +   ++      +     D 
Sbjct: 297 ADKLSGLAKNVLICHAGKEASVVSDE 322


>gi|314937085|ref|ZP_07844432.1| diphosphomevalonate decarboxylase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655704|gb|EFS19449.1| diphosphomevalonate decarboxylase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 327

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 127/328 (38%), Positives = 184/328 (56%), Gaps = 5/328 (1%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
            +   A   +NIAL KYWGK D  L +P+NNSLS++L    T TH+T  DS   D +ILN
Sbjct: 2   KKSGKARAHTNIALIKYWGKADENLIIPMNNSLSVTLERFYTETHVTFDDSLTEDQLILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + ++++ S   K  ++ D+ R+ + +  Y LIE+ N +PT AGLASSAS +AAL  A  
Sbjct: 62  KEAVNAKES--AKIQRYMDMIRKEAGISTYALIESDNFVPTAAGLASSASAYAALAGACN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
               +    + LSR+AR GSGSA RS Y GF EW  G D     +  +  +    DL + 
Sbjct: 120 EALDLNLSDKDLSRLARRGSGSASRSIYGGFAEWEKGYDDKTSYAHQIESDGFENDLAMI 179

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I ++ KK+ SR  M +TR  S F+  W   +  DL   KQAI  +DF ++GEV E N
Sbjct: 180 FVVINNKSKKVSSRSGMSLTRDTSRFYQYWLDHVEEDLKVTKQAIAQKDFKRMGEVIEAN 239

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
            L+MHAT + A PP  Y   E+ + M  V + R+  +P YFT+DAGPN+K+L   K ++ 
Sbjct: 240 GLRMHATNLGAQPPFTYLVPESYEAMRIVHECREAGLPCYFTMDAGPNVKVLIEKKHQQA 299

Query: 318 IKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           I   F E+   D + + D+      + +
Sbjct: 300 IVNQFLEVFNKDQIITSDITHAGVEIIK 327


>gi|296827024|ref|XP_002851094.1| diphosphomevalonate decarboxylase [Arthroderma otae CBS 113480]
 gi|238838648|gb|EEQ28310.1| diphosphomevalonate decarboxylase [Arthroderma otae CBS 113480]
          Length = 399

 Score =  336 bits (861), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 108/347 (31%), Positives = 167/347 (48%), Gaps = 27/347 (7%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID---- 70
             +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +       
Sbjct: 2   AEQTVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSARYPS 61

Query: 71  SDADCIILNGQKISSQSSFFK-KTTQFCDLFR-----------QFSKVYFLIETSNNIPT 118
           +D D + LN +  S Q S             R           + S     I + NN PT
Sbjct: 62  ADGDTLTLNNKPHSIQGSPRTLACLADLRSLRRQMESSNQSLPKLSAYPLRIVSENNFPT 121

Query: 119 KAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
            AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+  W  G  ++
Sbjct: 122 AAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYVAWRAGEKED 181

Query: 179 GMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDL 235
           G DS A  V   + WP++R  +L +   +K++ S E M++T   S  F    Q I    +
Sbjct: 182 GSDSIAEQVAPESHWPEMRALILVVSGAQKEVPSTEGMQLTVATSTLFPSRAQSIVPERM 241

Query: 236 AHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-RQQSI 294
             I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R    
Sbjct: 242 TAIEKSIQERNFESFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDINRAAGR 301

Query: 295 PIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
            +  +T DAGPN  + +  K  + +   F  I       + + W + 
Sbjct: 302 SVCAYTFDAGPNAVIYYLEKDTDCVLGTFKSIL----TSATEGWESS 344


>gi|295659468|ref|XP_002790292.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb01]
 gi|226281744|gb|EEH37310.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb01]
          Length = 405

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 109/341 (31%), Positives = 161/341 (47%), Gaps = 27/341 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   S      D 
Sbjct: 8   YRASATAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPSDAGDT 67

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LN +  S Q S              ++         + S     I + NN PT AGLA
Sbjct: 68  LTLNSEPHSIQDSKRTLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAGLA 127

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+DS 
Sbjct: 128 SSAAGFAALVCAIANLYELPQSPRDLSRIARQGSGSACRSMMGGYVAWRAGVLEDGIDSL 187

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
           A  V   + WPD+R  +L + D +K++ S + M+ T   S  F    +  +   +  I+ 
Sbjct: 188 AEEVAPASHWPDMRALILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARMTAIEA 247

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI +++F    E+  +++   HAT +   PP  Y    +   +  V D  +        +
Sbjct: 248 AIQNRNFPSFAEITMRDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETICAY 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           T DAGPN  + +  K  E +   F  I           W  
Sbjct: 308 TFDAGPNAVIYYLEKESERVIGTFKSIL----SAETRGWDG 344


>gi|20429112|emb|CAD24423.1| mevalonate diphosphate decarboxylase [Paracoccus
           zeaxanthinifaciens]
          Length = 332

 Score =  336 bits (861), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 178/311 (57%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
            + A+ PSNIAL KYWGKRD+  NLPLN+S+S+SL + G+ T +    +  D +  NG  
Sbjct: 21  AAEAYAPSNIALSKYWGKRDAARNLPLNSSVSISLANWGSHTRVEGSGTGHDEVHHNGTL 80

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +F ++   F DLFR    +   I T N+IPT AGLASSASGFAALT AL   + +
Sbjct: 81  LDPGDAFARRALAFADLFRGGRHLPLRITTQNSIPTAAGLASSASGFAALTRALAGAFGL 140

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LSR+AR+GSGSA RS + GF  W  G  ++G DS  VP + +WP  RI ++ + 
Sbjct: 141 DLDDTDLSRIARIGSGSAARSIWHGFVRWNRGEAEDGHDSHGVPLDLRWPGFRIAIVAVD 200

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K   SR+ M  T   SP F  W  Q   D   I+ AI  +D   LG   E NAL MH
Sbjct: 201 KGPKPFSSRDGMNHTVETSPLFPPWPAQAEADCRVIEDAIAARDMAALGPRVEANALAMH 260

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           ATM+AA PPL Y    + Q +ER+W AR   +  + T+DAGPN+KL+F       +   F
Sbjct: 261 ATMMAARPPLCYLTGGSWQVLERLWQARADGLAAFATMDAGPNVKLIFEESSAADVLYLF 320

Query: 323 PEITIIDPLDS 333
           P+ ++I P + 
Sbjct: 321 PDASLIAPFEG 331


>gi|223042897|ref|ZP_03612945.1| diphosphomevalonate decarboxylase [Staphylococcus capitis SK14]
 gi|222443751|gb|EEE49848.1| diphosphomevalonate decarboxylase [Staphylococcus capitis SK14]
          Length = 327

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 125/327 (38%), Positives = 184/327 (56%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADESYIIPMNNSLSVTLERFYTETQVTFDASLTEDQLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +++ ++ +   K  ++ D+ R  +   ++  IE++N +PT AGLASSAS +AAL  A   
Sbjct: 63  EEVDAKET--TKIQKYMDIVRDVAATDLHAKIESNNFVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +   S+ LSR+AR GSGSA RS Y GF EW  G D     + A+  N+   DL +  
Sbjct: 121 ALQLGLSSKDLSRLARRGSGSASRSIYGGFAEWEKGHDDATSYAHAIDANDWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DLA  K+AI ++DF  LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRETSRFYQYWLDHVDQDLAETKEAIKNKDFKHLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAVVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F +      +   D+ ST   + +
Sbjct: 301 VEQFLKEFDESQIIVSDIISTGVEIIK 327


>gi|195175589|ref|XP_002028521.1| GL14496 [Drosophila persimilis]
 gi|194104348|gb|EDW26391.1| GL14496 [Drosophila persimilis]
          Length = 406

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 99/329 (30%), Positives = 158/329 (48%), Gaps = 20/329 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILN 79
             +   P NIA+ KYWGKR  +L LP+N+S+S++L    L   T IT       + + LN
Sbjct: 3   SVTCKAPVNIAIIKYWGKRHEELILPINDSISMTLGTNELCAKTTITASEKFQHNRMWLN 62

Query: 80  GQKISSQS-SFFKKTTQFCDLFRQFSK-------VYFLIETSNNIPTKAGLASSASGFAA 131
            +++  +  S   +  +        +            I + NN PT AGLASSA+G+A 
Sbjct: 63  DEELLFEEDSRLMRCLKGVQRLAHINGSQEASLCWKVHIASRNNFPTAAGLASSAAGYAC 122

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-- 189
           L  +L R+Y IP   E L+ +AR GSGSACRS + GF +W  G   +G DS A P  +  
Sbjct: 123 LVYSLARLYGIPLT-EELTTIARQGSGSACRSLFGGFVQWHRGVLDDGSDSVAEPVASAQ 181

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFI 248
            WP++ + +L + D  KK  S   M+ +   S        + +   +A++K+AI  +DF 
Sbjct: 182 HWPNMHVLILVVNDERKKTSSTTGMQRSVTTSQLIQHRVDKLVPERIANLKKAIKARDFQ 241

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNL 306
              E+  K++ + HA  +   PP +Y    +   +  V    +   ++   +T DAGPN 
Sbjct: 242 SFAEITMKDSNQFHAIALDTYPPCVYMNDVSHAIVNFVHTYNKTTGTVHAAYTFDAGPNA 301

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPD 335
            +    +    + +    I  + P DS D
Sbjct: 302 CIYVLKEN---VAKLLAAIQKVFPTDSID 327


>gi|157042753|gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii x
           Nicotiana sanderae]
          Length = 406

 Score =  335 bits (860), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 101/350 (28%), Positives = 171/350 (48%), Gaps = 25/350 (7%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQKIS 84
            P+NIA+ KYWGKRD  L L +N+S+ ++L   HL T T + V    + D + LNG++IS
Sbjct: 1   TPTNIAVIKYWGKRDEDLILAINDSIGVTLDPAHLCTTTTVAVSPAFNQDRMWLNGKEIS 60

Query: 85  SQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASSASGF 129
                ++   +                    + +  ++  I + NN PT AGLASSA+GF
Sbjct: 61  LSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIASYNNFPTAAGLASSAAGF 120

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           A L  +L ++ ++ E +  LS +AR GSGSACRS Y GF +WI G ++NG DS AV   +
Sbjct: 121 ACLVFSLAKLMNVQEDNGKLSAIARQGSGSACRSLYGGFVKWIMGKEENGSDSIAVQLVD 180

Query: 190 --QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQD 246
              W +L I +  +  R+K+  S   M  T   S        + +   +  +++AI ++D
Sbjct: 181 EKHWDELVIIIAVVSSRQKETSSTSGMRDTVETSALIEHRAKEVVPKRIVQMEEAIQNRD 240

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGP 304
           F    ++   ++ + HA  +  S P+ Y    + + +  V  W+  + +  + +T DAGP
Sbjct: 241 FPTFAQLTCADSNQFHAVSMDTSLPIFYMNDTSHRVIGCVEKWNRSEGTPQVAYTFDAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           N  L+  ++   T+      +    P +S    ++     +    + GI 
Sbjct: 301 NAVLIARNRKAATL--MLQRLLFHFPPNSDTDLNSYVIGDKSILKDAGIQ 348


>gi|314932817|ref|ZP_07840186.1| diphosphomevalonate decarboxylase [Staphylococcus caprae C87]
 gi|313654498|gb|EFS18251.1| diphosphomevalonate decarboxylase [Staphylococcus caprae C87]
          Length = 327

 Score =  335 bits (860), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 124/307 (40%), Positives = 178/307 (57%), Gaps = 6/307 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADESYIIPMNNSLSVTLERFYTETQVTFDASLTEDQLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +++ ++ +   K  ++ D+ R  +   ++  IE++N +PT AGLASSAS +AAL  A   
Sbjct: 63  EEVDAKET--TKIQKYMDIVRDVAATDLHAKIESNNFVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +   S+ LSR+AR GSGSA RS Y GF EW  G D     + A+  N+   DL +  
Sbjct: 121 ALQLGLSSKDLSRLARRGSGSASRSIYGGFAEWEKGHDDATSYAHAIDANDWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DLA  K+AI ++DF  LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRETSRFYQYWLDHVDQDLAEAKEAIKNKDFKHLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE-T 317
           L+MHAT + A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++  
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAVVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAA 300

Query: 318 IKQFFPE 324
           ++QF  E
Sbjct: 301 VEQFLKE 307


>gi|156371457|ref|XP_001628780.1| predicted protein [Nematostella vectensis]
 gi|156215765|gb|EDO36717.1| predicted protein [Nematostella vectensis]
          Length = 406

 Score =  335 bits (860), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 107/354 (30%), Positives = 161/354 (45%), Gaps = 31/354 (8%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLS--LGHLGTITHITV-IDSDADCIIL 78
            + +   P NIA+ KYWGKRD +L LPLN+SLS +  L  L T T +    D+  D + +
Sbjct: 18  FRVTVKAPINIAVIKYWGKRDEELILPLNSSLSATINLDELCTTTTVVARRDNPQDSLWI 77

Query: 79  NGQKISSQSSFFKKTTQFC------------DLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           N ++     S   +  +              + +++       I + NN PT AGLASSA
Sbjct: 78  NKREQPIAES--PRIQKCISKVRQLAKENSPERWQELRNYGLCIYSKNNFPTAAGLASSA 135

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           SG+A L LAL ++Y +      LS +AR GSGSACRS Y GF +W  G   +G DS A  
Sbjct: 136 SGYACLVLALSKLYHLDM---ELSSIARQGSGSACRSMYGGFVKWEAGCRPDGTDSIASQ 192

Query: 187 FNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAII 243
             +   W  LRI +L I D  K   S   M  +   S       Q+     + +I +AI 
Sbjct: 193 IVDEKHWSTLRILILVINDERKANPSTSGMRRSTETSELLQFRAQKCVPKRMENITKAIK 252

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLL--YWQKETIQGMERV--WDARQQSIPIYFT 299
           ++DF    E+  K++ ++HA      PP+   Y    +   ++ V  ++    +  + +T
Sbjct: 253 ERDFHTFAEITMKDSNQLHAVCQDTYPPITPPYMNSTSHLVVQLVTAYNNNHGNNKVAYT 312

Query: 300 LDAGPNLKLLFTHKIEET----IKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
            DAGPN  L             IK FFP  +    +    +  +       N+I
Sbjct: 313 FDAGPNSVLFTQEGDLPELVALIKHFFPPASGKSFVQGIPIPDSGIEKGLLNAI 366


>gi|329920253|ref|ZP_08277037.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN 1401G]
 gi|328936298|gb|EGG32746.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN 1401G]
          Length = 325

 Score =  335 bits (860), Expect = 6e-90,   Method: Composition-based stats.
 Identities = 114/323 (35%), Positives = 174/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ + 
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVD 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|258611654|ref|ZP_05711586.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           R2-503]
 gi|300763376|ref|ZP_07073374.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N1-017]
 gi|258605122|gb|EEW17730.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           R2-503]
 gi|300515653|gb|EFK42702.1| diphosphomevalonate decarboxylase [Listeria monocytogenes FSL
           N1-017]
          Length = 339

 Score =  335 bits (859), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 126/331 (38%), Positives = 187/331 (56%), Gaps = 11/331 (3%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCI 76
            K+  +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    +   D  
Sbjct: 13  EKVVMRATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTF 72

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTL 134
           ILN +  +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL L
Sbjct: 73  ILNNEHKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALAL 127

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD- 193
           A        +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D 
Sbjct: 128 AGSSAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDK 187

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           + + +  + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D++FIK+GE+
Sbjct: 188 MSLVVAVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDENFIKVGEI 247

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
            E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   +
Sbjct: 248 TERNGMKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERE 307

Query: 314 IEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
            E  +      +   ++      +     D 
Sbjct: 308 NENIVADKLSGLAKNVLICHAGKEASVVSDE 338


>gi|225680212|gb|EEH18496.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb03]
          Length = 405

 Score =  334 bits (858), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 109/341 (31%), Positives = 160/341 (46%), Gaps = 27/341 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADC 75
            ++S   P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   S      D 
Sbjct: 8   YRASVTAPVNIAVIKYWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPTDAGDT 67

Query: 76  IILNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
           + LN +  S Q S              ++         + S     I + NN PT AGLA
Sbjct: 68  LTLNSEPHSIQDSKRTLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAGLA 127

Query: 124 SSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF 183
           SSA+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+DS 
Sbjct: 128 SSAAGFAALVCAIANLYKLPQSPRELSRIARQGSGSACRSMMGGYVAWRAGVLEDGIDSL 187

Query: 184 A--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
           A  V   + WPD+R  +L + D +K++ S + M+ T   S  F    +  +   +  I+ 
Sbjct: 188 AEEVAPASHWPDMRALILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARITAIEA 247

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYF 298
           AI ++DF    E+  +++   HAT +   PP  Y    +   +  V D  +        +
Sbjct: 248 AIQNRDFPSFAEITMRDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETICAY 307

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           T DAGPN  + +  K  E +   F  I           W  
Sbjct: 308 TFDAGPNAVIYYLKKESERVIGTFKSIL----SAETRGWDG 344


>gi|325912161|ref|ZP_08174559.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 143-D]
 gi|325476111|gb|EGC79279.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 143-D]
          Length = 325

 Score =  334 bits (858), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 114/323 (35%), Positives = 175/323 (54%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMLIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|227550900|ref|ZP_03980949.1| possible diphosphomevalonate decarboxylase [Enterococcus faecium
           TX1330]
 gi|257887849|ref|ZP_05667502.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,141,733]
 gi|257896533|ref|ZP_05676186.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com12]
 gi|257899514|ref|ZP_05679167.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com15]
 gi|293379312|ref|ZP_06625458.1| diphosphomevalonate decarboxylase [Enterococcus faecium PC4.1]
 gi|293572991|ref|ZP_06683933.1| diphosphomevalonate decarboxylase [Enterococcus faecium E980]
 gi|227179998|gb|EEI60970.1| possible diphosphomevalonate decarboxylase [Enterococcus faecium
           TX1330]
 gi|257823903|gb|EEV50835.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,141,733]
 gi|257833098|gb|EEV59519.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com12]
 gi|257837426|gb|EEV62500.1| diphosphomevalonate decarboxylase [Enterococcus faecium Com15]
 gi|291606893|gb|EFF36273.1| diphosphomevalonate decarboxylase [Enterococcus faecium E980]
 gi|292642108|gb|EFF60272.1| diphosphomevalonate decarboxylase [Enterococcus faecium PC4.1]
          Length = 325

 Score =  334 bits (858), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 180/322 (55%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++  L LP+NNSLSL+L    T T +   DS  AD   L+ 
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEALILPMNNSLSLTLDAFYTETEVIFSDSYIADEFYLDD 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGISLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWEKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 ILINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|226222650|ref|YP_002756757.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes
           Clip81459]
 gi|255519790|ref|ZP_05387027.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes FSL
           J1-175]
 gi|225875112|emb|CAS03800.1| Putative mevalonate diphosphate decarboxylase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|328476152|gb|EGF46858.1| diphosphomevalonate decarboxylase [Listeria monocytogenes 220]
          Length = 323

 Score =  334 bits (858), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 127/326 (38%), Positives = 185/326 (56%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    +   D  ILN +
Sbjct: 2   KATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  HKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
                 +   ++      +     D 
Sbjct: 297 ADKLSGLAKNVLICHAGKEASVVSDE 322


>gi|257893353|ref|ZP_05673006.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,408]
 gi|257829732|gb|EEV56339.1| diphosphomevalonate decarboxylase [Enterococcus faecium 1,231,408]
          Length = 325

 Score =  334 bits (858), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 129/322 (40%), Positives = 180/322 (55%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIILNG 80
            K  A   +NIAL KYWGK++  L LP+NNSLSL+L    T T +   DS  AD   L+ 
Sbjct: 2   FKGKARAYTNIALIKYWGKKNEALILPMNNSLSLTLDAFYTETEVIFSDSYIADEFYLDD 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                +++  KK +QF DLFR+ + +     + + N +PT AGLASSASG AAL  A   
Sbjct: 62  TLQDEKAT--KKVSQFLDLFRKEAGISLKASVISQNFVPTAAGLASSASGLAALAGACNT 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +     SLSR AR GSGSACRS + GF EW  G D     +  VP ++   DL +  
Sbjct: 120 ALKLGLDDLSLSRFARRGSGSACRSIFGGFVEWDKGHDDLSSYAKPVPSDSFEDDLAMVF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I D++K++ SR  M  T   S F+  W   +  DL  +KQAI  +DF  LGE  E+N 
Sbjct: 180 ILINDQKKEVSSRNGMRRTVETSSFYQGWLDSVEGDLYQLKQAIKTKDFQLLGETMERNG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  ++++ M+ V   R+Q IP YFT+DAGPN+K+L  +     +
Sbjct: 240 LKMHGTTLAAQPPFTYWSPDSLKAMDAVRQLRKQGIPCYFTMDAGPNVKVLVENSHLSEV 299

Query: 319 KQFFPEI----TIIDPLDSPDL 336
           ++ F ++     +I     P +
Sbjct: 300 QETFTKLFSKEQVITAHAGPGI 321


>gi|328773164|gb|EGF83201.1| hypothetical protein BATDEDRAFT_34046 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 783

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 106/361 (29%), Positives = 162/361 (44%), Gaps = 44/361 (12%)

Query: 8   ILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITH 65
           IL  ++         + +   P NIA+ KYWGKRD++L LP N+SLS++L   HL + T 
Sbjct: 347 ILETFLRYMITSTGLQVTCSAPVNIAVVKYWGKRDTQLLLPTNSSLSVTLSQDHLRSTTT 406

Query: 66  I-TVIDS--DADCIILNGQKISS-QSSFFKKTTQFCDLFRQ-----------FSKVYFLI 110
           I T  D+  + D + LN  +++   SS  +         R+            S     I
Sbjct: 407 IHTATDASLERDRLWLNHSEVNIAASSRLRNVLAEARRLRRTVEEANPTLPILSTCPLHI 466

Query: 111 ETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS-----------ESLSRVARLGSGS 159
            + NN PT AGLASSASGFA +  AL +++ +   +             LSR+AR+GSGS
Sbjct: 467 ASVNNFPTAAGLASSASGFACMVYALDQLFELNGPNTQTADLQTRHLSDLSRLARIGSGS 526

Query: 160 ACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEIT 217
           ACRS + GF  W  G   +G+DS AV  +    WPDL   +L + D +K  GS   M+ T
Sbjct: 527 ACRSLFGGFVAWDMGDRLDGLDSVAVQVDTELHWPDLEALILVVSDAQKDTGSTVGMQRT 586

Query: 218 RHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ 276
              S          +   +  +  AI  +DF    ++  +++ + HA  +   PP+ Y  
Sbjct: 587 VETSALLQHRIHHVVPDRMVEMTNAIHCKDFDTFAKLTMQDSNQFHAVCLDTFPPISYMN 646

Query: 277 KETIQGMERVWDAR---------QQSIPIYFTLDAGPNLKLLFTHKIEETIK----QFFP 323
             +   +  +              +   + +T DAGPN  L    K    +      FFP
Sbjct: 647 DISRAIVRLITAYNDLFTVESGTAKGYRVAYTFDAGPNAVLYLPRKHVAEVLGLINHFFP 706

Query: 324 E 324
           +
Sbjct: 707 Q 707


>gi|261206464|ref|XP_002627969.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis
           SLH14081]
 gi|239593028|gb|EEQ75609.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis
           SLH14081]
 gi|239610798|gb|EEQ87785.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis ER-3]
 gi|327350330|gb|EGE79187.1| diphosphomevalonate decarboxylase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 404

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 108/339 (31%), Positives = 158/339 (46%), Gaps = 25/339 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++SA  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   +    D + 
Sbjct: 8   YRASATAPVNIAVIKYWGKRDAILNLPTNSSLSVTLSQSSLRAYTTASCSPTYPAEDSLT 67

Query: 78  LNGQKISSQSS------------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
           LN Q  S + S              ++         + S     I + NN PT AGLASS
Sbjct: 68  LNSQPHSIKDSKRTLACLSDLRSLRQELENANPSLPKLSTFPLRIVSENNFPTAAGLASS 127

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA- 184
           A+GFAAL  A+  +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DS A 
Sbjct: 128 AAGFAALVRAVANLYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRTGVLEDGTDSLAE 187

Query: 185 -VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAI 242
            V   + WP++R  +L + D +K + S   M+ T   S  F    +  +   +  I+ AI
Sbjct: 188 EVAPASHWPEMRALILVVSDVKKDVPSTLGMQATVATSTLFATRAETVVPARMVAIETAI 247

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
            ++DF    E+  K++   HAT +   PP  Y    +   +  V D  +        +T 
Sbjct: 248 KNRDFPSFAEITMKDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAYTF 307

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           DAGPN  + + +   E +   F  I           W  
Sbjct: 308 DAGPNAVIYYLNNESERVIGTFRSIL----KPETKGWDG 342


>gi|309806238|ref|ZP_07700252.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           03V1-b]
 gi|308167385|gb|EFO69550.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           03V1-b]
          Length = 325

 Score =  334 bits (857), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 115/323 (35%), Positives = 175/323 (54%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KKI S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKKISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|239636793|ref|ZP_04677795.1| diphosphomevalonate decarboxylase [Staphylococcus warneri L37603]
 gi|239598148|gb|EEQ80643.1| diphosphomevalonate decarboxylase [Staphylococcus warneri L37603]
          Length = 327

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 121/327 (37%), Positives = 184/327 (56%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNG 80
           +   A   +NIAL KYWGK D KL +P+NNSLS+SL    T T +T   D  AD +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADEKLIIPMNNSLSVSLDKFYTETKVTFDSDYPADQLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           ++ + + +  KK   + D+ R+ +   ++  I++ N +PT AGLASSAS +AAL  A   
Sbjct: 63  KEANEKET--KKIQSYMDIVREIANTDLHTRIDSQNFVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSA RS + GF EW  G D     +  +  ++   +L +  
Sbjct: 121 ALQLELSDKDLSRLARRGSGSASRSIFGGFAEWEKGHDDETSYAHPIDADHWEDELSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  D+   KQAI  +DF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDIKEAKQAIEAKDFKQLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + + PP  Y  +E+   M  V + R+  +P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGSQPPFTYLVQESYDAMAIVHECRKMGVPCYFTMDAGPNVKVLVEKKNKQLV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
              F +      + + D+ +T   + +
Sbjct: 301 IDQFLKHFEASQIIASDIIATGVEIIK 327


>gi|262051920|ref|ZP_06024134.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus
           930918-3]
 gi|259160177|gb|EEW45207.1| mevalonate diphosphate decarboxylase [Staphylococcus aureus
           930918-3]
          Length = 328

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 124/328 (37%), Positives = 181/328 (55%), Gaps = 6/328 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGT-ITHITVIDS-DADCIILN 79
           +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T  T +T  D    D   LN
Sbjct: 3   KSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLSKNFTLETKVTFNDQLTQDQFWLN 62

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G+K+S +    +K +++ D+ R  +    Y  IE+ N +PT AGLASSAS +AAL  A  
Sbjct: 63  GEKVSGKE--LEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAACN 120

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
           +   +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL + 
Sbjct: 121 QALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLAMI 180

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E+N
Sbjct: 181 FVVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIEEN 240

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
            L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K ++ 
Sbjct: 241 GLRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNKQQ 300

Query: 318 IKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           I          + +   D+ +T   + +
Sbjct: 301 IIDKLLTQFDNNQIIDSDIIATGIEIIE 328


>gi|312875613|ref|ZP_07735614.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2053A-b]
 gi|325912578|ref|ZP_08174961.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 60-B]
 gi|311088867|gb|EFQ47310.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2053A-b]
 gi|325477999|gb|EGC81128.1| diphosphomevalonate decarboxylase [Lactobacillus iners UPII 60-B]
          Length = 325

 Score =  334 bits (856), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 114/323 (35%), Positives = 174/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ + 
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVD 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|153791289|ref|NP_001093300.1| diphosphomevalonate decarboxylase [Bombyx mori]
 gi|146424702|dbj|BAF62111.1| diphosphomevalonate decarboxylase [Bombyx mori]
          Length = 390

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 104/348 (29%), Positives = 163/348 (46%), Gaps = 22/348 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNG 80
            +   P NIA+ KYWGKRD KL LPLN+S+S +     +   T + T  D   D I LNG
Sbjct: 5   VTVIAPVNIAVIKYWGKRDEKLILPLNDSVSATFDTSVMCAKTSVSTHPDFVEDQIWLNG 64

Query: 81  QKISSQSSFFKKTTQFCD--------LFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
           ++ S  +   +   +           +          + + NN PT AGLASSA+G+A L
Sbjct: 65  KEESFSNPRLQNCLREIKSRAVAEKTIAEDVLSWKVHVSSENNFPTAAGLASSAAGYACL 124

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--Q 190
             AL ++Y I      +S +ARLGSGSACRS Y GF  W  G+  +G DS A    +   
Sbjct: 125 VSALAKLYKIK---SDVSSIARLGSGSACRSVYGGFVRWHAGSKPDGSDSIATQIADSNH 181

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++R+ +L + + +KK+ S   M+I+   S       Q         I +AI ++DF K
Sbjct: 182 WPEMRVLVLVVGNTQKKVSSTVGMKISSETSELLKHRIQHCVPQRTERIIEAIKNKDFYK 241

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLK 307
             E+  K++ + HA  + + PP++Y    +   ++ +           + +T DAG N  
Sbjct: 242 FAEITMKDSNQFHAICLDSYPPIVYMTDISHSIVDLIHKYNDFSGETKVAYTFDAGSNAC 301

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           L         +           P  SP+ + T  S++++      +SK
Sbjct: 302 LYLLKHDVPKVISLIK---YAFPSTSPENFITGLSVAKEEINTDILSK 346


>gi|57866188|ref|YP_187835.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           RP62A]
 gi|57636846|gb|AAW53634.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           RP62A]
 gi|329736912|gb|EGG73174.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU045]
          Length = 327

 Score =  334 bits (856), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 119/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVTFDPDFTEDRLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N++PT AGLASSAS +AAL  A   
Sbjct: 63  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 121 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 301 MEQFLKVFDESKIIASDIISSGVEIIK 327


>gi|91078238|ref|XP_970108.1| PREDICTED: similar to diphosphomevalonate decarboxylase [Tribolium
           castaneum]
 gi|270003930|gb|EFA00378.1| hypothetical protein TcasGA2_TC003224 [Tribolium castaneum]
          Length = 385

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 96/343 (27%), Positives = 149/343 (43%), Gaps = 16/343 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVID-SDADCIIL 78
           +  +   P NIA+ KYWGKRD  L LP+N+SLS +L    +   T I            L
Sbjct: 2   KTVTGIAPVNIAVVKYWGKRDEDLILPINDSLSCTLSTDFMCAKTTIMASPTFPTHRFWL 61

Query: 79  NGQKISSQSSFFKKTT-----QFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           NG++    +            +              I + NN PT AGLASSA+G+AAL 
Sbjct: 62  NGKESDFNNERLNNCLTEIRKRANPKCGDLLNWKLHICSENNFPTAAGLASSAAGYAALV 121

Query: 134 LALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQW 191
             L  +Y++      +S +AR GSGSACRS Y GF  W  G    G DS A      + W
Sbjct: 122 STLSALYNVE---GDISAIARRGSGSACRSIYGGFVRWNKGAKPGGEDSIACQIASASHW 178

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKL 250
           P++R+ +L + D +KK  S   M+ +   S       ++I    +  I +AI  ++F   
Sbjct: 179 PEMRVLILVVSDDQKKYSSTSGMKQSVLTSELLKHRAEKIVPGRVDEIIKAIKLKNFEAF 238

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKL 308
            ++  +++ + HA  +   PP  Y    +   +E V      Q +  + +T DAGPN  L
Sbjct: 239 AKITMQDSNQFHAICLDTYPPCFYMNDVSRMIIELVHAYNDYQGATKVAYTFDAGPNACL 298

Query: 309 LFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
                  + +     +I   +   S  +      L   N++  
Sbjct: 299 YLLQNDVDEVASLINDIFPSNTNPSEFIRGLPVKLKNSNNLRE 341


>gi|332639847|pdb|3QT5|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase
 gi|332639848|pdb|3QT5|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase
 gi|332639849|pdb|3QT6|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor Dpgp
 gi|332639850|pdb|3QT6|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor Dpgp
 gi|332639851|pdb|3QT7|A Chain A, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor
           6-Fmvapp
 gi|332639852|pdb|3QT7|B Chain B, Crystal Structure Of Staphylococcus Epidermidis Mevalonate
           Diphosphate Decarboxylase Complexed With Inhibitor
           6-Fmvapp
          Length = 332

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 120/333 (36%), Positives = 183/333 (54%), Gaps = 5/333 (1%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDAD 74
               + +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D
Sbjct: 2   STGSMVKSGKARAHTNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTED 61

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
           C+ILNG +++++    +K   + ++ R  +   ++  IE+ N +PT AGLASSAS +AAL
Sbjct: 62  CLILNGNEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAAL 119

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A     S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    
Sbjct: 120 AAACNEALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEK 179

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL +  + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGE
Sbjct: 180 DLSMIFVVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGE 239

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           V E N L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   
Sbjct: 240 VIEANGLRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEK 299

Query: 313 KIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           K ++ + + F ++     + + D+ S+   + +
Sbjct: 300 KNKQAVMEQFLKVFDESKIIASDIISSGVEIIK 332


>gi|332639853|pdb|3QT8|A Chain A, Crystal Structure Of Mutant S192a Staphylococcus
           Epidermidis Mevalonate Diphosphate Decarboxylase
           Complexed With Inhibitor 6- Fmvapp
 gi|332639854|pdb|3QT8|B Chain B, Crystal Structure Of Mutant S192a Staphylococcus
           Epidermidis Mevalonate Diphosphate Decarboxylase
           Complexed With Inhibitor 6- Fmvapp
          Length = 332

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 119/333 (35%), Positives = 183/333 (54%), Gaps = 5/333 (1%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDAD 74
               + +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D
Sbjct: 2   STGSMVKSGKARAHTNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTED 61

Query: 75  CIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAAL 132
           C+ILNG +++++    +K   + ++ R  +   ++  IE+ N +PT AGLASSAS +AAL
Sbjct: 62  CLILNGNEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAAL 119

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
             A     S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    
Sbjct: 120 AAACNEALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEK 179

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL +  + I ++ KK+ +R  M +TR  S F+  W   +  DL   K+A+ +QDF +LGE
Sbjct: 180 DLSMIFVVINNQSKKVSARSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGE 239

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           V E N L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   
Sbjct: 240 VIEANGLRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEK 299

Query: 313 KIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
           K ++ + + F ++     + + D+ S+   + +
Sbjct: 300 KNKQAVMEQFLKVFDESKIIASDIISSGVEIIK 332


>gi|293367975|ref|ZP_06614611.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291317904|gb|EFE58314.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 326

 Score =  333 bits (855), Expect = 2e-89,   Method: Composition-based stats.
 Identities = 119/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D +ILNG
Sbjct: 2   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVTFDPDFTEDRLILNG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N++PT AGLASSAS +AAL  A   
Sbjct: 62  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 120 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEKDLSMIF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 180 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 240 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 299

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 300 MEQFLKVFDESKIIASDIISSGVEIIK 326


>gi|313625778|gb|EFR95404.1| diphosphomevalonate decarboxylase [Listeria innocua FSL J1-023]
          Length = 323

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 185/326 (56%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +   +    D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDEKLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           + +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  QKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGNDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q  +++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPLSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
                 +   ++      +     D 
Sbjct: 297 ADKLSGLAKNVLICHAGKEASVISDE 322


>gi|312871713|ref|ZP_07731801.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           3008A-a]
 gi|311092655|gb|EFQ51011.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           3008A-a]
          Length = 325

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 114/323 (35%), Positives = 175/323 (54%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|196004226|ref|XP_002111980.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
 gi|190585879|gb|EDV25947.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
          Length = 385

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 89/316 (28%), Positives = 148/316 (46%), Gaps = 18/316 (5%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIIL 78
           ++++   P NIA+ KYWGKRD  L LP+N+SLS +L    +   T I +  S   D + +
Sbjct: 5   KQATCIAPVNIAVVKYWGKRDENLILPINSSLSGTLSTDQMCAKTTIAISKSFQRDRLWI 64

Query: 79  NGQKISSQSSFFKKTTQFCDLF--RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NG++  +     +   +        +    ++ I + NN PT AGLASSA+G+A L    
Sbjct: 65  NGKEQDATGKRLQNCLREVRSRCGSEIEGCHYHICSVNNFPTAAGLASSAAGYACLG--- 121

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDL 194
              +   E    +    R GSGSACRS Y GF +W  G   +G DS AV     + WP++
Sbjct: 122 -EYFEYKEGITKIQFTIRQGSGSACRSMYGGFVKWEMGNKSDGSDSIAVQVTPESHWPEM 180

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEV 253
            + +L + D++K + S   M+ +   S       +  +   +  ++ AI  +++    E+
Sbjct: 181 EVLILVVSDKKKGVSSTSGMQTSVKTSKLLKYRAESLVPKLMTEMETAIQQKNYQAFAEI 240

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFT 311
             K++ + HA  +   PP+ Y    + + ++ +    Q        +T DAGPN  L   
Sbjct: 241 TMKDSNQFHAVCLDTYPPIAYMNDISHKIVQLITHFNQYCGEYKACYTFDAGPNAVLYVL 300

Query: 312 HKIEETIK----QFFP 323
            K    I      +FP
Sbjct: 301 AKDVPQILSAVCHYFP 316


>gi|195384315|ref|XP_002050863.1| GJ19966 [Drosophila virilis]
 gi|194145660|gb|EDW62056.1| GJ19966 [Drosophila virilis]
          Length = 390

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 100/328 (30%), Positives = 160/328 (48%), Gaps = 20/328 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             ++   P N+AL KYWGKR+ +L LP+N+S+S++L    +   T IT  +S   + + L
Sbjct: 2   FSATCVAPVNMALVKYWGKRNEELILPINDSVSMTLDANEMCAKTTITASESFKQNRMWL 61

Query: 79  NGQKISSQSSFF--------KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
           NG+ ++ + +          ++        +        I + NN PT AGLASSA+G+A
Sbjct: 62  NGEVVTFEENARLMRCLAGVQRLALANGAHKFSLSWKLHIASYNNFPTAAGLASSAAGYA 121

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FN 188
            L   L R+Y +P   E L+ VAR GSGSACRS Y GF  W  G+  +G DS AVP    
Sbjct: 122 CLVYTLARLYELPLN-EELTTVARQGSGSACRSLYGGFVHWRRGSSADGSDSIAVPLAPA 180

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDF 247
           + WP++ + +L + D  KK GS   M++    S        + +   +  +  AI  +DF
Sbjct: 181 SHWPNMHMLILVVNDARKKTGSTRGMQLGVSTSSLIQHRAKEVVPRRVKELMAAIESRDF 240

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPN 305
               E+  K + ++HA  +   PP +Y    +   +  V D  +   S+   +T DAGPN
Sbjct: 241 QAFAEITIKESNQLHAICLDTYPPCVYMNDVSHAIVNFVHDYNETVGSLQAAYTFDAGPN 300

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDS 333
             +    +    + +    I +  P D+
Sbjct: 301 ACIYVLAEN---VPRLLAAIQLAFPNDA 325


>gi|254992955|ref|ZP_05275145.1| mevalonate diphosphate decarboxylase [Listeria monocytogenes FSL
           J2-064]
          Length = 323

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 126/326 (38%), Positives = 185/326 (56%), Gaps = 11/326 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           +++A   +N+AL KYWGKRD  L LP N+SLS ++    T T +    +   D  ILN +
Sbjct: 2   RATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             +       K  +F D  R+   +     I + N++PT AGLASSAS FAAL LA    
Sbjct: 62  HKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAGLASSASAFAALALAGSSA 116

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGL 198
               +  E +SR+AR GSGSA RS +  F  W  G   +G DSFAVPF N+  D + + +
Sbjct: 117 AGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVV 176

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             + D+EKK+ SR+ M +T   SPFF +W     TDL  +KQAI+D+DFIK+GE+ E+N 
Sbjct: 177 AVVSDKEKKVSSRDGMRLTVETSPFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNG 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+DAGPN+K++   + E  +
Sbjct: 237 MKMHATTLGAEPPFTYFQPKSLEIMDAVRELRENGIPAYFTMDAGPNVKVICERENENIV 296

Query: 319 KQFFPEI--TIIDPLDSPDLWSTKDS 342
                 +   ++      +     D 
Sbjct: 297 ADKLSGLAKNVLICHAGKEASVISDE 322


>gi|315641783|ref|ZP_07896787.1| diphosphomevalonate decarboxylase [Enterococcus italicus DSM 15952]
 gi|315482458|gb|EFU72997.1| diphosphomevalonate decarboxylase [Enterococcus italicus DSM 15952]
          Length = 330

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 127/322 (39%), Positives = 176/322 (54%), Gaps = 9/322 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
            K  A   +NIAL KYWGK +  L LP NNSLSL+L    T T +   + +  DC  L+G
Sbjct: 2   FKGKARAYTNIALIKYWGKENQALILPKNNSLSLTLDGFYTETEVLFTEEATKDCFYLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            K S Q++  KK T F +L R+ +    + ++ + N++PT AGLASSASG AAL  A  +
Sbjct: 62  VKQSEQAT--KKVTTFLNLVRERANCPFFAVVRSHNHVPTAAGLASSASGLAALAGACNQ 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LS++AR GSGSACRS + GF EW  G       +  +       +L +  
Sbjct: 120 ALGLNLAPKELSKLARRGSGSACRSIFGGFVEWDRGDSDETSYALPIDAQGWEQELAMIF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L I D+ K + SRE M+ T   S F+ QW ++   DL   K+AI   DF KLG V E NA
Sbjct: 180 LLINDQPKDVSSREGMQRTVETSAFYPQWVKEAQADLHIAKEAIQHHDFQKLGTVMEANA 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMHAT +AA PP  YW  ++++ M  V   RQ  +  YFT+DAGPN+K+L   K    I
Sbjct: 240 LKMHATTLAAVPPFTYWSPDSLRAMNLVRSIRQAGLFCYFTMDAGPNVKVLCQKKDIAAI 299

Query: 319 KQ----FFPEITIIDPLDSPDL 336
            +     F +  ++     P +
Sbjct: 300 FEVLSSTFSDQQMVVAYAGPGI 321


>gi|330685899|gb|EGG97528.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU121]
          Length = 327

 Score =  333 bits (854), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 121/327 (37%), Positives = 183/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNG 80
           +   A   +NIAL KYWGK D KL +P+NNSLS+SL    T T +T   D  AD +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADEKLIIPMNNSLSVSLDKFYTETEVTFDSDYPADQLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +  + + +  KK   + D+ R+ +   ++  I++ N +PT AGLASSAS +AAL  A   
Sbjct: 63  KVANEKET--KKIQSYMDIVREIAGTDLHARIDSQNFVPTAAGLASSASAYAALATACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSA RS + GF EW  G D     +  +  ++   +L +  
Sbjct: 121 ALQLNLSDKDLSRLARRGSGSASRSIFGGFAEWEKGHDDETSYAHPIDADHWEDELSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  D+   KQAI  +DF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDIKEAKQAIEAKDFQQLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + + PP  Y  +E+   M  V + R+  +P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGSQPPFTYLVQESYDAMAIVHECREMGVPCYFTMDAGPNVKVLVEKKNKQLV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
              F +      + + D+ +T   + +
Sbjct: 301 INQFLKHFEASQIIASDIIATGVEIIK 327


>gi|19114939|ref|NP_594027.1| diphosphomevalonate decarboxylase (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74626617|sp|O13963|MVD1_SCHPO RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
 gi|2330786|emb|CAB11260.1| diphosphomevalonate decarboxylase (predicted) [Schizosaccharomyces
           pombe]
          Length = 393

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 104/358 (29%), Positives = 161/358 (44%), Gaps = 32/358 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNGQ 81
           +   P NIA+ KYWGKRD  LNLP N+S+S++L    L T+T  +     + D + LNG 
Sbjct: 9   TVSAPVNIAVIKYWGKRDVALNLPTNSSISVTLSQDDLRTVTTASCSEKFENDTLWLNGN 68

Query: 82  KISSQ-SSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSASGF 129
                 +   +   +     R           +   +   + + NN PT AGLASSA+G+
Sbjct: 69  AEEIFANKRLRVCVEELRKARLDLEEENDDLDKIGALKLHVVSENNFPTAAGLASSAAGY 128

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN- 188
           AA   A+ R+Y +P     LSR+AR GSGSACRS + G+  W  G   +G DS AV    
Sbjct: 129 AAFCEAIARLYDLPWTPTQLSRIARQGSGSACRSLFGGYVAWEMGELHSGADSVAVQVEP 188

Query: 189 -NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQD 246
              WP++R+ +L     +K + S   M+ T   S  F    Q I    +  +K AI ++D
Sbjct: 189 VENWPEIRVAVLVASAAKKGVSSTAGMQATVASSTLFQHRIQNIVPQRIQEMKTAIRERD 248

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGP 304
           F    ++   ++ + HA  +   PP+ Y    +   +  V +           +T DAGP
Sbjct: 249 FETFAKLTMTDSNQFHACCLDTFPPIFYLNDTSRAVIRVVENINATAGKTIAAYTFDAGP 308

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS-------TKDSLSQKNSIELGISK 355
           N  + F  +  E +      +T      + + WS            +  N +  GIS+
Sbjct: 309 NAVIYFLEENSEIVLNTLYAVT-----KNAEGWSKQYGSSPVTVDSAAANIVSSGISR 361


>gi|116492691|ref|YP_804426.1| diphosphomevalonate decarboxylase [Pediococcus pentosaceus ATCC
           25745]
 gi|116102841|gb|ABJ67984.1| diphosphomevalonate decarboxylase [Pediococcus pentosaceus ATCC
           25745]
          Length = 327

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 113/322 (35%), Positives = 168/322 (52%), Gaps = 10/322 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK +S L LP N+S+SL+L    T T +T  D   ++   LN Q I 
Sbjct: 8   ARAHTNIALLKYWGKINSDLILPANDSISLTLDKFYTDTEVTFSDEYTSNLFYLNHQLID 67

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            +    ++  +  +  +       +  IE+ N++PT AGLASSASG AAL  A       
Sbjct: 68  VKK--MQRINRVLEAVKSEFGYQGFAKIESENHVPTAAGLASSASGMAALAGAAVSALGS 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LSR+ARLGSGSA RS + G   W  G D     +  +   +Q  DL +  + I 
Sbjct: 126 HTDLTNLSRLARLGSGSASRSVFGGIVHWHRGYDHQSSFAEQIVSEDQI-DLNMVTIVID 184

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            R+KK+ S   M+ T   SPF+  W +  +  +  +  A+ + DF K+GE+AE +A  MH
Sbjct: 185 RRQKKVKSTLGMQHTASTSPFYPAWVEATNQAIPEMISAVQNNDFTKIGELAEHSAAMMH 244

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT +++ P   Y+  ETIQ ++ V   R+  I  Y+T+DAGPN+K+L   K    +K+FF
Sbjct: 245 ATTLSSKPAFTYFAPETIQAIKLVEQLRESGIECYYTIDAGPNVKVLCQSKNITRVKRFF 304

Query: 323 PEI----TIIDPLDSPDLWSTK 340
                   ++       +  TK
Sbjct: 305 ASYFDQDQLVVAKPGSGIKFTK 326


>gi|9695271|dbj|BAB07791.1| diphosphomevalonate decarboxylase [Streptomyces sp. CL190]
          Length = 350

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 111/304 (36%), Positives = 163/304 (53%), Gaps = 9/304 (2%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A    NIAL KYWGKRD +L LP   SLS++L    T T + +  + + D   LNG+ 
Sbjct: 22  ATAVAHPNIALIKYWGKRDERLILPCTTSLSMTLDVFPTTTEVRLDPAAEHDTAALNGEV 81

Query: 83  ISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            + ++   ++ + F  L R+ +      +++T N +PT AGLASSASGFAAL +A    Y
Sbjct: 82  ATGET--LRRISAFLSLVREVAGSDQRAVVDTRNTVPTGAGLASSASGFAALAVAAAAAY 139

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD----QNGMDSFAVPFNNQWPDLRI 196
            +      LSR+AR GSGSA RS + GF  W  G D    +  + S+A P      D  +
Sbjct: 140 GLELDDRGLSRLARRGSGSASRSIFGGFAVWHAGPDGTATEADLGSYAEPVPAADLDPAL 199

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
            +  +    K + SREAM  T   SP +  W      DL  ++ A++  D   +GE+AE+
Sbjct: 200 VIAVVNAGPKPVSSREAMRRTVDTSPLYRPWADSSKDDLDEMRSALLRGDLEAVGEIAER 259

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NAL MHATM+AA P + Y    T+  ++ V   R+  +  Y T+DAGPN+K+L      E
Sbjct: 260 NALGMHATMLAARPAVRYLSPATVTVLDSVLQLRKDGVLAYATMDAGPNVKVLCRRADAE 319

Query: 317 TIKQ 320
            +  
Sbjct: 320 RVAD 323


>gi|319400100|gb|EFV88336.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           FRI909]
          Length = 327

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 119/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D +ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVTFDPDFTEDRLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N++PT AGLASSAS +AAL  A   
Sbjct: 63  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 121 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHEINSNGWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 301 MEQFLKVFDESKIIASDIISSGVEIIK 327


>gi|227513348|ref|ZP_03943397.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri ATCC
           11577]
 gi|227524491|ref|ZP_03954540.1| diphosphomevalonate decarboxylase [Lactobacillus hilgardii ATCC
           8290]
 gi|227083221|gb|EEI18533.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri ATCC
           11577]
 gi|227088361|gb|EEI23673.1| diphosphomevalonate decarboxylase [Lactobacillus hilgardii ATCC
           8290]
          Length = 336

 Score =  333 bits (853), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 114/322 (35%), Positives = 176/322 (54%), Gaps = 12/322 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           N   +A   +NIAL KYWGK+D  L +P  +SLSL+L H  T T +   +S   D II++
Sbjct: 14  NNPVTARAHTNIALIKYWGKKDESLIIPYTSSLSLTLDHFYTDTTVRFDESLSTDQIIID 73

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ  S +S   ++   F ++ R  +++     I ++N++PT AGLASSAS FAAL  +  
Sbjct: 74  GQIPSEKS--RQRVRDFLEIVRGKAQIAIPASISSTNHVPTAAGLASSASAFAALAASAS 131

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPDLRI 196
           +   +   +  LS++AR GSGSACRS +  F EW  GT+    DS+A P  +    D+R+
Sbjct: 132 KAAGLHLDATELSKLARRGSGSACRSVFGHFVEWQRGTND--ADSYAKPLPDTGLNDIRV 189

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             L +   +K + SR+ M ++   SP++  W +    DL  +K AI   DF + G+++E 
Sbjct: 190 VALTVERGQKAVSSRQGMHLSVTTSPYYPAWVKTCQADLLQLKSAIEKGDFTRFGKISEL 249

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA++MHA  ++A P   Y+  +T+  M  V   R Q    Y+T+DAGPN+K+L       
Sbjct: 250 NAMRMHALTLSADPSFTYFNGQTLAIMNLVKQLRHQGTECYYTIDAGPNVKVLCQQSTVA 309

Query: 317 TIKQFFPEIT----IIDPLDSP 334
            I   F ++     +I     P
Sbjct: 310 KISATFAQVLGDQNVIIAKPGP 331


>gi|315653557|ref|ZP_07906477.1| diphosphomevalonate decarboxylase [Lactobacillus iners ATCC 55195]
 gi|315488919|gb|EFU78561.1| diphosphomevalonate decarboxylase [Lactobacillus iners ATCC 55195]
          Length = 325

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 113/323 (34%), Positives = 173/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ + 
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVD 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAVELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSQKDISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMQSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|309803981|ref|ZP_07698063.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           11V1-d]
 gi|308163900|gb|EFO66165.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           11V1-d]
          Length = 325

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 114/323 (35%), Positives = 174/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R   I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRNNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|242241930|ref|ZP_04796375.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           W23144]
 gi|242234627|gb|EES36939.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           W23144]
          Length = 326

 Score =  333 bits (853), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 119/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       D +ILNG
Sbjct: 2   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSITLDRFYTETKVTFDPDFTEDRLILNG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N++PT AGLASSAS +AAL  A   
Sbjct: 62  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENHVPTAAGLASSASAYAALAAACNE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 120 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHEINSNGWEKDLSMIF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 180 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 240 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 299

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 300 MEQFLKVFDESKIIASDIISSGVEIIK 326


>gi|27467280|ref|NP_763917.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           ATCC 12228]
 gi|282874951|ref|ZP_06283826.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           SK135]
 gi|9937380|gb|AAG02436.1|AF290091_2 mevalonate diphosphate decarboxylase [Staphylococcus epidermidis]
 gi|27314823|gb|AAO03959.1|AE016745_58 mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           ATCC 12228]
 gi|281296279|gb|EFA88798.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           SK135]
 gi|329735925|gb|EGG72201.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU028]
          Length = 327

 Score =  332 bits (852), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 120/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       DC+ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTEDCLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N +PT AGLASSAS +AAL  A   
Sbjct: 63  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 121 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 301 MEQFLKVFDESKIIASDIISSGVEIIK 327


>gi|251810013|ref|ZP_04824486.1| possible diphosphomevalonate decarboxylase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|251806464|gb|EES59121.1| possible diphosphomevalonate decarboxylase [Staphylococcus
           epidermidis BCM-HMP0060]
          Length = 326

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 120/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       DC+ILNG
Sbjct: 2   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTEDCLILNG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N +PT AGLASSAS +AAL  A   
Sbjct: 62  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 120 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEKDLSMIF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 180 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 240 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 299

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 300 MEQFLKVFDESKIIASDIISSGVEIIK 326


>gi|13786942|pdb|1FI4|A Chain A, The X-Ray Crystal Structure Of Mevalonate 5-Diphosphate
           Decarboxylase At 2.3 Angstrom Resolution
          Length = 416

 Score =  332 bits (851), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 105/353 (29%), Positives = 171/353 (48%), Gaps = 24/353 (6%)

Query: 12  YIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHI-TV 68
            +   +      +S   P NIA  KYWGKRD+KLNLP N+S+S++L    L T+T   T 
Sbjct: 14  LVPRGSHXTVYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATA 73

Query: 69  IDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIP 117
            + + D + LNG+  S  +   +   +     R+            S+    I + NN P
Sbjct: 74  PEFERDTLWLNGEPHSIDNERTQNCLRDLRQLRKEXESKDASLPTLSQWKLHIVSENNFP 133

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  +
Sbjct: 134 TAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEXGKAE 193

Query: 178 NGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STD 234
           +G DS AV   +   WP  +  +L + D +K + S +  ++T   S  F +  + +    
Sbjct: 194 DGHDSXAVQIADSSDWPQXKACVLVVSDIKKDVSSTQGXQLTVATSELFKERIEHVVPKR 253

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
               ++AI+++DF    +    ++   HAT + + PP+ Y    + + +       Q   
Sbjct: 254 FEVXRKAIVEKDFATFAKETXXDSNSFHATCLDSFPPIFYXNDTSKRIISWCHTINQFYG 313

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
              + +T DAGPN  L +  + E  +  F  ++       S   W  K +  Q
Sbjct: 314 ETIVAYTFDAGPNAVLYYLAENESKLFAFIYKL-----FGSVPGWDKKFTTEQ 361


>gi|329723157|gb|EGG59689.1| diphosphomevalonate decarboxylase [Staphylococcus epidermidis
           VCU144]
          Length = 327

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 120/327 (36%), Positives = 182/327 (55%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T       DC+ILNG
Sbjct: 3   KSGKARAHTNIALIKYWGKADETYIIPMNNSLSVTLDRFYTETKVTFDPDFTEDCLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
            +++++    +K   + ++ R  +   ++  IE+ N +PT AGLASSAS +AAL  A   
Sbjct: 63  NEVNAKEK--EKIQNYMNIVRDLAGNRLHARIESENYVPTAAGLASSASAYAALAAACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             S+      LSR+AR GSGSA RS + GF EW  G D     +  +  N    DL +  
Sbjct: 121 ALSLNLSDTDLSRLARRGSGSASRSIFGGFAEWEKGHDDLTSYAHGINSNGWEKDLSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DL   K+A+ +QDF +LGEV E N 
Sbjct: 181 VVINNQSKKVSSRSGMSLTRDTSRFYQYWLDHVDEDLNEAKEAVKNQDFQRLGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+ ++P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYLVQESYDAMAIVEQCRKANLPCYFTMDAGPNVKVLVEKKNKQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
            + F ++     + + D+ S+   + +
Sbjct: 301 MEQFFKVFDESKIIASDIISSGVEIIK 327


>gi|326910927|ref|NP_001192100.1| diphosphomevalonate decarboxylase [Acyrthosiphon pisum]
 gi|328705024|ref|XP_003242673.1| PREDICTED: diphosphomevalonate decarboxylase [Acyrthosiphon pisum]
          Length = 386

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 110/330 (33%), Positives = 156/330 (47%), Gaps = 22/330 (6%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNG 80
            +   P NIA  KYWGKRD  L LPLN+S+SL+L    +   T +      D D + LNG
Sbjct: 5   VTCVAPVNIATIKYWGKRDEHLILPLNDSVSLTLDCDQMHAKTSVLAGPFIDEDSVWLNG 64

Query: 81  QKISSQ-SSFFKKTTQFCDL--------FRQFSKVYFLIETSNNIPTKAGLASSASGFAA 131
           Q +S + +   KK                 Q +K    + + NN PT AGLASSA+G+A 
Sbjct: 65  QIMSIETNKRLKKCFDLIRNLIRIRKGENSQEAKWNIRVCSENNFPTAAGLASSAAGYAC 124

Query: 132 LTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NN 189
           L   L   +      E L  +AR GSGSACRS Y GF  W  GTD  G DS AV    + 
Sbjct: 125 LVYTLANAFG--LVDEDLPSIARQGSGSACRSIYGGFVHWKAGTDDLGSDSTAVQISADT 182

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFI 248
            WP++RI +L + D +KK  S   M+ +   S       Q+        I QAI D++F 
Sbjct: 183 HWPEMRIIILVVNDSQKKTSSTVGMKQSVKTSELLKYRIQKCVPERTNEIIQAITDKNFE 242

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNL 306
           K  E+  +++ + HA  +   PP +Y  + + + +  + D  +    I + +T DAGPN 
Sbjct: 243 KFAEITMRDSNQFHAVCLDTYPPCVYLNQVSHEIISFIHDYNEAVGQIKVSYTFDAGPNA 302

Query: 307 KLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
            L    K       F  E+  + P   P+ 
Sbjct: 303 FLFIQQKDLSL---FMSELVNVFPSQQPNS 329


>gi|163790895|ref|ZP_02185319.1| mevalonate diphosphate decarboxylase [Carnobacterium sp. AT7]
 gi|159873848|gb|EDP67928.1| mevalonate diphosphate decarboxylase [Carnobacterium sp. AT7]
          Length = 325

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 127/322 (39%), Positives = 187/322 (58%), Gaps = 11/322 (3%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISS 85
              +NIAL KYWGKRD KL LP ++SLSL+L    T T ++  +S + D   L+      
Sbjct: 8   RAYTNIALIKYWGKRDDKLILPTSSSLSLTLDAFYTETAVSFDESLEKDTFYLDDNLQDE 67

Query: 86  QSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
            ++   K ++F +LFR+ + +    LI+++N +PT AGLASSASG AAL  A      + 
Sbjct: 68  AATL--KVSRFLNLFREQADLKAPALIKSTNYVPTAAGLASSASGMAALAGAANLASGLN 125

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID 203
              + LS  AR GSGSA RS Y GF EW  GT    +DS+AV  +N   D+ + ++ +  
Sbjct: 126 LTPQELSIFARQGSGSASRSVYGGFVEWQKGTS--SVDSYAVKVDNADWDIGMVVVVVNK 183

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
            +K++ SRE M+ T   SPF+  W +  + DL +IK+AI  +DF ++GE+ E N +KMH 
Sbjct: 184 NQKELSSREGMKQTVATSPFYAGWIESTAVDLVNIKKAIGQRDFEQVGEITESNGMKMHG 243

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK---- 319
           TM+ A+PP+ YW+ +++  M+ V   R+Q IP YFT+DAGPN+K+L      + IK    
Sbjct: 244 TMLGANPPISYWEPDSVLAMQLVRKLRKQGIPCYFTMDAGPNVKVLCRLSDSKEIKTAFL 303

Query: 320 QFFPEITIIDPLDSPDLWSTKD 341
            +F E  +I      DL     
Sbjct: 304 NYFSEEQLIVSGPGSDLKEITF 325


>gi|289620875|emb|CBI52609.1| unnamed protein product [Sordaria macrospora]
          Length = 394

 Score =  332 bits (851), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 105/349 (30%), Positives = 163/349 (46%), Gaps = 25/349 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D ++
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDTKLNLPTNSSLSVTLSQADLRTLTTASCSASYPEGDSLL 66

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +     R           + S +   I + NN PT AGLASSA
Sbjct: 67  LNGEPSDVSGARPQACFRELRTRRAALEAADPSLPKLSTMPLRIVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAA   A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A  
Sbjct: 127 AGFAAFVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGEAADGTDSMADQ 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAII 243
           V   + WP++R  +L     +K + S   M+ T   S  F +  +  +  ++  +++AI 
Sbjct: 187 VAEASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFQERIKSVVPKNMEIMEKAIS 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           ++DF    EV  +++   HAT     PP+ Y    +   +  V             +T D
Sbjct: 247 ERDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINAAAGRTVAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
           AGPN  + +  +  E +      +         D W        K++I 
Sbjct: 307 AGPNAVIYYLEQDTEAVVGNLYSVL-----SEVDGWKASAVEGLKSNIS 350


>gi|312873036|ref|ZP_07733096.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2062A-h1]
 gi|311091558|gb|EFQ49942.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2062A-h1]
          Length = 325

 Score =  332 bits (851), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 115/323 (35%), Positives = 173/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S   +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASC--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSRVARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRVARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W      +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTCGMK-IAQTSPFYQTWLNLNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A P   Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|332797171|ref|YP_004458671.1| diphosphomevalonate decarboxylase [Acidianus hospitalis W1]
 gi|332694906|gb|AEE94373.1| diphosphomevalonate decarboxylase [Acidianus hospitalis W1]
          Length = 324

 Score =  331 bits (849), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 99/317 (31%), Positives = 165/317 (52%), Gaps = 10/317 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQ 81
           +  A  PSNIA+ KYWGKR+++LNLPLN+S+S+SL +L   T +   +    D +I+NG+
Sbjct: 4   EGEAIAPSNIAIVKYWGKRNAELNLPLNSSISISLDNLYARTKVIFSEEFSKDEVIINGK 63

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K+S + +      +  ++FR+     ++  + ++ N P  +GLASSA+G AAL  A    
Sbjct: 64  KLSEKET-LNYAGRVLNIFRKIYGKSLFAKVISTTNFPPSSGLASSAAGIAALVYASNEA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS--FAVPFNNQWPDLRIG 197
             +    + LS++AR+GSGSACRS   GF  W  G  ++G DS  + +   N W DL   
Sbjct: 123 LGLGLTQKELSKIARIGSGSACRSTEGGFVVWEKGEREDGEDSFCYQIFPPNYWEDLVDI 182

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +  + D +K++ SRE ME++   S         I      + ++I  +D  K  E+  ++
Sbjct: 183 IAIVSDEKKEVSSREGMEVSTRSSYLMKCRLDFIKETFNDVIESIRKKDEEKFFELTMRH 242

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           +  MHA ++ + P   Y    + + +  V D         +T DAGPN  +  T K  + 
Sbjct: 243 SNSMHAVILDSWPSFFYLNDMSFKIIRWVQDFGHAG----YTFDAGPNPHIFTTKKHMKE 298

Query: 318 IKQFFPEITIIDPLDSP 334
           +  F  ++ +   + SP
Sbjct: 299 VINFLQDLNLKYIITSP 315


>gi|70607014|ref|YP_255884.1| diphosphomevalonate decarboxylase [Sulfolobus acidocaldarius DSM
           639]
 gi|68567662|gb|AAY80591.1| diphosphomevalonate decarboxylase [Sulfolobus acidocaldarius DSM
           639]
          Length = 325

 Score =  331 bits (849), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 109/309 (35%), Positives = 157/309 (50%), Gaps = 10/309 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A  PSNIA+ KYWGKRD KLNLPLN+SLS+SL  L   T +TV  D   D I +N QK+ 
Sbjct: 7   AIAPSNIAIVKYWGKRDDKLNLPLNSSLSISLEKLEVRTKVTVSADLQKDEIYINQQKLR 66

Query: 85  SQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            +  F +   +  ++FR+     F   +E+  N P   GLASSA+G AAL  AL     +
Sbjct: 67  -EEEFEEYGGRVINIFRELYGKKFSVKVESYMNFPKSVGLASSAAGIAALVYALNDALGL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLK 200
                 LS++AR+GSGSACRS   GF  W  G+ ++G DS+       + W DL   +  
Sbjct: 126 GLSQRELSKIARIGSGSACRSTIGGFVIWEKGSQEDGEDSYCYQIFPEDHWEDLIDIIPL 185

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I  +EKK+ SR+ M+ T   S       + I   L  +  +I  +D  +      +++  
Sbjct: 186 IQLKEKKVSSRKGMKNTALSSSLMECRLKFIEDTLPLVIDSIKKKDEKEFYYWTMRHSNS 245

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA ++ + P   Y    + + ME + +         +T DAGPN  +  T K  + I Q
Sbjct: 246 MHAVILDSWPSFFYLNDTSFKIMEWIQEF----GNAAYTFDAGPNPHIFTTKKHLDEITQ 301

Query: 321 FFPEITIID 329
           +   I I D
Sbjct: 302 YLNSIGIKD 310


>gi|259500611|ref|ZP_05743513.1| diphosphomevalonate decarboxylase [Lactobacillus iners DSM 13335]
 gi|302191300|ref|ZP_07267554.1| mevalonate pyrophosphate decarboxylase [Lactobacillus iners AB-1]
 gi|259167995|gb|EEW52490.1| diphosphomevalonate decarboxylase [Lactobacillus iners DSM 13335]
          Length = 325

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 113/323 (34%), Positives = 174/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAVELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSQKDISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMQSFSYFQPTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|242372815|ref|ZP_04818389.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           M23864:W1]
 gi|242349487|gb|EES41088.1| mevalonate diphosphate decarboxylase [Staphylococcus epidermidis
           M23864:W1]
          Length = 326

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 122/324 (37%), Positives = 178/324 (54%), Gaps = 5/324 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +   A   +NIAL KYWGK D    +P+NNSLS++L    T T +T   S   D +ILNG
Sbjct: 2   KSGKARAHTNIALIKYWGKADEAYIIPMNNSLSITLDRFYTETKVTFDSSLTEDKLILNG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +K+  + +   K  ++ D+ R+ +   +Y +IE+ N +PT AGLASSAS +AAL  A   
Sbjct: 62  EKVDDKET--AKIQKYMDIVREVADTELYAVIESENFVPTSAGLASSASAYAALAAACNE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSA RS + GF EW  G D     +  +   +   +L +  
Sbjct: 120 ALHLGLSDKDLSRLARRGSGSASRSIFGGFAEWEKGHDDATSFAHPIDAQHWEDELSMIF 179

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M +TR  S F+  W   +  DLA  K+AI  +DF  LGEV E N 
Sbjct: 180 VVINNKSKKVSSRSGMSLTRDTSRFYQYWLDHVDQDLADAKEAIHHKDFKHLGEVIEANG 239

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +E+   M  V   R+  +P YFT+DAGPN+K+L   K ++ +
Sbjct: 240 LRMHATNLGAQPPFTYMVQESYDAMAIVHQCREAGLPCYFTMDAGPNVKVLVEKKNKQAV 299

Query: 319 KQFFPEITIIDPLDSPDLWSTKDS 342
              F +      + + D+ ST   
Sbjct: 300 IDQFLKAFDEKQIIASDIISTGVE 323


>gi|227890749|ref|ZP_04008554.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius ATCC
           11741]
 gi|227867687|gb|EEJ75108.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius ATCC
           11741]
          Length = 322

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 189/322 (58%), Gaps = 15/322 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           +  ++A   +NIAL KYWGK+D++L LP+NNSLSL+L H  T T +T   S   D  ILN
Sbjct: 2   SNHAAARAHTNIALIKYWGKKDTELILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A  
Sbjct: 62  GKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAAS 116

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP-FNNQWPDLRI 196
           +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVP   N   D+++
Sbjct: 117 KASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSWDIKM 174

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+AE+
Sbjct: 175 IAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANCSIPLMKEAISKQDFTTMGELAEE 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K   
Sbjct: 235 NAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKDTA 294

Query: 317 TIKQF----FPEITIIDPLDSP 334
           +I  F     P   ++     P
Sbjct: 295 SITSFLQKNLPNTEVLVSSAGP 316


>gi|302881821|ref|XP_003039821.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256720688|gb|EEU34108.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 391

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 103/325 (31%), Positives = 157/325 (48%), Gaps = 20/325 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD KLNLP N+SLS++L    L T+T  +  +S    D + 
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLSQADLRTLTTASCSNSYTSGDSLT 66

Query: 78  LNGQKISSQSSFFKKTTQFC-----------DLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +                 + S +   + + NN PT AGLASSA
Sbjct: 67  LNGESADVSGARTQACFRELRARRAALEAADSSLPKLSAMNLKLVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAAL  A+  +Y +P+    LS VAR GSGSACRS + G+  W  G   +G DS A  
Sbjct: 127 AGFAALVQAIALLYELPDSPSDLSLVARQGSGSACRSLFGGYVAWRMGEKDDGSDSKAEL 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           V   + WP++R  +L     +K + S   M+ T   S  F +     +  ++A +++A+ 
Sbjct: 187 VAPASHWPEMRALILVASAAKKGVSSTSGMQQTVATSGLFKERITNIVPANMALMEEAVK 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           ++DF K  EV  + +   HAT     PP+ Y    +   +  V D           +T D
Sbjct: 247 NKDFAKFAEVTMRESNSFHATCADTYPPIFYMNDVSRAAIRAVEDINTKAGKTVAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEIT 326
           AGPN  + +  +    +   F +  
Sbjct: 307 AGPNCVVYYLEENANAVLGTFYQAL 331


>gi|227510340|ref|ZP_03940389.1| diphosphomevalonate decarboxylase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227189992|gb|EEI70059.1| diphosphomevalonate decarboxylase [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 336

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 114/322 (35%), Positives = 175/322 (54%), Gaps = 12/322 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           N   +A   +NIAL KYWGK+D  L +P  +SLSL+L H  T T +   +S   D II++
Sbjct: 14  NNPVTARAHTNIALIKYWGKKDESLIIPYTSSLSLTLDHFYTDTTVWFDESLSTDQIIID 73

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ  S +S   ++   F ++ R  +++     I ++N++PT AGLASSAS FAAL  +  
Sbjct: 74  GQIPSEKS--RQRVHDFLEIVRGKAQIAIPASISSTNHVPTAAGLASSASAFAALAASAS 131

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-WPDLRI 196
               +   +  LS++AR GSGSACRS +  F EW  GT+    DS+A P  +    D+R+
Sbjct: 132 EAAGLHLDATELSKLARRGSGSACRSVFGHFVEWQRGTND--ADSYAKPLPDSGLNDIRV 189

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             L +   +K + SR+ M ++   SP++  W +    DL  +K AI   DF + G+++E 
Sbjct: 190 VALTVERGQKAVSSRQGMHLSVTTSPYYPAWVKTCQADLLQLKSAIEKGDFTRFGKISEL 249

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA++MHA  ++A P   Y+  +T+  M  V   R Q    Y+T+DAGPN+K+L       
Sbjct: 250 NAMRMHALTLSADPSFTYFNGQTLAIMNLVKQLRHQGTECYYTIDAGPNVKVLCQQSTVA 309

Query: 317 TIKQFFPEIT----IIDPLDSP 334
            I   F ++     +I     P
Sbjct: 310 KISATFAQVLGDQNVIIAKPGP 331


>gi|257877200|ref|ZP_05656853.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC20]
 gi|257811366|gb|EEV40186.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC20]
          Length = 332

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 130/332 (39%), Positives = 174/332 (52%), Gaps = 10/332 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
            K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +        D   L+G
Sbjct: 2   YKGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFTQDRFTLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  ++  KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A   
Sbjct: 62  VVQTDAAT--KKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSACRS Y GF EW  GT      +  VP N    +L +  
Sbjct: 120 ALDLNLSEQELSRLARRGSGSACRSIYGGFAEWHQGT-DETSFATQVPSNGWEEELSMIF 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I  + K++ SRE M  T   S F+  W    ++DL  +KQAI ++DF  LGE  E NA
Sbjct: 179 ILINAQAKEVSSREGMRRTVETSSFYPGWLSATASDLVKMKQAIAEKDFTALGETTEANA 238

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+TI
Sbjct: 239 LKMHGTTLAAEPPFTYWSSESLRAMECVRTLRKKGLACYFTMDAGPNVKVLCQKQEEQTI 298

Query: 319 K----QFFPEITIIDPLDSPDLWSTKDSLSQK 346
                  F    ++       L       S  
Sbjct: 299 LRELSAHFASEQLVTAHAGKGLAFLPVEESSP 330


>gi|90961661|ref|YP_535577.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius UCC118]
 gi|301300768|ref|ZP_07206952.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|90820855|gb|ABD99494.1| Diphosphomevalonate decarboxylase [Lactobacillus salivarius UCC118]
 gi|300851618|gb|EFK79318.1| diphosphomevalonate decarboxylase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 322

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 124/322 (38%), Positives = 189/322 (58%), Gaps = 15/322 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           +  ++A   +NIAL KYWGK+D++L LP+NNSLSL+L H  T T +T   S   D  ILN
Sbjct: 2   SNHAAARAHTNIALIKYWGKKDTELILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A  
Sbjct: 62  GKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAAS 116

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP-FNNQWPDLRI 196
           +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVP   N   D+++
Sbjct: 117 KASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSWDIKM 174

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+AE+
Sbjct: 175 IAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANRSIPLMKEAISKQDFTTMGELAEE 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K   
Sbjct: 235 NAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKDTA 294

Query: 317 TIKQF----FPEITIIDPLDSP 334
           +I  F     P   ++     P
Sbjct: 295 SITSFLQKNLPNTEVLVSSAGP 316


>gi|313885700|ref|ZP_07819449.1| diphosphomevalonate decarboxylase [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619065|gb|EFR30505.1| diphosphomevalonate decarboxylase [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 328

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 123/321 (38%), Positives = 179/321 (55%), Gaps = 9/321 (2%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
             ++     +NIAL KYWGKR+  L LP+ +SLSL+L    T T +    S   D   L+
Sbjct: 5   KYQARMRAHTNIALVKYWGKRNKNLFLPVTSSLSLTLDAFYTETEVLFDPSLKEDSFTLD 64

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ  + QS    K + F DLFR+     +   I + N++PT AGLASSAS FAAL  A  
Sbjct: 65  GQVQTGQS--LAKVSNFVDLFRRDFNMSLPVQITSRNHVPTAAGLASSASAFAALAAASN 122

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
           +   +    E +S  AR GSGSA RS + GF  W  G   +   S+A   +    D+ + 
Sbjct: 123 QALGLGLSPEEVSVYARQGSGSASRSLFGGFALWHKGQGDDSASSYAQQIDPADWDIAML 182

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           ++ +    KKI SR+ ME T   SPF+  W ++++ DL+ ++ AI D++  ++G +AE N
Sbjct: 183 VVLVNPGPKKISSRQGMEHTMQSSPFYALWPEEVAKDLSAMEDAIKDRNIDQIGIIAEHN 242

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           A+KMHATMIA++P   YWQ +++  MERV   RQ     YFT+DAGPN+K++  +   E 
Sbjct: 243 AMKMHATMIASNPSFTYWQAQSLLAMERVRQLRQAGYSAYFTMDAGPNVKVICPYSQVEA 302

Query: 318 IKQF----FPEITIIDPLDSP 334
           I+Q     F E  ++     P
Sbjct: 303 IRQALLDDFAEDHLVISRPGP 323


>gi|163753333|ref|ZP_02160457.1| mevalonate diphosphate decarboxylase [Kordia algicida OT-1]
 gi|161327065|gb|EDP98390.1| mevalonate diphosphate decarboxylase [Kordia algicida OT-1]
          Length = 360

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 87/341 (25%), Positives = 147/341 (43%), Gaps = 29/341 (8%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--- 72
                N   +   PSNIAL KYWGK++++  +P N S+S +L    T T ++        
Sbjct: 12  TEKIDNGTVTWKSPSNIALIKYWGKKEAQ--IPQNPSISFTLDACATTTKLSYHKKATKA 69

Query: 73  ---ADCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASS 125
              +  +   G++          F ++   +          +F IETSN+ P  +G+ASS
Sbjct: 70  AQFSFELFFEGKQKDDFKPKINTFLQRIEPYLPF---LKDYHFTIETSNSFPHSSGIASS 126

Query: 126 ASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
           ASG +AL L L  +        +    ++  S +ARLGSGSA RS       W    D  
Sbjct: 127 ASGMSALALCLMSLEKELNPSMTDEHFNQKASFLARLGSGSASRSIEGDLIVWGTHEDTV 186

Query: 179 GMDS-----FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIST 233
           G        +    +  + +    +L +   EK++ S        H+ PF  Q   Q   
Sbjct: 187 GSSDLFGIKYPYKVHEVFKNYHDTILLVDKGEKQVSSTVG-HNLMHNHPFAAQRFAQAHE 245

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ- 292
           +L  ++  + D D  +   + E  AL +HA M+ + P  +  +  T++ + R+W  RQ+ 
Sbjct: 246 NLTKMQSVLADGDLKEFIAIVESEALTLHAMMMTSMPYFILMKPNTLEIINRIWQFRQES 305

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
              + FTLDAG N+ +L+    ++ +  F     I    + 
Sbjct: 306 GTNVCFTLDAGANVHVLYPENEKDKVYPFIQSELIKFCQNG 346


>gi|282160515|gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
          Length = 417

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 106/354 (29%), Positives = 170/354 (48%), Gaps = 25/354 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
            +A  P NIA+ KYWGKRD  L LP+N+S+ +SL   HL T T ++V  S + D + LNG
Sbjct: 9   VTAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFEQDRMWLNG 68

Query: 81  QKISSQSSFFKKTTQFCDLFR---------------QFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++F I + NN PT AGLASS
Sbjct: 69  KEISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFPTAAGLASS 128

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G A    AL ++ ++ E +  LS +AR GSGSACRS Y GF +WI G ++NG DS AV
Sbjct: 129 AAGLACFVFALAKLLTLQEDNGQLSAIARRGSGSACRSLYGGFVKWIMGKEENGSDSIAV 188

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAI 242
              +   W DL I +  +  R+K+  S   M+ +   S        + +   +  ++ AI
Sbjct: 189 QLADEKHWDDLVIVIAVVSARQKETSSTTGMQDSCKTSMLIQHRAKEVVPKRILQMEDAI 248

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
             +DF     +A  ++ + HA  +  SPP+ Y    + + +  V    +   +  + +T 
Sbjct: 249 EKRDFPSFARLACADSNQFHAVCLDTSPPIFYINDTSHKIISCVEKWNRSVGTPQVAYTF 308

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
           DAGPN  L+   +  +        +    P  S    ++     +    ++G+ 
Sbjct: 309 DAGPNAVLI--ARDRKIAALLLRRLLFHFPPHSNTDSNSYVIGDKSILQDVGVQ 360


>gi|270290281|ref|ZP_06196506.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici 7_4]
 gi|304384905|ref|ZP_07367251.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici DSM
           20284]
 gi|270281062|gb|EFA26895.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici 7_4]
 gi|304329099|gb|EFL96319.1| diphosphomevalonate decarboxylase [Pediococcus acidilactici DSM
           20284]
          Length = 331

 Score =  329 bits (844), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 108/328 (32%), Positives = 168/328 (51%), Gaps = 11/328 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
            ++  A   +NIAL KYWGK DS+L +P N+S+SL+L    T T +   +    +   LN
Sbjct: 6   KKRGFARAHTNIALIKYWGKVDSELIIPANDSVSLTLDEFYTDTVVNFSEDYKVNEFWLN 65

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G  +  +     +  +  D  ++      +  I + N++PT AGLASSASG AAL  A  
Sbjct: 66  GNLMPYK--HMARINRVIDAVKEEYDYPGFAKIRSFNHVPTSAGLASSASGMAALAGAAA 123

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
                     ++SR+ARLGSGSA RS + G   W  G+D        V  N +  DL + 
Sbjct: 124 DALGDEHDLTNISRIARLGSGSASRSVFGGIVHWHRGSDHESSFVEQV-VNEKDIDLNMV 182

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
            + +   +K I S   M+ T   SPF+  W  + +  +  +  A+   DF K+GE+AE +
Sbjct: 183 TVVVNSHQKSIKSTNGMQRTVETSPFYPTWVSESNRMVPEMLAAVKKNDFTKIGELAEHS 242

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEE 316
           A+ MHAT +AA P   Y+Q +T++ +  V   R++  I  Y+T+DAGPN+K+L  +K   
Sbjct: 243 AMMMHATTLAAIPAFTYFQPDTLKVIRLVTQLRKEHGIECYYTIDAGPNVKVLCQNKDIL 302

Query: 317 TIKQF----FPEITIIDPLDSPDLWSTK 340
            I+ F    F E  ++       +  +K
Sbjct: 303 AIRNFLKNYFEERQLVIARPGSGIKFSK 330


>gi|255513677|gb|EET89942.1| diphosphomevalonate decarboxylase [Candidatus Micrarchaeum
           acidiphilum ARMAN-2]
          Length = 353

 Score =  329 bits (843), Expect = 5e-88,   Method: Composition-based stats.
 Identities = 101/341 (29%), Positives = 167/341 (48%), Gaps = 17/341 (4%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG-HLGTITHITVIDS-DADCIILNGQK 82
           +A   SNIA  KYWGKRD K+NLP N+S+S++L  ++GT T +       +D + +NG++
Sbjct: 7   TAIGSSNIAFIKYWGKRDGKINLPNNSSISMTLDRNVGTKTSVLFSSKLKSDRLFINGKE 66

Query: 83  ISSQSSFFKK---TTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALF 137
            + +    +K    ++     ++ + +    LI + NN P+ +GLASSASG A L   L 
Sbjct: 67  ENIKEGANEKSRFISEMLAYCKKAAGINTNALIVSENNFPSDSGLASSASGGATLAFLLS 126

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLR 195
               +   S  +S +AR  SGSACRS Y G  +W  G+ Q+G DSFA    +   WPDL 
Sbjct: 127 NALDLKMDSREISIMARKISGSACRSVYGGIVKWDAGSKQDGSDSFAEQVVDHRYWPDLM 186

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  +   +KK+ S     IT   S  +    Q     +  +  A+ ++DF  L E   
Sbjct: 187 DIIAIVDPSKKKVSSSAGHAITVKTSSLYRVRPQVAEEGVKKVVNAVTNKDFQVLAETVM 246

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHK 313
           +++  MHATM+ + PP++Y    +   +  + +    +      +T DAGPN  ++ T  
Sbjct: 247 RDSNNMHATMMDSWPPIMYLSDASRSIIYAMHELNESEGKYVAAYTFDAGPNAHIITTSS 306

Query: 314 IEETIKQFFPEITIIDP------LDSPDLWSTKDSLSQKNS 348
               + +   EI +            P++   ++SL  + S
Sbjct: 307 NRSKVIKMLEEIGVARSIIESKMGAGPEMLEGEESLIDQES 347


>gi|227544619|ref|ZP_03974668.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri CF48-3A]
 gi|300910251|ref|ZP_07127711.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri SD2112]
 gi|227185402|gb|EEI65473.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri CF48-3A]
 gi|300892899|gb|EFK86259.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri SD2112]
          Length = 323

 Score =  329 bits (843), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 115/324 (35%), Positives = 178/324 (54%), Gaps = 12/324 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T +   +   +D + ++ Q 
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQQT 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  KK     D+ RQ S +     +E+ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--KKVVHVLDIVRQLSGIKAFARVESINHVPTAAGLASSASAFAALAGAASTAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   S  LSR+AR GSGSA RS Y G  EW  GTD     +  V  N  +P + +  + 
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDDASSFAQPVLENVDFP-IEMLAVL 178

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +  + KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NAL+
Sbjct: 179 VDTKRKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENALR 238

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA   +A P   Y+  ET+  ++ V D R Q I  Y+T+DAGPN+K+++  +    I +
Sbjct: 239 MHALTFSADPGFTYFNGETLTIIKAVEDLRNQGINCYYTMDAGPNVKVIYDRENRSKIVE 298

Query: 321 FFPEI------TIIDPLDSPDLWS 338
               I       +  P     +W+
Sbjct: 299 KLSNIVGPERLVVSQPGPGIKIWN 322


>gi|305666246|ref|YP_003862533.1| diphosphomevalonate decarboxylase [Maribacter sp. HTCC2170]
 gi|88708237|gb|EAR00474.1| diphosphomevalonate decarboxylase [Maribacter sp. HTCC2170]
          Length = 360

 Score =  328 bits (842), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 94/352 (26%), Positives = 165/352 (46%), Gaps = 31/352 (8%)

Query: 7   HILHRYI-GECNPKIN-EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
             ++ ++  + + ++   K +   PSNIAL KYWGK++ +  +P N S+S +L    T T
Sbjct: 1   MTINDFLPTKYSQQVEEGKVTYKAPSNIALVKYWGKKEDQ--IPANPSISFTLDACATTT 58

Query: 65  HITVIDSDA------DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSN 114
            I+              ++  G+   S       FF++  ++    R     +  I TSN
Sbjct: 59  TISYSKLKEEAKSFSFELLFEGKSKESFKPKIRTFFERIAKYMPFLRD---YHLKIVTSN 115

Query: 115 NIPTKAGLASSASGFAALTLALFRIY-------SIPEKSESLSRVARLGSGSACRSFYRG 167
           + P  +G+ASSASG +A+ L L  I             +   S +ARLGSGSACRS    
Sbjct: 116 SFPHSSGIASSASGMSAMALCLMHIESELNPEIDKEYFNRKASFLARLGSGSACRSIEGD 175

Query: 168 FCEWI-CGTDQNGMDSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSP 222
             +W   G  +   D FA+ +    +N +      +L +   +K++ S        H  P
Sbjct: 176 LIQWGSHGPTKGSSDLFAIKYPYNVHNIFQKYHDTILLVDKGQKQVSSTIG-HDLMHGHP 234

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           F  Q   Q + +L+ +K      D ++  ++ E  AL +HA M+A+ P  +  +  T+Q 
Sbjct: 235 FAEQRFTQANDNLSKLKNVFASGDLVEFIKIVESEALTLHAMMMASMPYFILMKPNTLQI 294

Query: 283 MERVWDARQ-QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           + ++W+ R+  +  + FTLDAG N+ +L+    +ET+ QF  +  +    + 
Sbjct: 295 INKIWEFRKTSNTHVCFTLDAGANVHVLYPENEKETVYQFIKDELVAFCENG 346


>gi|260663061|ref|ZP_05863954.1| diphosphomevalonate decarboxylase [Lactobacillus fermentum
           28-3-CHN]
 gi|260552682|gb|EEX25682.1| diphosphomevalonate decarboxylase [Lactobacillus fermentum
           28-3-CHN]
          Length = 329

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 113/328 (34%), Positives = 179/328 (54%), Gaps = 10/328 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
            ++A   +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+
Sbjct: 2   TTTARAHTNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +S+  +  +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  + 
Sbjct: 62  LVSANKA--QKVVKFMDLVRQLSGRTEYAQIASVNNVPMAAGLASSASAFAALAGAAAKD 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS Y G  EW  G D     +  V     + D+ +  +
Sbjct: 120 AGLDLSLKDLSRLARRGSGSATRSVYGGLVEWHRGVDDATSFAEPVQEVPDF-DIAMLAI 178

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +   +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL
Sbjct: 179 LVDTSQKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENAL 238

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ + 
Sbjct: 239 RMHALNLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDLL 298

Query: 320 Q----FFPEITIIDPLDSPDLWSTKDSL 343
                 F    ++     P +    + +
Sbjct: 299 NALTPLFGAERLVVANPGPGIEFLTEPV 326


>gi|321472661|gb|EFX83630.1| hypothetical protein DAPPUDRAFT_301631 [Daphnia pulex]
          Length = 378

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 99/328 (30%), Positives = 152/328 (46%), Gaps = 17/328 (5%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCII 77
           +  S+   P NIA+ KYWGK D +  +PLN+S+S++L    + T T  T+      D I+
Sbjct: 5   SRSSTCIAPINIAVIKYWGKSDEEQIIPLNDSISITLDTDYMFTKTTATIGPEFTQDSIV 64

Query: 78  LNGQKISSQSSFFKKTTQFCDLFR---------QFSKVYFLIETSNNIPTKAGLASSASG 128
           LN ++ S     F+                   + S     I + NN PTKAGLASSASG
Sbjct: 65  LNNEQGSGDGVRFQNCLSEIRKLAASSKHSSTVEKSTWKVAIVSENNFPTKAGLASSASG 124

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
           +A L   L ++Y +      LS +AR GSGSACRS + GF  W    D     +  +   
Sbjct: 125 YACLVFTLAQLYELESHQSELSALARRGSGSACRSLFGGFVRWFH--DSQPCIARPIAEA 182

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
             WP+LR  +  + +  K +GS E M  +   S       + +  D +  +K AI++++F
Sbjct: 183 EHWPELRCLVAVVSNTSKSVGSTEGMRRSAETSKLLEHRVKHVVRDRIEDMKMAILEKNF 242

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPN 305
           +K  E+  +++ + HA  +   PPL Y    +   ++ V    Q  +SI + +T DAGPN
Sbjct: 243 VKFAEITMRDSNQFHAICLDTYPPLFYMNSTSQAIIQLVHRYNQIRRSIKVAYTFDAGPN 302

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDS 333
             L             F  +    P D 
Sbjct: 303 AVLFLEQAEISRFASVFYSVFGSTPHDQ 330


>gi|146299149|ref|YP_001193740.1| GHMP kinase [Flavobacterium johnsoniae UW101]
 gi|146153567|gb|ABQ04421.1| GHMP kinase [Flavobacterium johnsoniae UW101]
          Length = 368

 Score =  328 bits (842), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 85/341 (24%), Positives = 148/341 (43%), Gaps = 34/341 (9%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-------- 72
           N       PSNIAL KYWGK+  +  +P N S+S +L +  TIT ++    D        
Sbjct: 18  NGSFEWSAPSNIALVKYWGKK--ENQIPANPSVSFTLNNCKTITKLSFSKKDASTSLNVT 75

Query: 73  ---ADCIILNGQKISSQSSFFKKTTQFCD----LFRQFSKVYFLIETSNNIPTKAG---- 121
              +  ++  G+    +  F  K  +F +          + +F I+T N  P  +G    
Sbjct: 76  NSFSFDLLFEGKP---KEDFKPKIQKFLERVEVYLPFLKEYHFTIDTQNTFPHSSGIASS 132

Query: 122 ---LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
              +A+ A  F +L   L    +     +  S +ARLGSGSACRS       W    +  
Sbjct: 133 ASGMAALAMNFMSLERKLNPEMADDYFYQKASFLARLGSGSACRSVKGNVVVWGNQANIE 192

Query: 179 GMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIST 233
           G        F    +  + + +  +L +   EK++ S        H+ P+  +   Q   
Sbjct: 193 GSTDLFGVEFPYTIHENFKNYQDTILLVDKGEKQVSSTVG-HDLMHNHPYAERRFAQAHE 251

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS 293
           +L  +       +  +  +V E  AL +HA M+ + P  +  +  T+Q +  +W  R ++
Sbjct: 252 NLDKLIAIFEKGNLNEFIKVVESEALTLHAMMMTSMPYFILMKPNTLQIINAIWKFRNET 311

Query: 294 -IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
            IP+ FTLDAG N+ +L+   ++E + QF  +  ++   +S
Sbjct: 312 QIPVCFTLDAGANVHVLYPENVKEKVLQFIQDELVVFCQNS 352


>gi|227514851|ref|ZP_03944900.1| possible diphosphomevalonate decarboxylase [Lactobacillus fermentum
           ATCC 14931]
 gi|227086783|gb|EEI22095.1| possible diphosphomevalonate decarboxylase [Lactobacillus fermentum
           ATCC 14931]
          Length = 329

 Score =  328 bits (841), Expect = 9e-88,   Method: Composition-based stats.
 Identities = 113/328 (34%), Positives = 179/328 (54%), Gaps = 10/328 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
            ++A   +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+
Sbjct: 2   TTTARAHTNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +S+  +  +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  + 
Sbjct: 62  LVSANKA--QKVVKFMDLVRQLSGRTEYAQIASVNNVPMAAGLASSASAFAALAGAAAKD 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS Y G  EW  G D     +  V     + D+ +  +
Sbjct: 120 AGLDLSLKDLSRLARRGSGSATRSVYGGLVEWHRGVDDATSFAEPVQEVPDF-DIAMLAI 178

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +   +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL
Sbjct: 179 LVDTSQKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENAL 238

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ + 
Sbjct: 239 RMHALNLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDLL 298

Query: 320 Q----FFPEITIIDPLDSPDLWSTKDSL 343
                 F    ++     P +    + +
Sbjct: 299 NALTPLFGAERLVVAKPGPGIEFLTEPV 326


>gi|126662475|ref|ZP_01733474.1| mevalonate diphosphate decarboxylase [Flavobacteria bacterium
           BAL38]
 gi|126625854|gb|EAZ96543.1| mevalonate diphosphate decarboxylase [Flavobacteria bacterium
           BAL38]
          Length = 361

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 89/346 (25%), Positives = 156/346 (45%), Gaps = 28/346 (8%)

Query: 10  HRYIGECNPKINEKS-SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV 68
             +I      I   +     PSNIAL KYWGK+  +  +P N S+S +L +  TIT + V
Sbjct: 5   KDFISTTYNSIESANFEWSAPSNIALVKYWGKK--ENQIPANPSISFTLNNCKTITKLEV 62

Query: 69  ID-----SDADCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTK 119
           +      S +  ++  G+           FF++  Q+C   ++    +F I+T N  P  
Sbjct: 63  VKKLDINSFSFDLLFEGKPKEDFKPKIQKFFERIEQYCPFLKE---YHFKIDTQNTFPHS 119

Query: 120 AG-------LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWI 172
           +G       +A+ A    +L  A+    S        S +ARLGSGSACRS       W 
Sbjct: 120 SGIASSASGMAALAMNIMSLEKAINPTISDEYFYSKASFLARLGSGSACRSIKGEVVVWG 179

Query: 173 CGTDQN-GMDSFAVP---FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT 228
             T+ N   D F V     +  + + +  +L +   EK++ S        H+ P+  +  
Sbjct: 180 NHTEINGSSDLFGVEFSEIHQDFKNYQDTILLVDKGEKQVSSTVG-HDLMHNHPYAERRF 238

Query: 229 QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD 288
            Q   +L+ IK  +   +  +  ++ E  AL +HA M+ + P  +  +  T++ + ++W 
Sbjct: 239 TQAHENLSKIKAILTTGNIEEFIKIVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWK 298

Query: 289 ARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
            R ++ IP+ FTLDAG N+ +L+   ++  + QF  +  +      
Sbjct: 299 FRNETQIPVCFTLDAGANVHVLYPENVKHKVLQFIQDELVGYCQKG 344


>gi|184155669|ref|YP_001844009.1| mevalonate diphosphate decarboxylase [Lactobacillus fermentum IFO
           3956]
 gi|183227013|dbj|BAG27529.1| mevalonate diphosphate decarboxylase [Lactobacillus fermentum IFO
           3956]
          Length = 329

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/328 (34%), Positives = 179/328 (54%), Gaps = 10/328 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
            ++A   +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+
Sbjct: 2   TTTARAHTNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +S+  +  +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  + 
Sbjct: 62  LVSANKA--QKVVKFMDLVRQLSGRTEYAQITSVNNVPMAAGLASSASAFAALAGAAAKD 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS Y G  EW  G D     +  V     + D+ +  +
Sbjct: 120 AGLDLSLKDLSRLARRGSGSATRSVYGGLVEWHRGVDDATSFAEPVQEVPDF-DIAMLAI 178

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +   +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL
Sbjct: 179 LVDTSQKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENAL 238

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  +AA P   Y+  +TI  M+ +   R++ +  Y+T+DAGPN+K++F  K ++ + 
Sbjct: 239 RMHALNLAADPGFTYFDGQTILAMQTIDRLREEGLNCYYTMDAGPNVKVIFDPKDQDDLL 298

Query: 320 Q----FFPEITIIDPLDSPDLWSTKDSL 343
                 F    ++     P +    + +
Sbjct: 299 NALTPLFGAERLVVAKPGPGIEFLTEPV 326


>gi|312874200|ref|ZP_07734234.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2052A-d]
 gi|311090270|gb|EFQ48680.1| diphosphomevalonate decarboxylase [Lactobacillus iners LEAF
           2052A-d]
          Length = 325

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/323 (34%), Positives = 174/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ ++
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTETEFTHNVDLANDMVIMNGKAVN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTMLAVELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSQKDISSTCGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMQSFSYFQSTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKSVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|309809852|ref|ZP_07703702.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN
           2503V10-D]
 gi|308169804|gb|EFO71847.1| diphosphomevalonate decarboxylase [Lactobacillus iners SPIN
           2503V10-D]
          Length = 325

 Score =  328 bits (840), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 113/323 (34%), Positives = 173/323 (53%), Gaps = 11/323 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKIS 84
           A   +NIAL KYWGK DS L +PL +S+S++L    T T  T   D   D +I+NG+ + 
Sbjct: 5   ARAHTNIALIKYWGKADSSLKIPLMSSISMTLDAFYTDTEFTHNVDLANDMVIMNGKAVD 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q+S+  +   +    +       +F I+T N++PT AGLASSASGFAAL  +    Y++
Sbjct: 65  DQASY--RIINYVKKLQDIYGFNDHFCIKTENHVPTAAGLASSASGFAALATSFAASYNL 122

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               + LSR+ARLGSGSA RS + GF EW  G D     +F +  + Q  DL +  +++ 
Sbjct: 123 NLNRQELSRIARLGSGSATRSIFGGFVEWQKGYDDQTSFAFPINEHPQ-MDLTLLAIELD 181

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              K+I S   M+     SPF+  W  +   +++ ++ AI + +F +LGE++E +A +MH
Sbjct: 182 VSPKEISSTRGMK-IAQTSPFYQTWLNRNKQEISEMESAIKNNNFTRLGELSELSANEMH 240

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           +  + A     Y+Q  TI  M  V + R+  I  Y+T+DAGPN+K+L   K  E I +  
Sbjct: 241 SLNLTAMQSFSYFQSTTITIMNLVRNLRKNGIECYYTIDAGPNVKILCQDKNVEDICKAI 300

Query: 323 PE----ITIIDPLDSPDLWSTKD 341
                 + II     P +     
Sbjct: 301 HNTLDSVKIIKSKFGPGVQIINC 323


>gi|300214466|gb|ADJ78882.1| Diphosphomevalonate decarboxylase [Lactobacillus salivarius CECT
           5713]
          Length = 322

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 123/322 (38%), Positives = 188/322 (58%), Gaps = 15/322 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           +  ++A   +NIAL KYWGK+D++  LP+NNSLSL+L H  T T +T   S   D  ILN
Sbjct: 2   SNHAAARAHTNIALIKYWGKKDTEFILPMNNSLSLTLDHFYTDTSVTFDSSYTKDTFILN 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G++I +++       +F ++ R+ + +  +  + ++N++PT AGLASSAS FAAL  A  
Sbjct: 62  GKEIPNEN-----VHKFLNIVREKAGISEFAKVNSTNHVPTTAGLASSASAFAALAAAAS 116

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP-FNNQWPDLRI 196
           +   +      LSR+AR GSGSA RS Y GF EW  G   N ++S+AVP   N   D+++
Sbjct: 117 KASGMNLSRRDLSRLARRGSGSATRSIYGGFVEWQAG--DNDLNSYAVPFIENVSWDIKM 174

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             + I  + KKI SR  M+   + SP++  W ++ +  +  +K+AI  QDF  +GE+AE+
Sbjct: 175 IAVVINSKPKKITSRAGMQTVVNTSPYYNSWIKEANRSIPLMKEAISKQDFTTMGELAEE 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA+KMHA  ++A P   Y+  E+IQ M  V + R   I  Y+T+DAGPN+K++   K   
Sbjct: 235 NAMKMHALNLSAHPHFSYFSPESIQVMNLVEELRSMGIECYYTMDAGPNVKIICLGKDTA 294

Query: 317 TIKQF----FPEITIIDPLDSP 334
           +I  F     P   ++     P
Sbjct: 295 SITSFLQKNLPNTEVLVSSAGP 316


>gi|301097882|ref|XP_002898035.1| diphosphomevalonate decarboxylase [Phytophthora infestans T30-4]
 gi|262106480|gb|EEY64532.1| diphosphomevalonate decarboxylase [Phytophthora infestans T30-4]
          Length = 422

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 94/316 (29%), Positives = 150/316 (47%), Gaps = 16/316 (5%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHIT-VIDSDADCIILNG 80
           ++   P+NIA+ KYWGK D  LN P+N+S+S++L    L T T +    +  +  + LNG
Sbjct: 4   ATCSAPTNIAVIKYWGKDDVALNTPINSSVSVTLHQNQLRTTTSVAGGSELQSTRLWLNG 63

Query: 81  QKISSQSS---FFKKTTQFCDLFRQFSK-VYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           Q+           ++  Q        S   +  I ++N+ PT AGLASSA+G+A L  AL
Sbjct: 64  QEQPINKRVTVVLREMQQLAQRVHGESDPQHLHIVSTNSFPTAAGLASSAAGYACLVAAL 123

Query: 137 FRIYS----IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--Q 190
              Y       E +  LS +AR GSGSACRS   GF  W  G   +G DS AV   +   
Sbjct: 124 AEFYGVSKADEEFTGQLSAIARQGSGSACRSLDGGFVAWQKGERPDGHDSIAVQVADELH 183

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIK 249
           WP+L   +  + D +K   S   M+ ++  S       +  +   +  ++QAI+ +DF  
Sbjct: 184 WPELCAVVCVVNDAQKDTSSTTGMQTSKATSSLLAYRAKHLVPERMQTMEQAILARDFEA 243

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ--SIPIYFTLDAGPNLK 307
            G +  +++   HAT +  +PP+ Y    + Q +  V    +Q   +   +T DAGPN  
Sbjct: 244 FGTLTMQDSNHFHATCLDTTPPIFYLNDVSRQIIHLVHRYNKQAGRVQAAYTFDAGPNAV 303

Query: 308 LLFTHKIEETIKQFFP 323
           +    +  + +     
Sbjct: 304 IFVEEQHVQEVVSLVH 319


>gi|73663430|ref|YP_302211.1| mevalonate diphosphate decarboxylase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72495945|dbj|BAE19266.1| mevalonate diphosphate decarboxylase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 327

 Score =  327 bits (839), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 123/327 (37%), Positives = 185/327 (56%), Gaps = 5/327 (1%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
               A   +NIAL KYWGK D    +P+NNSLS++L    T T +T  +S   D +ILNG
Sbjct: 3   NSGKARAHTNIALIKYWGKADETYIIPMNNSLSVALERFYTETKVTFDESYTKDTLILNG 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           + +++  S   K ++F D+ R  S   ++  IE+ N++PT AGLASSAS +AAL  A  +
Sbjct: 63  ETVTASES--AKISRFMDIVRATSGTTMFAYIESDNHVPTAAGLASSASAYAALAAACDK 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
             ++    + LSR+AR GSGSA RS Y GF EW  G D     SF +  ++   +L +  
Sbjct: 121 ALNLGLTGKGLSRLARRGSGSASRSIYGGFVEWEKGHDDESSYSFPIEADHWEQELAMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I ++ KK+ SR  M  TR  S F+  W   +  D+A +K AI  +DF+++GEV E N 
Sbjct: 181 VVINNKTKKVSSRAGMSHTRDTSRFYQYWLNHVDEDIASVKHAIERKDFMQMGEVIEANG 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L+MHAT + A PP  Y  +++   M+ V   R+   P YFT+DAGPN+K+L   K ++ +
Sbjct: 241 LRMHATNLGAQPPFTYMVEDSYLAMDIVDQCRKAGYPCYFTMDAGPNVKILVEKKNQQAV 300

Query: 319 KQFFPEITIIDPLDSPDLWSTKDSLSQ 345
                +    D + + D+ ST   + +
Sbjct: 301 IDALHKSFDKDQIIASDIISTGVEIIE 327


>gi|260584343|ref|ZP_05852090.1| diphosphomevalonate decarboxylase [Granulicatella elegans ATCC
           700633]
 gi|260157861|gb|EEW92930.1| diphosphomevalonate decarboxylase [Granulicatella elegans ATCC
           700633]
          Length = 341

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 127/331 (38%), Positives = 188/331 (56%), Gaps = 12/331 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK+D  L LP+N+SLSL+L    T T IT+  + + D   LN     
Sbjct: 7   ARAHTNIALIKYWGKKDKALFLPMNSSLSLTLEAFYTDTKITLDKTLEKDEFYLNNVLQ- 65

Query: 85  SQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            Q +  +K ++F DLFR  +K   +  IE+ N +PT AGLASSAS FAAL  A+ +    
Sbjct: 66  -QEAEIQKISKFLDLFRIPAKETRFARIESYNFVPTAAGLASSASAFAALAGAMHQAMGW 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LS  AR GSGS+ RS + GF EW  GT  N  DS A+P ++   D+ + ++ + 
Sbjct: 125 DLSRSELSTYARRGSGSSTRSLFGGFVEWNQGT--NSEDSMAIPIDDASWDIGMLIVVVN 182

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KKI SR  ME T   SPF+  W +   TDL  IK AI +++F ++GE+AE N +KMH
Sbjct: 183 GAAKKISSRVGMEQTVATSPFYPAWVESAKTDLEEIKIAIQEKNFTRMGEIAEFNGMKMH 242

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQ-QSIPIYFTLDAGPNLKLLFTHKIEETIK-- 319
           ATM+A+ PP  Y++ +++   ++V   R+   IP Y+T+DAGPN+K+L      + ++  
Sbjct: 243 ATMLASQPPFCYFEPDSLIAQQQVVYLREVLGIPAYYTMDAGPNIKVLCKASDLDKVRDH 302

Query: 320 --QFFPEITIIDPLDSPDLWSTKDSLSQKNS 348
             Q+F    +I       + +  +   Q++ 
Sbjct: 303 FEQYFASEKLITSHPGEAMRTLTEEEWQESI 333


>gi|325285752|ref|YP_004261542.1| diphosphomevalonate decarboxylase [Cellulophaga lytica DSM 7489]
 gi|324321206|gb|ADY28671.1| diphosphomevalonate decarboxylase [Cellulophaga lytica DSM 7489]
          Length = 360

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 88/340 (25%), Positives = 149/340 (43%), Gaps = 29/340 (8%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA 73
              N  +        PSNIAL KYWGK+  +  +P N S+S +L    T T +T    D+
Sbjct: 10  SYTNTVLEGTVKWKSPSNIALVKYWGKK--ENQIPANPSISFTLDACATTTSVTYKKLDS 67

Query: 74  ------DCIILNGQKISSQ----SSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
                   +   G+          +F  +   +    ++    +F IETSN+ P  +G+A
Sbjct: 68  KADNFSFDLFFEGKPKEDFKPKIETFLTRIEAYLPFIKE---YHFKIETSNSFPHSSGIA 124

Query: 124 SSASGFAALTLALFRIYS-------IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           SSASG +AL L L  +             +   S +ARLGSGSACRS      +W    +
Sbjct: 125 SSASGMSALALCLMSVEKELNPSITTAFFNNKASFLARLGSGSACRSIEGPLVQWGNHAN 184

Query: 177 QNGM-----DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI 231
             G        +    ++ + +    +L +   +K++ S        H+ PF  +   Q 
Sbjct: 185 TKGSTDLFGIKYPNEVHSVFKNYHDTILLVDKGQKQVSSTVG-HNLMHNHPFAKERFAQA 243

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ 291
            T+L  ++    + +  +  E+ E  AL +HA M+ + P  +  +  T+Q + ++W+ R 
Sbjct: 244 HTNLDELQTVFKEGNLKRFVEIVESEALTLHAMMMTSMPYFILMKPNTLQIINKIWEFRA 303

Query: 292 -QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
                I FTLDAG N+ +L+    +E + QF  +  +   
Sbjct: 304 INKSNICFTLDAGANVHVLYPENEKEVVYQFIKDELVAYC 343


>gi|257867121|ref|ZP_05646774.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC30]
 gi|257873456|ref|ZP_05653109.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC10]
 gi|257801177|gb|EEV30107.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC30]
 gi|257807620|gb|EEV36442.1| mevalonate diphosphate decarboxylase [Enterococcus casseliflavus
           EC10]
          Length = 332

 Score =  327 bits (838), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 130/332 (39%), Positives = 175/332 (52%), Gaps = 10/332 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
            K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +        D   L+G
Sbjct: 2   YKGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFTQDRFTLDG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  ++  KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A   
Sbjct: 62  VVQTDAAT--KKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSE 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    ++LSR+AR GSGSACRS Y GF EW  GT      +  VP N    +L +  
Sbjct: 120 ALDLNLSEQALSRLARRGSGSACRSIYGGFAEWHQGT-DETSFATQVPSNGWEEELSMIF 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I  + K++ SRE M  T   S F+  W    ++DL  +KQAI ++DF  LGE  E NA
Sbjct: 179 ILINAQAKEVSSREGMRRTVETSSFYPGWLSATASDLVKMKQAIAEKDFTALGETTEANA 238

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+TI
Sbjct: 239 LKMHGTTLAAEPPFTYWSSESLRAMECVRMLRKKGLACYFTMDAGPNVKVLCQKQEEQTI 298

Query: 319 K----QFFPEITIIDPLDSPDLWSTKDSLSQK 346
                  F    ++       L       S  
Sbjct: 299 LRELSAHFASEQLVTAHAGKGLAFLPVEESSP 330


>gi|150024415|ref|YP_001295241.1| diphosphomevalonate decarboxylase [Flavobacterium psychrophilum
           JIP02/86]
 gi|149770956|emb|CAL42423.1| Diphosphomevalonate decarboxylase [Flavobacterium psychrophilum
           JIP02/86]
          Length = 360

 Score =  326 bits (837), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 84/330 (25%), Positives = 150/330 (45%), Gaps = 28/330 (8%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD-----ADCIILNG 80
              PSNIAL KYWGK+  +  +P N S+S +L +  TIT ++    D     +  ++  G
Sbjct: 23  WSAPSNIALVKYWGKK--ENQIPANPSISFTLNNCKTITKLSFAKKDNHDDFSFDLLFEG 80

Query: 81  QKISSQ----SSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAG-------LASSASGF 129
           +          +FF++   +C         +F I+T N  P  +G       +A+ A   
Sbjct: 81  KPKEEFKTKIQNFFERIAMYCPF---LKDYHFTIDTQNTFPHSSGIASSASGMAALAMNI 137

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD-QNGMDSFAVP-- 186
            +L  AL    +     +  S +ARLGSGSACRS       W          + F V   
Sbjct: 138 MSLEKALNPSMNDDYFYKKASFLARLGSGSACRSVKGSIVVWGENDSVAGSSNLFGVEFS 197

Query: 187 --FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
              +  + + +  +L +   EK++ S        H+ P+  +  +Q   +L+ IK  + +
Sbjct: 198 STIHQNFKNYQDTILLVDKGEKQVSSTVG-HDLMHNHPYANRRFEQAHENLSKIKTVLEN 256

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAG 303
            +  +  ++ E  AL +HA M+ + P  +  +  T++ + ++W  R + +IP+ FTLDAG
Sbjct: 257 GNLDEFIKIVENEALTLHAMMMTSMPYFILMKPNTLEIINKIWKFRNENNIPVCFTLDAG 316

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
            N+ +L+    +E I QF  +  +    + 
Sbjct: 317 ANVHVLYPENKKEIILQFIKDELVGYCQNG 346


>gi|194468008|ref|ZP_03073994.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri 100-23]
 gi|194452861|gb|EDX41759.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri 100-23]
          Length = 323

 Score =  326 bits (837), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 111/324 (34%), Positives = 177/324 (54%), Gaps = 12/324 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D  L +P  +SLSL+L    T T +   +   +D + ++   
Sbjct: 2   ATAKAHTNIALVKYWGKKDQDLIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQHI 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  +K     D+ RQ S +     +++ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--QKVVHVLDIVRQLSGIKSFARVDSINHVPTAAGLASSASAFAALAGAASTAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   S  LSR+AR GSGSA RS Y G  EW  GTD +   +  V  N  +P + +  + 
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDDDSSFAQPVLENVDFP-IEMLAVL 178

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +  ++KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NAL+
Sbjct: 179 VDTKKKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENALR 238

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA   +A P   Y+  ET+  ++ V D R Q +  Y+T+DAGPN+K+++       I +
Sbjct: 239 MHALTFSADPGFTYFNGETLTIIKAVEDLRNQGVNCYYTMDAGPNVKVIYDRGNRSKIVE 298

Query: 321 FFPEI------TIIDPLDSPDLWS 338
               I       +  P     +W+
Sbjct: 299 ELSNIVGPERLVVSQPGPGIKIWN 322


>gi|325568464|ref|ZP_08144831.1| diphosphomevalonate decarboxylase [Enterococcus casseliflavus ATCC
           12755]
 gi|325158233|gb|EGC70386.1| diphosphomevalonate decarboxylase [Enterococcus casseliflavus ATCC
           12755]
          Length = 334

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 132/330 (40%), Positives = 175/330 (53%), Gaps = 10/330 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
            K  A   +NIAL KYWGK+D    LP+NNSLSL+L    T T +        DC  L+G
Sbjct: 4   YKGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFPQDCFTLDG 63

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
              +  ++  KK   F DL R+ +    Y  +E+ N +PT AGLASSASG AAL  A   
Sbjct: 64  VVQTDVAT--KKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSE 121

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +    + LSR+AR GSGSACRS Y GF EW  GT      +  VP N    +L +  
Sbjct: 122 ALDLNLSEQELSRLARRGSGSACRSIYGGFAEWHQGT-DETSFATQVPSNGWEEELSMIF 180

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           + I  + K++ SRE M  T   S F+  W    +TDL  +KQAI ++DF  LGE  E NA
Sbjct: 181 ILINAQAKEVSSREGMRRTVETSSFYPGWLTATATDLVKMKQAIAEKDFTALGETTEANA 240

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           LKMH T +AA PP  YW  E+++ ME V   R++ +  YFT+DAGPN+K+L   + E+TI
Sbjct: 241 LKMHGTTLAAEPPFTYWSSESLRAMECVRMLRKKGLACYFTMDAGPNVKVLCQKQEEQTI 300

Query: 319 K----QFFPEITIIDPLDSPDLWSTKDSLS 344
                  F    ++       L       S
Sbjct: 301 LRELSAHFASEQLVTAHAGKGLAFLPVEES 330


>gi|148544143|ref|YP_001271513.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri DSM 20016]
 gi|184153516|ref|YP_001841857.1| mevalonate diphosphate decarboxylase [Lactobacillus reuteri JCM
           1112]
 gi|227364572|ref|ZP_03848633.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM2-3]
 gi|325682313|ref|ZP_08161830.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM4-1A]
 gi|148531177|gb|ABQ83176.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri DSM 20016]
 gi|183224860|dbj|BAG25377.1| mevalonate diphosphate decarboxylase [Lactobacillus reuteri JCM
           1112]
 gi|227070409|gb|EEI08771.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM2-3]
 gi|324978152|gb|EGC15102.1| diphosphomevalonate decarboxylase [Lactobacillus reuteri MM4-1A]
          Length = 323

 Score =  326 bits (836), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 111/324 (34%), Positives = 177/324 (54%), Gaps = 12/324 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D  L +P  +SLSL+L    T T +   +   +D + ++   
Sbjct: 2   ATAKAHTNIALVKYWGKKDQDLIIPQTDSLSLTLNEFYTTTTVNFDNHLTSDLVAIDQHI 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S + +  +K     D+ RQ S +     +++ N++PT AGLASSAS FAAL  A     
Sbjct: 62  LSKKEA--QKVAHVLDIVRQLSGIKSFARVDSINHVPTAAGLASSASAFAALAGAASVAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   S  LSR+AR GSGSA RS Y G  EW  GTD +   +  V  N  +P + +  + 
Sbjct: 120 GLNLSSRDLSRLARRGSGSATRSIYGGLVEWQKGTDDDSSFAQPVLENVDFP-IEMLAVL 178

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +  ++KK+ SR  M+ +   SP++  W Q ++ D+  IK+AI  +D  ++G +AE+NAL+
Sbjct: 179 VDTKKKKVSSRSGMQSSVETSPYYDAWRQVVANDMVAIKKAIKAKDIDQIGHIAEENALR 238

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA   +A P   Y+  ET+  ++ V D R Q +  Y+T+DAGPN+K+++       I +
Sbjct: 239 MHALTFSADPGFTYFNGETLTIIKAVEDLRNQGVNCYYTMDAGPNVKVIYDRGNRNKIVE 298

Query: 321 FFPEI------TIIDPLDSPDLWS 338
               I       +  P     +W+
Sbjct: 299 ELSNIVGPERLVVSQPGPGIKIWN 322


>gi|326803271|ref|YP_004321089.1| diphosphomevalonate decarboxylase [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651516|gb|AEA01699.1| diphosphomevalonate decarboxylase [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 413

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 117/306 (38%), Positives = 172/306 (56%), Gaps = 7/306 (2%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
             +      +NIAL KYWGKRD  L LP+N++LSL+L    + T +        DC  L+
Sbjct: 3   KYRGICRAHTNIALIKYWGKRDDDLILPMNSNLSLTLDRFYSETQVRFSKDIVEDCFQLD 62

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALF 137
           G+   +     +K ++F DLFRQ ++V     + + N++PT AGLASSAS FAAL  A  
Sbjct: 63  GEWQDNSE--VEKISRFVDLFRQIAQVDLACEVISYNHVPTAAGLASSASAFAALAGACN 120

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
           +   +     SLSR+AR GSGSA RS + GF EW  GT     DS A PF++   D+ + 
Sbjct: 121 QALHLNLDPVSLSRLARRGSGSATRSIFGGFVEWDKGTGDQ--DSQAAPFDDANWDVGMV 178

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +L +  ++K I SR  M+ T   SPF+  W Q     L  +K AI  +D  ++GE+AE +
Sbjct: 179 VLALNTKKKSISSRRGMKHTVETSPFYQLWPQVSEEKLLEMKAAIKARDLDRMGEIAENH 238

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           A+ MHAT ++A P   Y + E+++ ++ V   R+Q    YFT+DAGPN+K+L  +   + 
Sbjct: 239 AMLMHATTLSADPAFTYLEAESLKAIDAVKALRRQGYKAYFTMDAGPNVKILCPYSQSQA 298

Query: 318 IKQFFP 323
           I     
Sbjct: 299 IIDALA 304


>gi|328350516|emb|CCA36916.1| diphosphomevalonate decarboxylase [Pichia pastoris CBS 7435]
          Length = 514

 Score =  325 bits (833), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 103/336 (30%), Positives = 166/336 (49%), Gaps = 24/336 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIIL 78
             +S+  P NIA+ KYWGKRD+ LNLP N+S+S++L    L T+T +    + + D + L
Sbjct: 136 YTASSSAPVNIAVLKYWGKRDTNLNLPTNSSISVTLSQKDLRTLTTVNSSRNFEKDSLYL 195

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSAS 127
           NG   S ++       +     RQ            S+    I + NN PT AGLASSA+
Sbjct: 196 NGVSHSIENDRTTNCLEQLRSLRQQLEEDDPNLPKLSQWKLHIISENNFPTAAGLASSAA 255

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF 187
           GFAA+  A+ ++Y +P+ +  LSR+AR GSGSACRS + G+  W  G   +G DS AV  
Sbjct: 256 GFAAMVAAISKLYELPQDASELSRIARKGSGSACRSMFGGYVAWEMGEKLDGTDSKAVQI 315

Query: 188 --NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIID 244
                WP+++  +  + D +K + S   M+ T   S  F     Q +    + +  AI +
Sbjct: 316 APPEHWPNMKAAICIVSDLKKDVSSTSGMQTTVQTSELFQYRVNQVVPPRYSQMVDAIKN 375

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDA 302
           +DF   G +  K++   HAT + + PP+ Y    + + ++ +         +   +T DA
Sbjct: 376 RDFETFGTLTMKDSNSFHATCLDSYPPIFYLTDTSKKIIKLIHTLNDAIGKVVAAYTFDA 435

Query: 303 GPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS 338
           GPN  + +  + EE +      +       + D W+
Sbjct: 436 GPNAVIYYESENEEVVLGVLFGVL-----SNVDGWN 466


>gi|312869994|ref|ZP_07730133.1| diphosphomevalonate decarboxylase [Lactobacillus oris PB013-T2-3]
 gi|311094579|gb|EFQ52884.1| diphosphomevalonate decarboxylase [Lactobacillus oris PB013-T2-3]
          Length = 323

 Score =  325 bits (833), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 111/325 (34%), Positives = 178/325 (54%), Gaps = 14/325 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQK 82
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T +       AD +++NGQ+
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLDEFYTTTRVNFDQKLTADQVMINGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++       K T   D+ RQ S +     +++ N++PT AGLASSAS FAAL  A  R  
Sbjct: 62  LAG--PAAAKVTHLLDIVRQRSGLSARARVDSQNHVPTAAGLASSASAFAALAGATSRAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRIGLL 199
            +      LSR+AR GSGSA RS Y G  EW  G   +   S+A+P        + +  +
Sbjct: 120 GLQLSRRELSRLARRGSGSATRSIYGGLVEWQAG--HDDRTSYALPIMEQVDFGIEMIAI 177

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +   +KK+ SR  M+ +   SP++  W + ++ D+A +K+AI  QD  ++G +AE+NAL
Sbjct: 178 LVDTHKKKVSSRFGMQQSVSTSPYYRVWAEVVARDMAAVKKAIAAQDIDQIGAIAEENAL 237

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  ++A P   Y+  +TI  M  V + R+  +  YFT+DAGPN+K+++     + + 
Sbjct: 238 RMHALTLSADPGFTYFDSDTITAMTIVRELRENGVNCYFTMDAGPNVKVIYDQANRKAVY 297

Query: 320 QFFP------EITIIDPLDSPDLWS 338
                      + +  P    ++W+
Sbjct: 298 STLAAQFGTDRLVVAKPGPGIEIWN 322


>gi|164423595|ref|XP_001728068.1| diphosphomevalonate decarboxylase [Neurospora crassa OR74A]
 gi|157070160|gb|EDO64977.1| diphosphomevalonate decarboxylase [Neurospora crassa OR74A]
 gi|206597125|dbj|BAG71667.1| diphosphomevalonate decarboxylase [Neurospora crassa]
          Length = 394

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 102/336 (30%), Positives = 157/336 (46%), Gaps = 25/336 (7%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS--DADCII 77
            ++S   P NIA+ KYWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D ++
Sbjct: 7   YRASTTAPVNIAVVKYWGKRDTKLNLPTNSSLSVTLSQADLRTLTTASCSASYPEGDSLL 66

Query: 78  LNGQKISSQSSFFKKTTQFC-----------DLFRQFSKVYFLIETSNNIPTKAGLASSA 126
           LNG+      +  +   +                 + S +   I + NN PT AGLASSA
Sbjct: 67  LNGEPSDVSGARPQACFRELRARRAALEAADPSLPKLSTMPLRIVSENNFPTAAGLASSA 126

Query: 127 SGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA-- 184
           +GFAA   A+  +Y +P     LS +AR GSGSACRS + G+  W  G   +G DS A  
Sbjct: 127 AGFAAFVRAIANLYELPASPSELSLIARQGSGSACRSLFGGYVAWRMGEAADGSDSMADQ 186

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           V   + WP++R  +L     +K + S   M+ T   S  F +     +  ++  +++AI 
Sbjct: 187 VAEASHWPEMRALILVASAAKKGVSSTSGMQQTVATSSLFKERITSVVPKNMEIMEKAIA 246

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLD 301
           ++DF    EV  +++   HAT     PP+ Y    +   +  V             +T D
Sbjct: 247 ERDFAAFAEVTMRDSNSFHATCADTYPPIFYMNDVSRAAIRAVEAINAAAGRSVAAYTFD 306

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
           AGPN  + +  +  E +      +         D W
Sbjct: 307 AGPNAVIYYLEQDTEAVVGNLYSVL-----SKVDGW 337


>gi|328705847|ref|XP_001950422.2| PREDICTED: diphosphomevalonate decarboxylase-like isoform 1
           [Acyrthosiphon pisum]
          Length = 390

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 109/332 (32%), Positives = 157/332 (47%), Gaps = 26/332 (7%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCIILNG 80
            +   P NIA+ KYWGKRD  L LPLN+S+SL+L    + T T I        DC+ LNG
Sbjct: 5   VTCVAPVNIAVIKYWGKRDEHLILPLNDSVSLTLDCDQMHTKTSIIAGPFITEDCVWLNG 64

Query: 81  QKISSQSSFFKKTTQFCDLFRQFS-----------KVYFLIETSNNIPTKAGLASSASGF 129
           Q +S +    ++  +  DL R              K    + + NN PT AGLASSA+G+
Sbjct: 65  QIMSIE--RNERLKKCFDLIRNLIKIQKGENSQEVKWKIRVCSENNFPTAAGLASSAAGY 122

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-- 187
           A L   L   +     +  L  +AR GSGSACRS Y GF +W  G D  G DS AV    
Sbjct: 123 ACLVYTLANAFG--LVNGDLPSIARQGSGSACRSIYGGFVQWTAGVDDQGYDSTAVQIAA 180

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQD 246
           +  WP++RI +L + D +KK  S   M+     S       Q+        I QAI D++
Sbjct: 181 DTHWPEMRIIILVVNDSKKKTSSTVGMKQAVKTSELLKYRIQKCVPERTKEIIQAITDKN 240

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDAGP 304
           F K  E+  +++ + HA  +   PP +Y  + + + +  V D  + +  I + +T  AGP
Sbjct: 241 FEKFAEITMRDSNQFHAICLDTYPPCVYLNQVSHEIISFVHDYNEATGQIKVSYTFYAGP 300

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           N  L            F  E+  + P   P+ 
Sbjct: 301 NAFLFIQQIDLSL---FMSELVNVFPTMQPNS 329


>gi|312190949|gb|ADQ43374.1| mevalonate diphosphate decarboxylase [Streptomyces cinnamonensis]
          Length = 351

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 111/328 (33%), Positives = 167/328 (50%), Gaps = 14/328 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILN 79
            + ++A    NIAL KYWGKRD +L LP  +SLS++L    T T + +   +D D + L 
Sbjct: 18  TDTATAVAHPNIALIKYWGKRDERLILPRTDSLSMTLDIFPTTTRVHLAPGADHDEVTLG 77

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G     ++    +   F DL R+ S V    +++T N +PT AGLASSASGFAAL +A  
Sbjct: 78  GTPAEGEARR--RIVTFLDLVRERSGVADRAVVDTENTVPTGAGLASSASGFAALAVAAA 135

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVPFNNQWP 192
             Y +  ++ +LSR+AR GSGSA RS +  F  W  G      ++  + S+A P      
Sbjct: 136 AAYGLDLEAIALSRLARRGSGSASRSLFGDFVVWHAGRETGTDEEADLSSYAEPVPTGPL 195

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           D  + +  +    K + SR AM  T   SP +  W      DLA +++A+   D   +GE
Sbjct: 196 DPALVVAVVNAGPKDVSSRAAMRRTVDTSPLYEPWALSSKGDLAEMRRALGRGDLEAVGE 255

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           +AE+NAL MHATM+AA P + Y    ++  ++ V   R+  +  Y T+DAGPN+K+L   
Sbjct: 256 IAERNALGMHATMLAARPAVRYMSPASLTVLDSVLQLRRDGVAAYATMDAGPNVKVLCRA 315

Query: 313 KIEETIKQFFPEI----TIIDPLDSPDL 336
              + +            +      P  
Sbjct: 316 ADADRVADTVRAAAQGGAVHIARPGPGA 343


>gi|332292092|ref|YP_004430701.1| GHMP kinase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170178|gb|AEE19433.1| GHMP kinase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 360

 Score =  323 bits (829), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 92/342 (26%), Positives = 151/342 (44%), Gaps = 29/342 (8%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA 73
           G+ N       S   PSNIAL KYWGK   +  LP N S+S +L +  T T ++   +  
Sbjct: 10  GDYNVLPAGSVSYQSPSNIALVKYWGKYGEQ--LPQNPSISFTLSNCHTTTTLSYKKNSN 67

Query: 74  D------CIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLA 123
                   I L+G+           FFK+   +    ++     + IETSN+ P  +G+A
Sbjct: 68  FSGEIPFEIFLDGEAAPDFKPKITKFFKRIAIYMPFVKE---YEYKIETSNSFPHSSGIA 124

Query: 124 SSASGFAALTLALFR-------IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           SSASG +AL L L           +    +E  S +ARLGSGSACRS       W    +
Sbjct: 125 SSASGMSALALCLMEMERGMEGAMTDAFFNEKASFLARLGSGSACRSIEGPLVVWGKHAE 184

Query: 177 QNGMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI 231
             G       S+    + ++ + +  +L +   EK++ S        H   F      Q 
Sbjct: 185 IEGSTNFYGTSYEGEIHEKFHNYQDTILLVDKGEKQVSSTVG-HDLMHGHAFAKARFTQA 243

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ 291
             +L+ + Q     D  +  ++ E  AL +HA M+ + P  +  + +T++ +  +W  R 
Sbjct: 244 HENLSSLMQVFKQGDVDQFIKIVESEALTLHAMMMTSHPYFILMKPKTLEIINEIWAYRN 303

Query: 292 Q-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           +    I FTLDAG N+ +L+    +E++++F          +
Sbjct: 304 ETGSKICFTLDAGANVHVLYPENEKESVQKFIASELSKFCQN 345


>gi|86142061|ref|ZP_01060585.1| diphosphomevalonate decarboxylase [Leeuwenhoekiella blandensis
           MED217]
 gi|85831624|gb|EAQ50080.1| diphosphomevalonate decarboxylase [Leeuwenhoekiella blandensis
           MED217]
          Length = 360

 Score =  322 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 89/335 (26%), Positives = 152/335 (45%), Gaps = 29/335 (8%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDAD------ 74
            +  S   PSNIAL KYWGK   +  +P N S+S +L +  T T ++             
Sbjct: 17  TQSVSYESPSNIALIKYWGKHGVQ--IPKNPSISFTLNNCKTTTKLSFEKRTNFDEAYDL 74

Query: 75  CIILNGQKISSQSSFFKKTTQFC----DLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
            +IL+G+    +  F  K  QF     +      +  F I+T+N+ P  +G+ASSASG +
Sbjct: 75  KVILDGK---HKPGFEPKIHQFFGRIDEYLPFIKEYRFTIDTTNSFPHSSGIASSASGLS 131

Query: 131 ALTLALFRIYSIPE-------KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD-- 181
           AL L L  +             ++  S +ARLGSGS CRS       W    D  G    
Sbjct: 132 ALALCLMEMEREMHPEMSLKRFNQKASFIARLGSGSGCRSLEGPLVVWGEHADIEGSSDV 191

Query: 182 ---SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
               +    ++ +   +  +L +   EK + S        H+  +      Q   +LA +
Sbjct: 192 YGVQYPYEVHSVFDHYQDTILLVDKGEKPVSSTVG-HNLMHNHAYAASRFDQAVENLALL 250

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
              + + +  +   + E  AL +HA M+ + P  +  +  T++ ++++W+ R+ + IP+ 
Sbjct: 251 VPILKEGNLDEFVSLVESEALTLHAMMLTSKPYFILMKPNTLKIIDKIWEYRRDTSIPVC 310

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           FTLDAG N+ +L+  K +E +++F      I   D
Sbjct: 311 FTLDAGANVHVLYPKKDKEAVQEFIKNDLSIYCQD 345


>gi|302557476|ref|ZP_07309818.1| diphosphomevalonate decarboxylase [Streptomyces griseoflavus
           Tu4000]
 gi|302475094|gb|EFL38187.1| diphosphomevalonate decarboxylase [Streptomyces griseoflavus
           Tu4000]
          Length = 349

 Score =  322 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 110/313 (35%), Positives = 159/313 (50%), Gaps = 8/313 (2%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SD 72
                      +A    NIAL KYWGKRD +L +P  +SLS++L    T T + +   + 
Sbjct: 11  ATAGGAPGHGVTAVAHPNIALIKYWGKRDERLMIPYVDSLSMTLDIFPTTTTVRLAPGAP 70

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFA 130
           AD + L+G     +    ++   F DL R+ S      +++T N++PT AGLASSASGFA
Sbjct: 71  ADSLTLDGSPAEGE--VRRRVVGFLDLLRERSGRSEPAVVDTHNSVPTGAGLASSASGFA 128

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT---DQNGMDSFAVPF 187
           AL LA    Y +     +LSR+AR GS SA RS + GF     G        + S+A P 
Sbjct: 129 ALALAGAAAYGLDPDRTALSRLARRGSASASRSIFGGFAVCHAGRGTGAAADLGSYAEPV 188

Query: 188 NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDF 247
                D  + +  +    K + SR AM  T   SP +  W     TDLA ++ A+   D 
Sbjct: 189 PVPDFDPALVIAVVDAGAKAVSSRAAMRRTVETSPLYRAWATSGKTDLAEMRVALRRGDL 248

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLK 307
             +GE+AE+NAL MHATM+ A P + Y    T+  ++ V   R   +P Y T+DAGPN+K
Sbjct: 249 DAVGEIAERNALGMHATMLTARPAVRYLSPATVAVLDGVLRLRSDGVPAYATMDAGPNVK 308

Query: 308 LLFTHKIEETIKQ 320
           +L      + + +
Sbjct: 309 VLCHPADADRVAE 321


>gi|300361739|ref|ZP_07057916.1| possible diphosphomevalonate decarboxylase [Lactobacillus gasseri
           JV-V03]
 gi|300354358|gb|EFJ70229.1| possible diphosphomevalonate decarboxylase [Lactobacillus gasseri
           JV-V03]
          Length = 321

 Score =  322 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 121/320 (37%), Positives = 185/320 (57%), Gaps = 13/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK +  L  PL +SLS++L    T T      S   D  ILNGQ
Sbjct: 2   KKTARAHTNIALIKYWGKSNQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNGQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K + + S  K+   +  L ++      +F I+++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQTPEES--KRVFNYIHLLQEKFGFNDHFTIKSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
           Y +      LS++ARLGSGSA RS Y GF EW  G D     S+AVP +     DL +  
Sbjct: 120 YGLDLSRRELSKLARLGSGSATRSIYGGFVEWQKGIDDAS--SYAVPIDENPDLDLSLLA 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L++  ++KKI S + M+     SPF+  W  +   ++A +KQAI ++DF K+G+++E +A
Sbjct: 178 LEVDTKQKKISSTKGMK-LAQTSPFYQPWLARNKQEIAELKQAIKEKDFTKIGKLSELSA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET- 317
            +MHA  + A+ P  Y++ ETI+ ++ V + RQQ I  Y+T+DAGPN+K+L T + ++  
Sbjct: 237 NEMHACNLTANEPFTYFEPETIKAIKLVENLRQQGIECYYTIDAGPNVKILCTLRNKKEI 296

Query: 318 ---IKQFFPEITIIDPLDSP 334
              +++    + I+     P
Sbjct: 297 ISAVQKSLTNVKIVVASFGP 316


>gi|319440914|ref|ZP_07990070.1| putative diphosphomevalonate decarboxylase [Corynebacterium
           variabile DSM 44702]
          Length = 341

 Score =  322 bits (826), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 117/341 (34%), Positives = 177/341 (51%), Gaps = 18/341 (5%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILN 79
           +  ++A   +NIAL KYWGK D +L +P+ +SLSL+L  L T T +   ID DAD   L+
Sbjct: 5   SSPATATAHANIALIKYWGKADDELIIPVTSSLSLTLDALYTTTTVRFGIDGDADEATLD 64

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G+ ++ ++  + +     DL R+ + +     + + N +PT AGLASSASGFAAL  A  
Sbjct: 65  GEVVTGKA--YNRIVDLLDLVRERAGIPDRAEVVSVNTVPTAAGLASSASGFAALAGAAA 122

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ---WPDL 194
               +      LSR+AR GSGSA RS + G   W  GTD +   S+A P  +      DL
Sbjct: 123 AAAGLELSDRELSRLARRGSGSASRSIFGGLAVWHAGTDDDS--SYAEPVADPTGLSGDL 180

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +L +   EK + SRE M  T   SP +  W +  +  LA   +A+ + D  +LG VA
Sbjct: 181 AMVVLVLDAGEKSVSSREGMRRTVQTSPDYRPWVEAHAGHLASAMEAVKNGDLERLGAVA 240

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+NA  MH TM +A PP+ Y   ++   +  V   R++ +P + T+DAGPN+K+L     
Sbjct: 241 EENAAGMHGTMASAVPPVEYVTDQSRAALAAVKTLREEGLPAWATMDAGPNVKVLTRASE 300

Query: 315 EETIKQFF--------PEITIIDPLDSPDLWSTKDSLSQKN 347
            E +            P++  +     P L  T+    + N
Sbjct: 301 AERVDARLREMLAEVAPQLGTVVAYSGPGLEITRPDTREAN 341


>gi|259503452|ref|ZP_05746354.1| diphosphomevalonate decarboxylase [Lactobacillus antri DSM 16041]
 gi|259168530|gb|EEW53025.1| diphosphomevalonate decarboxylase [Lactobacillus antri DSM 16041]
          Length = 323

 Score =  322 bits (825), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 113/325 (34%), Positives = 182/325 (56%), Gaps = 14/325 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQK 82
           ++A   +NIAL KYWGK+D +L +P  +SLSL+L    T T +    +  +D +++NGQ+
Sbjct: 2   ATAKAHTNIALVKYWGKKDQELIIPQTDSLSLTLDEFYTTTTVDFDQELASDQVMINGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +   ++   K T+  D+ RQ S +     +++ N++PT AGLASSAS FAAL  A  +  
Sbjct: 62  LGGPAAR--KVTRLLDIVRQRSDLTARARVDSHNHVPTAAGLASSASAFAALAGAASQAA 119

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF-NNQWPDLRIGLL 199
            +      LSR+AR GSGSA RS Y G  EW  G D     S+AVP        + +  +
Sbjct: 120 GLQLDRRGLSRLARRGSGSATRSVYGGLVEWQAGNDDQT--SYAVPIMEEVDFGIEMIAI 177

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I  R+KKI SR  M+ +   SP++  W + ++ D+  +K+AI  +D  ++G +AE+NAL
Sbjct: 178 LIDTRQKKISSRFGMQQSVATSPYYRLWPEVVAHDMVAVKKAIAARDVDQIGAIAEENAL 237

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  ++A+P   Y+  +T++ M  V + R   I  YFT+DAGPN+K+++     E + 
Sbjct: 238 RMHALTLSAAPGFTYFDSDTLKAMAIVRELRANGINCYFTMDAGPNVKVIYDRVNREAVY 297

Query: 320 QFFPE------ITIIDPLDSPDLWS 338
               +      + +  P     +W+
Sbjct: 298 SSLADQLGADRLVVAKPGPGIKIWN 322


>gi|256847333|ref|ZP_05552779.1| diphosphomevalonate decarboxylase [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715997|gb|EEU30972.1| diphosphomevalonate decarboxylase [Lactobacillus coleohominis
           101-4-CHN]
          Length = 322

 Score =  322 bits (825), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 109/321 (33%), Positives = 173/321 (53%), Gaps = 10/321 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K+SA   +NIAL KYWGK+D +L +P  +SLSL+L    T T +  I+S   D +I++ Q
Sbjct: 2   KASARAHTNIALVKYWGKKDPQLIIPQTDSLSLTLDKFFTDTTVEFIESLKQDELIIDDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            ++ Q     K T      R  S  +    + + NN+P  AGLASSAS FAAL LA    
Sbjct: 62  PVAPQK--MAKVTAVLSQVRSLSHQHYFAKVISQNNVPMAAGLASSASAFAALALAASTA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +      LSR+AR GSGSA RS + G  EW  G D     +  +     +  + +  +
Sbjct: 120 AGLHLSPRDLSRLARRGSGSATRSIFGGLVEWHAGVDDASSYAEPIMEQVDF-GIEMIAI 178

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I  ++KK+ SR  M+++   SPF+  W + ++ D+  +K AI  +D  ++G +AE+NA+
Sbjct: 179 LIDTKQKKVSSRGGMQLSVTTSPFYPAWRKVVADDMQAMKTAISKRDINQMGHIAEENAM 238

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  ++A P   Y++  TI+ +  +   R+Q I  Y+T+DAGPN+K+++ H+  + I 
Sbjct: 239 RMHALTMSADPAYTYFEGATIKAINLIKGLREQGINCYYTMDAGPNVKVIYNHQDRQRII 298

Query: 320 QFFPEIT----IIDPLDSPDL 336
                +     +I     P  
Sbjct: 299 DKLAPVFGKDHLIIAQPGPGA 319


>gi|227892524|ref|ZP_04010329.1| possible diphosphomevalonate decarboxylase [Lactobacillus
           ultunensis DSM 16047]
 gi|227865645|gb|EEJ73066.1| possible diphosphomevalonate decarboxylase [Lactobacillus
           ultunensis DSM 16047]
          Length = 320

 Score =  322 bits (825), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 112/318 (35%), Positives = 175/318 (55%), Gaps = 11/318 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +    +NIAL KYWGK+D KL LPL +SLS++L    T T I    +  +   LN +K  
Sbjct: 4   TVRAHTNIALIKYWGKKDPKLRLPLMSSLSMTLDAFYTDTSIEKT-NGENQFYLNNKKQD 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +S  K+   + DL ++    +   +I+++N++PT AGLASS+S FAAL  A  + Y+I
Sbjct: 63  ETNS--KRVFSYLDLLKRKFDCHDNLIIKSTNHVPTSAGLASSSSAFAALAAAFCKYYNI 120

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LSR+AR+GSGSACRS + GF  W  G       ++A+       DL +  +++ 
Sbjct: 121 SVDKTELSRLARMGSGSACRSIFGGFAIWQKGESDESSYAYAL-VEEPKMDLHLLAIELN 179

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            ++KKI S   M+     SPFF  W ++   ++  +  AI   DF  LG++AE NA +MH
Sbjct: 180 TKQKKISSTRGMKD-AQSSPFFEPWIKRNDLEMKQMIAAIKKNDFTALGKLAELNANEMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A  + A P   Y++  T++ ++ +   R + I  Y+T+DAGPN+K+L   +  + IK+ F
Sbjct: 239 AINLTAQPEFTYFEPNTLRAIKLIEQLRNEGIECYYTIDAGPNIKVLCQLRNSKEIKERF 298

Query: 323 PEI----TIIDPLDSPDL 336
             I     I+D    P +
Sbjct: 299 ERIFNSVNIVDASFGPGI 316


>gi|227890030|ref|ZP_04007835.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii ATCC
           33200]
 gi|227849474|gb|EEJ59560.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii ATCC
           33200]
          Length = 321

 Score =  321 bits (824), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 121/320 (37%), Positives = 180/320 (56%), Gaps = 13/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++   +  +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSVEDS--KRVFNYIHLLQEKFGMTDHFTIRSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+AVP +     DL +  
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAVPIDENPDLDLSLLA 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           +++  ++KKI S + M+     SPF+  W  +   ++A IK+AI + DF ++GE++E +A
Sbjct: 178 IEVNTKQKKISSTKGMQ-LAQTSPFYQTWLARNEEEIAEIKKAIQNNDFTRIGELSELSA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT----HKI 314
            +MHA  + A  P  Y++ ETI+ ++ V D R+  I  Y+T+DAGPN+K++ T      I
Sbjct: 237 NEMHACNLTAKEPFTYFEPETIKIIKLVEDLRKNGIECYYTIDAGPNVKIICTLRNRKDI 296

Query: 315 EETIKQFFPEITIIDPLDSP 334
              +++    + I+     P
Sbjct: 297 ISAVQKTLTNVKIVVASFGP 316


>gi|42519131|ref|NP_965061.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii NCC
           533]
 gi|41583418|gb|AAS09027.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii NCC
           533]
 gi|329667334|gb|AEB93282.1| mevalonate pyrophosphate decarboxylase [Lactobacillus johnsonii DPC
           6026]
          Length = 321

 Score =  321 bits (824), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 123/320 (38%), Positives = 179/320 (55%), Gaps = 13/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++   V  +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSVEDS--KRVFNYIHLLQEKFGVNDHFTIRSTNHVPTSAGLASSASAFAALATSFVAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+A P +     DL +  
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAAPIDENPDLDLSLLA 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           +++  ++KKI S + M+     SPF+  W  +   ++A IKQAI + DF ++GE++E +A
Sbjct: 178 IEVNTKQKKISSTKGMQ-LAQTSPFYQPWLARNEEEIAEIKQAIQNNDFTRIGELSELSA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT----HKI 314
            +MHA  + A  P  Y++ ETI+ ++ V D R+  I  Y+T+DAGPN+K+L T      I
Sbjct: 237 NEMHACNLTAKEPFTYFEPETIKIIKLVEDLRKNGIECYYTIDAGPNVKILCTLRNRKDI 296

Query: 315 EETIKQFFPEITIIDPLDSP 334
              +++    + I+     P
Sbjct: 297 ISAVQKTLTNVKIVVASFGP 316


>gi|47230341|emb|CAF99534.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 393

 Score =  321 bits (823), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 104/324 (32%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHL-GTITHITVIDSDADCIILNGQ 81
           +   P NIA+ KYWGKR+ +L LP+N+SLS++L    L  T T +T    + D I LNG+
Sbjct: 7   TCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTVVTSKSFEEDRIWLNGK 66

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK-------------VYFLIETSNNIPTKAGLASSASG 128
           +        +   +      +  +                 I + NN PT AGLASSA+G
Sbjct: 67  EEDISHPRLQSCLKEIRRLARKRRNDENPSLESPVWSHKVHICSINNFPTAAGLASSAAG 126

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VP 186
           FA L   L R++ +      LS +AR GSGSACRS Y GF +WI G  ++G DS A  V 
Sbjct: 127 FACLVYTLARVFGVE---GELSAIARQGSGSACRSMYGGFVQWIMGQREDGKDSIALQVE 183

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQ 245
            ++ WP+LRI +L     +K +GS   M+ +   S       +  +   LA + QA+  +
Sbjct: 184 PDSHWPELRILVLVASAEKKPVGSTAGMQTSVETSCLLKYRAESVVPGRLAEMIQAVRRR 243

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
           DF    E+  K++ + HAT +   PP+ Y    + Q +  V    +    + + +T DAG
Sbjct: 244 DFATFAELTMKDSNQFHATCLDTYPPIFYLSSVSQQVINLVHRYNRHYGEMRVSYTFDAG 303

Query: 304 PNLKLLFTHKIEET----IKQFFP 323
           PN  +    +        ++ FFP
Sbjct: 304 PNAVIFTLEQHVSEFLQVVQHFFP 327


>gi|116629675|ref|YP_814847.1| mevalonate pyrophosphate decarboxylase [Lactobacillus gasseri ATCC
           33323]
 gi|238854239|ref|ZP_04644583.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 202-4]
 gi|282852205|ref|ZP_06261557.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 224-1]
 gi|311110682|ref|ZP_07712079.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri MV-22]
 gi|116095257|gb|ABJ60409.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri ATCC
           33323]
 gi|238833050|gb|EEQ25343.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 202-4]
 gi|282556624|gb|EFB62234.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri 224-1]
 gi|311065836|gb|EFQ46176.1| diphosphomevalonate decarboxylase [Lactobacillus gasseri MV-22]
          Length = 321

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 120/320 (37%), Positives = 184/320 (57%), Gaps = 13/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK +  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKANQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           +   + S  K+   +  L ++      +F+I+++N++PT AGLASSAS FAAL  +    
Sbjct: 62  EQGPEES--KRVFNYIHLLQEKFGFNDHFIIKSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+A+P +     DL +  
Sbjct: 120 YDLDLSRKDLSRLARLGSGSATRSIYGGFVEWQKGIDDAS--SYAIPIDENPDLDLSLLA 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L++  ++KKI S + M+     SPF+  W  +   ++A +KQAI ++DF K+G+++E +A
Sbjct: 178 LEVDTKQKKISSTKGMK-LAQTSPFYQPWLARNKQEIAELKQAIKEKDFTKIGKLSELSA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT----HKI 314
            +MHA  + A+ P  Y++ ETI+ ++ V D R+Q I  Y+T+DAGPN+K+L T     +I
Sbjct: 237 NEMHACNLTANEPFTYFEPETIKAIKLVEDLRKQGIECYYTIDAGPNVKILCTLRNRKEI 296

Query: 315 EETIKQFFPEITIIDPLDSP 334
              +++    + I+     P
Sbjct: 297 ISAVQKSLTNVKIVVASFGP 316


>gi|118794452|ref|XP_321487.3| AGAP001611-PA [Anopheles gambiae str. PEST]
 gi|116116303|gb|EAA00918.3| AGAP001611-PA [Anopheles gambiae str. PEST]
          Length = 382

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 98/335 (29%), Positives = 154/335 (45%), Gaps = 26/335 (7%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS-DADCII 77
           +   +   P NIA+ KYWGKRD  L LP+N+S+S++L   HL T T IT       + + 
Sbjct: 2   STSVTCIAPVNIAIIKYWGKRDDDLILPINDSISVTLSTDHLRTKTTITAGPEISKNVLR 61

Query: 78  LNGQKISSQSSFFKKTTQFCDL---------FRQFSKVYFLIETSNNIPTKAGLASSASG 128
           LNG + S ++   ++  Q               +  +    +E+ NN PT AGLASSA+G
Sbjct: 62  LNGVEESFENPRIQRCLQEVKRIAKASGKCSKPEMLEWNVHVESENNFPTAAGLASSAAG 121

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP-- 186
           +A     L  +Y +   SE LS +AR+GSGSACRS + G+ +W  G   +G DS AV   
Sbjct: 122 YACFVYTLATLYGVE--SEELSGIARMGSGSACRSLHSGYVQWARGERADGSDSLAVQLA 179

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQ 245
             + WPD+ + +L + DR+K   S   M  +   S              +  +++AI ++
Sbjct: 180 PASAWPDMHVLILVVSDRKKATASTHGMATSVKTSDLLKHRASVCVPERVKLVQKAIAEK 239

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ------QSIPIYFT 299
           DF   G +A K++ + HA  +   PP  Y    +   +  V             + + ++
Sbjct: 240 DFDTFGRIAMKDSNQFHAICLDTYPPCFYLNDVSRSIIRMVDQINNLAEPNLAPVKVAYS 299

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
            DAGPN  L    K    +      +  + P    
Sbjct: 300 FDAGPNACLFLLEKDVAEVSAI---VRRVFPFTGT 331


>gi|260061656|ref|YP_003194736.1| hypothetical protein RB2501_08645 [Robiginitalea biformata
           HTCC2501]
 gi|88785788|gb|EAR16957.1| hypothetical protein RB2501_08645 [Robiginitalea biformata
           HTCC2501]
          Length = 373

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 85/349 (24%), Positives = 136/349 (38%), Gaps = 25/349 (7%)

Query: 7   HILHRYIGE--CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            +   +  +    P    +     PSNIAL KYWGKRD +  LP N S+S +L    T T
Sbjct: 1   MVYQEFQCKGPLGPLPAGEVGWQAPSNIALVKYWGKRDGQ--LPTNPSVSFTLEACRTST 58

Query: 65  HITVIDSDA------DCIILNGQKISSQSSFFKK-TTQFCDLFRQFSKVYFLIETSNNIP 117
            I     +         + L+G          ++   +        S ++  I T N+ P
Sbjct: 59  RIAYSPLEQSVKGPRFRVFLDGFPAPDFEPKIRQFLERALPYAPFLSGLHLEIRTENSFP 118

Query: 118 TKAGLASSASGFAALTLALFRIY-------SIPEKSESLSRVARLGSGSACRSFYRGFCE 170
             +G+ASSASG AAL L L  +                 S +ARLGSGSA RS   G   
Sbjct: 119 HSSGIASSASGMAALALCLVSLEEQLLPGTDPGYARRKASFLARLGSGSAARSTAGGLIL 178

Query: 171 WICGTDQNGMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT 225
           W                +    +  +      +L +   +K + S           PF  
Sbjct: 179 WGEQEGIPESTDLLGVPYPGEVHEVFHTYHDTILLVDKGQKTVSSSVG-HGLMDGHPFAA 237

Query: 226 QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER 285
           +  +Q    L  +       D      + E  AL +HA M+ ++P  +  +  T++ +E+
Sbjct: 238 ERFEQARRHLEKLGGIFASGDLEAFANLVESEALSLHAMMLTSTPSFILMKPGTLEIIEK 297

Query: 286 VWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           + D R++   P+ FTLDAG N+ +L+       +  F  E  +   +  
Sbjct: 298 IRDYRRETGHPVCFTLDAGANVHVLYPEASAGPVYSFIREELLEHCVSG 346


>gi|268319452|ref|YP_003293108.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii FI9785]
 gi|262397827|emb|CAX66841.1| diphosphomevalonate decarboxylase [Lactobacillus johnsonii FI9785]
          Length = 321

 Score =  319 bits (819), Expect = 3e-85,   Method: Composition-based stats.
 Identities = 122/320 (38%), Positives = 179/320 (55%), Gaps = 13/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K +A   +NIAL KYWGK D  L  PL +SLS++L    T T      S   D  ILN Q
Sbjct: 2   KKTARAHTNIALIKYWGKADQALKTPLMSSLSMTLDAFYTDTTFEHDSSLTEDTFILNDQ 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           K S + S  K+   +  L ++   +  +F I ++N++PT AGLASSAS FAAL  +    
Sbjct: 62  KQSLEDS--KRVFNYIHLLQEKFGMTDHFTIRSTNHVPTSAGLASSASAFAALATSFAAS 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGL 198
           Y +    + LSR+ARLGSGSA RS Y GF EW  G D     S+AVP +     DL +  
Sbjct: 120 YGLDLSKKELSRLARLGSGSATRSVYGGFVEWKKGFDDES--SYAVPIDENPDIDLSLLA 177

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           ++I  ++KKI S + M+     SPF+  W  +   ++  IKQAI + DF K+GE++E +A
Sbjct: 178 IEINTKQKKISSTKGMQ-LAQTSPFYQTWLARNEQEITEIKQAIQNNDFTKIGELSELSA 236

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT----HKI 314
            +MHA  + A  P  Y++ ETI+ ++ V + R+  I  Y+T+DAGPN+K++ T      I
Sbjct: 237 NEMHACNLTAKEPFTYFEPETIKIIKLVEELRKNGIECYYTIDAGPNVKIICTLRNRKDI 296

Query: 315 EETIKQFFPEITIIDPLDSP 334
              +++    + I+     P
Sbjct: 297 ISAVQKTLTNVKIVVASFGP 316


>gi|225012603|ref|ZP_03703038.1| GHMP kinase [Flavobacteria bacterium MS024-2A]
 gi|225003136|gb|EEG41111.1| GHMP kinase [Flavobacteria bacterium MS024-2A]
          Length = 356

 Score =  319 bits (818), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 94/345 (27%), Positives = 142/345 (41%), Gaps = 21/345 (6%)

Query: 7   HILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI 66
                +I      IN  ++   PSNIAL KYWGK + +  LP N SLS +L +  T T +
Sbjct: 1   MNTSVFIASAALPINYTTTWEAPSNIALIKYWGKYEPQ--LPKNPSLSFTLSNSKTKTKV 58

Query: 67  TVIDSDADCIILNGQKISSQ-SSFFKKTTQFCDLFRQF----SKVYFLIETSNNIPTKAG 121
                  + I         Q   F  K   F D   ++       +  + + N+ P  +G
Sbjct: 59  IFTPHAKNEIDFEFFFHGIQKPDFKPKLKTFFDRIGEYIPWIFSYHLEVFSENSFPHSSG 118

Query: 122 LASSASG-------FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           +ASSAS           L   LF         +  S +ARLGSGSA RS       W   
Sbjct: 119 IASSASSMAALSLCLMDLERQLFPEMETVYFYQKASFLARLGSGSAARSIQGPVIFWGKN 178

Query: 175 T-DQNGMDSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ 229
               +  D FA PF    ++ + + +  +L +    K + S +      H  PF      
Sbjct: 179 AVRDSSSDLFATPFGTTLHSVFDNYQDTILLVDKGSKPVSSTQG-HNLMHGHPFAENRFL 237

Query: 230 QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA 289
           Q S +L+ +   +          + E  AL +HA M+ +SP  +  Q  T+  + RVW+ 
Sbjct: 238 QASNNLSSLVPIMETGALDDFIHLVELEALSLHAMMLTSSPYFILMQPNTLAIIHRVWEF 297

Query: 290 RQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           R+++ IP+ FTLDAG N+ LL+  +    I  F  E         
Sbjct: 298 RKETSIPLCFTLDAGANVHLLYPKQDIGVIHSFIKEELSGFCQSG 342


>gi|146317946|ref|YP_001197658.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis 05ZYH33]
 gi|146320133|ref|YP_001199844.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis 98HAH33]
 gi|253751170|ref|YP_003024311.1| mevalonate diphosphate decarboxylase [Streptococcus suis SC84]
 gi|253753071|ref|YP_003026211.1| mevalonate diphosphate decarboxylase [Streptococcus suis P1/7]
 gi|253754893|ref|YP_003028033.1| mevalonate diphosphate decarboxylase [Streptococcus suis BM407]
 gi|145688752|gb|ABP89258.1| Mevalonate pyrophosphate decarboxylase [Streptococcus suis 05ZYH33]
 gi|145690939|gb|ABP91444.1| Mevalonate pyrophosphate decarboxylase [Streptococcus suis 98HAH33]
 gi|251815459|emb|CAZ51037.1| mevalonate diphosphate decarboxylase [Streptococcus suis SC84]
 gi|251817357|emb|CAZ55093.1| mevalonate diphosphate decarboxylase [Streptococcus suis BM407]
 gi|251819316|emb|CAR44666.1| mevalonate diphosphate decarboxylase [Streptococcus suis P1/7]
 gi|292557730|gb|ADE30731.1| Diphosphomevalonate decarboxylase [Streptococcus suis GZ1]
 gi|319757439|gb|ADV69381.1| mevalonate pyrophosphate decarboxylase [Streptococcus suis JS14]
          Length = 341

 Score =  319 bits (818), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 130/338 (38%), Positives = 180/338 (53%), Gaps = 14/338 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGKRD +L LP+N+SLSL+L    T T +       AD   LNG    
Sbjct: 8   ARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKVVFDPELTADEFYLNGILQK 67

Query: 85  SQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            +     K ++F DLF ++     +  +E+ N +PT AGLASSAS FAAL LA      +
Sbjct: 68  EKEIL--KISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L + 
Sbjct: 126 DLSPATLSTLARRGSGSSTRSLFGGFVEWGMGTG--SEDSMAHPIDDADWDIGMVVLAVN 183

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KKI SRE M+ T   SPF+T W +    DL  IK AI  +DF KLG++ E N +KMH
Sbjct: 184 TGPKKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAAIASRDFEKLGQITEHNGMKMH 243

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEET---- 317
           AT ++A+PP  YW  +++   E V   R+   +  Y T+DAGPN+K+L      +     
Sbjct: 244 ATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRASQMDELVAG 303

Query: 318 IKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI--ELGI 353
           + + FP   II     P  +   +   Q +    E GI
Sbjct: 304 LAKVFPREKIITSKPGPAAYVLSEKDWQASQTAFEKGI 341


>gi|332881013|ref|ZP_08448682.1| putative diphosphomevalonate decarboxylase [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332681030|gb|EGJ53958.1| putative diphosphomevalonate decarboxylase [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 341

 Score =  319 bits (818), Expect = 4e-85,   Method: Composition-based stats.
 Identities = 94/336 (27%), Positives = 149/336 (44%), Gaps = 33/336 (9%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD----------AD 74
           +   PSNIAL KYWGK+  +  LP N S+S +L H  T T I                + 
Sbjct: 3   TFKAPSNIALVKYWGKKGEQ--LPANPSISFTLSHCYTETSIAYQRRSAATMATDAPFSF 60

Query: 75  CIILNGQKISSQSSFFKKTTQFC----DLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
               +GQ    + SF  K   F           +  +F I + N+ P  +G+ASSAS  A
Sbjct: 61  DFSFDGQP---KPSFHPKIEAFFARIAPYLPFLTDYHFSIHSHNSFPHSSGIASSASAMA 117

Query: 131 ALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWIC-----GTDQN 178
           AL++ L ++       YS  E  +  S +ARLGSGSACRS       W       G+  +
Sbjct: 118 ALSVCLMQVARELGYTYSEEEFWQKASFLARLGSGSACRSVKGSIVVWGQHPSIVGSSDD 177

Query: 179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
               + +     + D +  +L I   +K++ S        H  PF      Q ++++  +
Sbjct: 178 YGIPYPLQVAPVFADFQDTILLIDREQKQVSSTVG-HNLMHGHPFAEARFLQANSNIDRL 236

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
             A    D     EV E  AL +HA M  + P  +  +  T++ ++RVW  R+ + +P+ 
Sbjct: 237 IGAFATGDIDTFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRVWQYRKDTKVPLC 296

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           FTLDAG N+ LL+   +++ ++ F          + 
Sbjct: 297 FTLDAGANVHLLYPKSVKDEVQTFIKNELAHFCEEG 332


>gi|298207506|ref|YP_003715685.1| hypothetical protein CA2559_04605 [Croceibacter atlanticus
           HTCC2559]
 gi|83850142|gb|EAP88010.1| hypothetical protein CA2559_04605 [Croceibacter atlanticus
           HTCC2559]
          Length = 360

 Score =  319 bits (817), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 89/352 (25%), Positives = 162/352 (46%), Gaps = 30/352 (8%)

Query: 7   HILHRYIGECNPKINEKS--SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
                ++ +    + EK   ++  PSNIAL KYWGKRD  + +P N S+S +L    TIT
Sbjct: 1   MTASNFLMKDYSSLPEKGSITSEAPSNIALVKYWGKRD--IQIPENTSISFTLNTCKTIT 58

Query: 65  HITVIDSD------ADCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSN 114
            +     +      +  + L+G++ +S       FF++  ++           F IETSN
Sbjct: 59  TLHFEKKENLTNDYSFQVYLDGERTTSFEPKIGKFFERIEEYLPF---LKNYKFKIETSN 115

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSES-------LSRVARLGSGSACRSFYRG 167
           + P  +G+ASSASG AAL++ L  +    +  +         S +ARLGSGSA RS    
Sbjct: 116 SFPHSSGIASSASGMAALSMCLVALEKQIDNLKDNLYFQNKASFLARLGSGSASRSIDGP 175

Query: 168 FCEWICGTD-QNGMDSFAVP---FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
              W          +++A+     +  + D +  +L +   EK++ S    +   +  PF
Sbjct: 176 MMIWGKHEAIPESTNNYAIKYDKIDPVFKDYQDTILLVDKGEKQVSSTVGHQ-LMYGHPF 234

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
             Q   Q   ++  + + +   +      + E+ AL +HA M+ ++P  +  +  T++ +
Sbjct: 235 SEQRFNQAQDNMVSLLEILESGNLKDFINLVEREALTLHAMMMTSNPYFILMKPNTLEII 294

Query: 284 ERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
            R+W  R+++ + + FTLDAG N+ LL+     +    F  +  +    +  
Sbjct: 295 NRIWAFRKETNLNLCFTLDAGANVHLLYPKNEADKTLDFIKKELVAYCKNGE 346


>gi|331701430|ref|YP_004398389.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128773|gb|AEB73326.1| diphosphomevalonate decarboxylase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 328

 Score =  319 bits (817), Expect = 6e-85,   Method: Composition-based stats.
 Identities = 117/325 (36%), Positives = 180/325 (55%), Gaps = 12/325 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILN 79
           ++  +A   +NIAL KYWGK++ +L +P   SLSL+L    T T +T   + D D I ++
Sbjct: 6   DKTVTAVAHTNIALIKYWGKQNPELIIPYTGSLSLTLDQFYTQTSVTFNANLDKDQITID 65

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           GQ ++ +S   ++   F  + R+ S +     ++++N++PT AGLASSAS FAAL  A  
Sbjct: 66  GQPVTGKSG--QRVHNFLSIVRRESGIDLNAQVKSTNHVPTAAGLASSASAFAALAAAAS 123

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRI 196
           +   +      LSR+AR GSGSACRS + GF EW  G+D    +S+A+P       D+ I
Sbjct: 124 KAAGMNLSLTDLSRLARRGSGSACRSIFGGFVEWQKGSDD--TNSYAIPVETTHLNDICI 181

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             L I   +K I SRE M ++   SP++  W + +  DL +IK AI D DF + G ++E 
Sbjct: 182 VALTIEKHQKPISSREGMALSVTTSPYYPTWVKVVEADLENIKAAIQDDDFTRFGTISEL 241

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA++MHA  ++A P  LY+  +T+  M  V   R   I  Y+T+DAGPN+K++      +
Sbjct: 242 NAMRMHALTLSADPDFLYFNGDTLTAMNEVKRLRHSGIECYYTIDAGPNIKVICQQANVQ 301

Query: 317 TIKQFFPEI----TIIDPLDSPDLW 337
           TI   F  +     +      P + 
Sbjct: 302 TITDTFSNLFGPTKVTVAKPGPGVK 326


>gi|40882372|dbj|BAD07376.1| mevalonate diphosphate decarboxylase [Actinoplanes sp. A40644]
          Length = 334

 Score =  318 bits (815), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 111/324 (34%), Positives = 167/324 (51%), Gaps = 12/324 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILN 79
              ++A    NIAL KYWGK D +L +P  +SLS++L  L T+T + +      D + L+
Sbjct: 3   TAAATAVAHPNIALIKYWGKSDERLMIPYVDSLSMTLNILPTVTTVALDSGVRTDQVTLD 62

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALF 137
           G    ++  F ++   F DL R  +      +++T N +PT AGLASSASGFAAL +A  
Sbjct: 63  GSP--AKGDFRQRVVTFLDLLRAMAGRDDRAVVDTRNVVPTGAGLASSASGFAALAVAGA 120

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT---DQNGMDSFAVPFNNQWPDL 194
             Y +     +LSR+AR GS SA RS + GF     G    +     +FA P      D 
Sbjct: 121 AAYGLDLDPTALSRLARRGSASASRSIFGGFAICHAGQGGGEAADQSAFAEPVPVTGLDP 180

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVA 254
            + +  +    K + SREAM  T   SP +  W      DLA ++ A+   D   +GE+A
Sbjct: 181 ALVIALVNAGPKAVSSREAMRRTVATSPLYQSWAASSKIDLAEMRAALHHGDLAVVGEIA 240

Query: 255 EKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           E+NAL+MHATM+AA P + Y   +T+  ++ V   R   I  Y T+DAGPN+K+L     
Sbjct: 241 ERNALRMHATMLAARPAVRYLSADTVTVLDSVLRLRADGIAAYATMDAGPNVKVLCHRAD 300

Query: 315 ----EETIKQFFPEITIIDPLDSP 334
                + ++   P+ +++     P
Sbjct: 301 AGRVADAVRAAVPDCSVLTAGPGP 324


>gi|213964145|ref|ZP_03392383.1| ghmp kinase [Capnocytophaga sputigena Capno]
 gi|213953186|gb|EEB64530.1| ghmp kinase [Capnocytophaga sputigena Capno]
          Length = 343

 Score =  318 bits (815), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 92/331 (27%), Positives = 148/331 (44%), Gaps = 27/331 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI------TVIDSDADCII 77
           ++   PSNIAL KYWGK+  +  LP N S+S +L H  T T I       +  +  D   
Sbjct: 2   TTFKAPSNIALVKYWGKKGEQ--LPANPSISFTLTHCYTETSIDYERRSELSIASGDSFS 59

Query: 78  LNG-QKISSQSSFFKKTTQF----CDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
            N   +   + SF  K + F              +F I + N+ P  +G+ASSAS  AAL
Sbjct: 60  FNFSFEEQPKPSFHPKISTFFERILPYLPFLKDYHFNIASHNSFPHSSGIASSASAMAAL 119

Query: 133 TLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWIC-----GTDQNGM 180
           ++ L +I       Y+     +  S +ARLGSGSACRS       W       G+     
Sbjct: 120 SVCLMKIAVELGETYTEEAFWQKASFLARLGSGSACRSVKGSIVVWGEHPAIAGSSDEYG 179

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
            ++ +P +  + + +  +L I   +K++ S        H  PF      Q + ++  +  
Sbjct: 180 ITYPLPVHEVFQNYQDTILLIDRGQKQVSSTVG-HNLMHGHPFAEARFTQANKNINQLVS 238

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
                D     E+ E  AL +HA M  + P  +  +  T++ ++RVW  R+ + +P+ FT
Sbjct: 239 CFASGDIEHFMEIVESEALTLHAMMQTSIPYFILMRPNTLEVIQRVWQYRKDTKVPLCFT 298

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
           LDAG N+ LL+       +++F  E      
Sbjct: 299 LDAGANVHLLYPKTSIAEVQKFIAEELAQFC 329


>gi|195122128|ref|XP_002005564.1| GI19000 [Drosophila mojavensis]
 gi|193910632|gb|EDW09499.1| GI19000 [Drosophila mojavensis]
          Length = 379

 Score =  318 bits (815), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 97/320 (30%), Positives = 154/320 (48%), Gaps = 24/320 (7%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNGQKISSQSSF 89
           AL KYWGKR+ +L LP+N+S+S++L    +   T I+  +S   + + LNG+ +  + + 
Sbjct: 2   ALVKYWGKRNEELILPINDSVSMTLDANEMCAKTTISASESFKQNRMWLNGEVVPFEEN- 60

Query: 90  FKKTTQFCDLFRQFS----------KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
             +  +  +   + +               I + NN PT AGLASSA+G+A L   L R+
Sbjct: 61  -ARLMRCVEGIHRLALANGAHKFPLSWKVHIASYNNFPTAAGLASSAAGYACLVYTLARL 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPDLRIG 197
           Y +P   E L+ +AR GSGSACRS Y GF  W  GT  +G DS AV       WP++ + 
Sbjct: 120 YDLPMN-EELTTIARQGSGSACRSLYGGFVHWQRGTSADGSDSIAVQLAPAEHWPNMHML 178

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           +L + D  KK GS + M++    S        + +   +  +  AI  +DF    E+  K
Sbjct: 179 ILVVNDARKKTGSTKGMQLGVQTSALIQHRAKEVVPQRVKDLIAAIDARDFESFAEITMK 238

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKI 314
            + ++HA  +   PP +Y    +      V D  +   S+   +T DAGPN  L    + 
Sbjct: 239 ESNQLHAICLDTYPPCVYMNDVSHAIANFVHDYNETVGSVQAAYTFDAGPNACLYVLAEN 298

Query: 315 EETIKQFFPEITIIDPLDSP 334
              + +    I +  P D+ 
Sbjct: 299 ---VPRLLAAIQLAFPNDAS 315


>gi|223934070|ref|ZP_03626020.1| diphosphomevalonate decarboxylase [Streptococcus suis 89/1591]
 gi|223897261|gb|EEF63672.1| diphosphomevalonate decarboxylase [Streptococcus suis 89/1591]
          Length = 341

 Score =  318 bits (815), Expect = 9e-85,   Method: Composition-based stats.
 Identities = 130/338 (38%), Positives = 179/338 (52%), Gaps = 19/338 (5%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGKRD +L LP+N+SLSL+L    T T +       AD   LNG    
Sbjct: 8   ARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKVVFDPELTADEFYLNGMLQK 67

Query: 85  SQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            +     K ++F DLF ++     +  +E+ N +PT AGLASSAS FAAL LA      +
Sbjct: 68  EKEIL--KISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L + 
Sbjct: 126 DLSPATLSTLARRGSGSSTRSLFGGFVEWDMGTG--SEDSMAHPIDDADWDIGMVVLAVN 183

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KKI SRE M+ T   SPF++ W      DLA IK AI  +DF KLG++ E N +KMH
Sbjct: 184 TGPKKIASREGMDHTVATSPFYSAWVDTAKQDLADIKAAIAGRDFEKLGQITEHNGMKMH 243

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEE----T 317
           AT ++A+PP  YW  +++   E V   R+   +  Y T+DAGPN+K+L      +     
Sbjct: 244 ATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRASQMDELVAE 303

Query: 318 IKQFFPEITIIDPLDSP-------DLWSTKDSLSQKNS 348
           + + FP   II     P       D W T  +  +K  
Sbjct: 304 LAKVFPREKIITSKPGPAAYVLSEDEWQTSQAAFEKGL 341


>gi|319952528|ref|YP_004163795.1| ghmp kinase [Cellulophaga algicola DSM 14237]
 gi|319421188|gb|ADV48297.1| GHMP kinase [Cellulophaga algicola DSM 14237]
          Length = 364

 Score =  317 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 93/349 (26%), Positives = 155/349 (44%), Gaps = 31/349 (8%)

Query: 7   HILHRYIGEC--NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            I   +I     +     K S   PSNIAL KYWGK+  +  LP N S+S +L    T T
Sbjct: 1   MIEKDFIPSAYNHTITEGKVSYKSPSNIALVKYWGKK--ENQLPQNPSISFTLDACATTT 58

Query: 65  HITVI----DSDA--DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSN 114
            I+       S+     ++  G            FF +   +    ++    +F IETSN
Sbjct: 59  KISFKRLNKPSEEYSFDLLFEGNSKEDFKPKIKIFFTRIEVYLPFLKE---YHFTIETSN 115

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSI-------PEKSESLSRVARLGSGSACRSFYRG 167
           + P  +G+ASSASG +AL L L  +             ++ +S +ARLGSGSACRS    
Sbjct: 116 SFPHSSGIASSASGMSALALCLVALEKQLNPEMSDDFFTKKVSFLARLGSGSACRSIEGD 175

Query: 168 FCEWICGTDQNGMDS-----FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSP 222
             +W    +  G        +    ++ +      +L +   +K++ S        H+ P
Sbjct: 176 IVQWGNHENTEGSSDLFGIKYPYKVHDNFKRFHDTILLVDKGQKQVSSTVG-HNLMHNHP 234

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           F TQ  +Q   +L  +       D  +   + E  AL +HA M+ + P  +  +  T++ 
Sbjct: 235 FATQRFKQAHENLDKLIAVFESGDLKEFIAIVESEALTLHAMMMTSMPNFILMKPNTLEI 294

Query: 283 MERVWDARQQSI-PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
           + ++W+ R++S   + FTLDAG N+ +L+    ++ + QF  +  I   
Sbjct: 295 INKIWEFREKSNSNVCFTLDAGANVHVLYPENEKDVVFQFIKDELIGYC 343


>gi|302023328|ref|ZP_07248539.1| diphosphomevalonate decarboxylase [Streptococcus suis 05HAS68]
 gi|330832129|ref|YP_004400954.1| mevalonate diphosphate decarboxylase [Streptococcus suis ST3]
 gi|329306352|gb|AEB80768.1| mevalonate diphosphate decarboxylase [Streptococcus suis ST3]
          Length = 341

 Score =  317 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 130/338 (38%), Positives = 179/338 (52%), Gaps = 19/338 (5%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGKRD +L LP+N+SLSL+L    T T +       AD   LNG    
Sbjct: 8   ARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYTDTKVVFDPELTADEFYLNGMLQK 67

Query: 85  SQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            +     K ++F DLF ++     +  +E+ N +PT AGLASSAS FAAL LA      +
Sbjct: 68  EKEIL--KISRFLDLFCEYIGERAFARVESLNFVPTAAGLASSASAFAALALATATALDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LS +AR GSGS+ RS + GF EW  GT     DS A P ++   D+ + +L + 
Sbjct: 126 DLSPATLSTLARRGSGSSTRSLFGGFVEWDMGTG--SEDSMAHPIDDADWDIGMVVLAVN 183

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
              KKI SRE M+ T   SPF+T W +    DL  IK AI  +DF KLG++ E N +KMH
Sbjct: 184 TGPKKIASREGMDHTVATSPFYTAWVETAKQDLVDIKAAIASRDFEKLGQITEHNGMKMH 243

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEE----T 317
           AT ++A+PP  YW  +++   E V   R+   +  Y T+DAGPN+K+L      +     
Sbjct: 244 ATTLSANPPFTYWSADSLVAQEAVRQVREATGLSAYMTMDAGPNVKVLCRTSQMDELVAE 303

Query: 318 IKQFFPEITIIDPLDSP-------DLWSTKDSLSQKNS 348
           + + FP   II     P       D W T  +  +K  
Sbjct: 304 LAKVFPREKIITSKPGPAAYVLSEDEWQTSQAAFEKGL 341


>gi|237784665|ref|YP_002905370.1| diphosphomevalonate decarboxylase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237757577|gb|ACR16827.1| diphosphomevalonate decarboxylase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 375

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 116/352 (32%), Positives = 171/352 (48%), Gaps = 16/352 (4%)

Query: 10  HRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI 69
           H  +G+  P     + A    NIAL KYWGKR++ L LP   SLSL+L    T T +   
Sbjct: 5   HPSMGDIGPITPRTARATAHPNIALVKYWGKRNADLVLPATGSLSLTLDIYPTDTVVNPD 64

Query: 70  DS-DADCIILNGQKISSQSSFFKKTTQFCDLFR--------QFSKVYFLIETSNNIPTKA 120
            S  +D   LNG+      +   +   F DL R        + + +Y  I + N++PT A
Sbjct: 65  PSLTSDIFTLNGEPAPGTPTH--RVRAFLDLVRKLSAEQNPELAHMYARINSVNSVPTGA 122

Query: 121 GLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           GLASSASGFAAL  A  + Y +P    SLSR+AR GSGSA RS       W  G   +  
Sbjct: 123 GLASSASGFAALATAASKAYGLPGDPRSLSRLARRGSGSATRSILGNLVIWHPGDGDDEN 182

Query: 181 -DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIK 239
            D  +   +   PDL + +  +   +K + SR AM  T   SPFF  W      DL  ++
Sbjct: 183 ADLTSYAESVPGPDLAMVICVVSGAQKAVSSRVAMADTIRTSPFFDGWVSSTQRDLVDMQ 242

Query: 240 QAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT 299
           QA+ + D+ ++GE+ E NAL+MHA +    PP+ Y    ++   + +   R   + +Y T
Sbjct: 243 QALAEGDYTRVGEITESNALRMHAAINGNRPPVRYLAPTSVAIFDTIAQLRNDGLEVYGT 302

Query: 300 LDAGPNLKLLFTHKIEE----TIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
            DAGPN+  L   K  +     +++ FP++ +I        + T    +  N
Sbjct: 303 ADAGPNVVALCQAKDLDATHAALRERFPDLELIPARAGSGAYLTPVEETSGN 354


>gi|302417826|ref|XP_003006744.1| diphosphomevalonate decarboxylase [Verticillium albo-atrum
           VaMs.102]
 gi|261354346|gb|EEY16774.1| diphosphomevalonate decarboxylase [Verticillium albo-atrum
           VaMs.102]
          Length = 412

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 103/312 (33%), Positives = 156/312 (50%), Gaps = 20/312 (6%)

Query: 35  CKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVIDS--DADCIILNGQKISSQSSFF 90
            +YWGKRD+KLNLP N+SLS++L    L T+T  +   S  + D +ILNG+      +  
Sbjct: 41  IRYWGKRDAKLNLPTNSSLSVTLAQSDLRTLTTASTSASYPEGDSLILNGEPSDITGART 100

Query: 91  KKTTQFCDLFR-----------QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           +   +     R           + + +   + + NN PT AGLASSA+GFAAL  A+  +
Sbjct: 101 QACFRELRARRAALEASDSSLPKLAALPLRVVSENNFPTAAGLASSAAGFAALVRAIADL 160

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIG 197
           Y +P+  + LS VAR GSGSACRS + G+  W  G+  +G DS A  V   + WPD+R  
Sbjct: 161 YQLPDTPDQLSLVARQGSGSACRSLFGGYVAWRMGSAADGSDSKADLVAEASHWPDMRAL 220

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEK 256
           +L +   +K + S   M+ T   S  F Q  Q  +  ++  ++QAI D+DF K  EV  +
Sbjct: 221 ILVVSAAKKGVSSSSGMQQTVATSGLFQQRIQTVVPANMDLMEQAIRDRDFAKFAEVTMR 280

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKI 314
           ++   H+T     PP+ Y    +   +  V             +T DAGPN  + +    
Sbjct: 281 DSNSFHSTCADTYPPIFYMNDVSRAAIRAVEAINAAAGRTVAAYTFDAGPNAVIYYQEAD 340

Query: 315 EETIKQFFPEIT 326
           E T+   F  + 
Sbjct: 341 EATVVGAFTAVL 352


>gi|330834517|ref|YP_004409245.1| diphosphomevalonate decarboxylase [Metallosphaera cuprina Ar-4]
 gi|329566656|gb|AEB94761.1| diphosphomevalonate decarboxylase [Metallosphaera cuprina Ar-4]
          Length = 326

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 97/309 (31%), Positives = 163/309 (52%), Gaps = 10/309 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           ++ A  P+NIA+ KYWGKR+ +LNLPLN+SLS++L  L   + +T  ++ + D I +NG+
Sbjct: 4   EAEAVAPANIAVVKYWGKRNKQLNLPLNDSLSITLESLQVRSKVTFDENLNHDEIFVNGE 63

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           ++S   +  +   +  ++ R+     V+  IE+++N P+ AGLASSA+G AALT A    
Sbjct: 64  RLSDYETR-EYAGRVLEIIRKLYGKRVFARIESTSNFPSSAGLASSAAGIAALTFASNAA 122

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIG 197
            ++    + LS++AR+GSGSACRS + GF  W  G    G DSF       + WP+L   
Sbjct: 123 LNLGLDDKELSKIARVGSGSACRSMFGGFVRWNKGESDEGDDSFCEQVFGPDHWPNLVDV 182

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +    + +KK+ SR  ME +   S       + +      I +AI D+D      +  ++
Sbjct: 183 IGIFKEEKKKVSSRSGMESSVASSSLLKCRLRFVEETFDDIIKAIRDRDVNSFFHLTMRH 242

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEET 317
           +  MHA ++ + P + Y   ++   M+ V +         +T DAGPN  +L   +  + 
Sbjct: 243 SNSMHAIILDSWPSMSYLNDKSFVVMDWVHEF----GKAAYTFDAGPNPHILVLEENVQE 298

Query: 318 IKQFFPEIT 326
           +  F   + 
Sbjct: 299 VVNFLEGLG 307


>gi|332519093|ref|ZP_08395560.1| GHMP kinase [Lacinutrix algicola 5H-3-7-4]
 gi|332044941|gb|EGI81134.1| GHMP kinase [Lacinutrix algicola 5H-3-7-4]
          Length = 360

 Score =  317 bits (813), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 91/336 (27%), Positives = 150/336 (44%), Gaps = 29/336 (8%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------D 74
           N +     PSNIAL KYWGK++ +  +P N S+S +L    TIT +              
Sbjct: 17  NGEIKWASPSNIALVKYWGKKEHQ--IPENQSISFTLSDCKTITKLKYEAKAKTTNSFDF 74

Query: 75  CIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
            + L+G++          FF +  Q+         + F IET N  P  +G+ASSASG +
Sbjct: 75  QVYLDGERKPDFEPKIEVFFNRIQQYFPF---LKTLKFTIETENTFPHSSGIASSASGMS 131

Query: 131 ALTLALFRIYSI-------PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS- 182
           AL L L  I             ++  S +ARLGSGSACRS       W    +       
Sbjct: 132 ALALCLMSIEKQLNPEITESYFNKKASFIARLGSGSACRSIQGDLVVWGAHNEIENSSDL 191

Query: 183 ----FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
               +    ++ + + +  +L +   EK++ S        H  PF  Q  +Q + +++ I
Sbjct: 192 YGVKYPYQVHDNFKNYQDTILLVDKGEKQVSSTVG-HNLMHGHPFAKQRFKQANNNISEI 250

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
           K  +   D      + E  AL +HA M+ + P  +  +  T++ + ++W  R+ + + I 
Sbjct: 251 KNILKSGDLKAFIALVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWSFRKATNLNIC 310

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           FTLDAG N+ +L+  K +E I +F     +    + 
Sbjct: 311 FTLDAGANVHILYPEKEKEQILEFIKTQLVAYCQNG 346


>gi|57753871|dbj|BAD86801.1| mevalonate diphosphate decarboxylase [Streptomyces sp. KO-3988]
          Length = 350

 Score =  316 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 109/301 (36%), Positives = 158/301 (52%), Gaps = 10/301 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQK 82
            +A    NIAL KYWGKRD  L LP  +SLS++L    T T + +  ++  D +  NG  
Sbjct: 20  VTAVAQPNIALIKYWGKRDEHLFLPWTSSLSMTLDIFPTTTRVHLDAEATDDEVTFNGAP 79

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            + +     + T F DL RQ + +    +++T N +PT AGLASSA GFAAL +A    Y
Sbjct: 80  AAGEERR--RITGFLDLVRQRAGLTHRAVVDTRNTVPTGAGLASSAGGFAALAVAAATAY 137

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVPFNNQWPDLR 195
            +      LSR+AR GSGSA RS + GF  W  G       +  + S+A P      D  
Sbjct: 138 GLDLDDTGLSRLARRGSGSASRSIFGGFAVWNAGTPTAPPAEADLSSYAEPVPVGDLDPA 197

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           + +  +    K + SR AM  T   SP F  W      DL  ++QA++  D   +GE+AE
Sbjct: 198 LVIAVVNAGPKDVSSRAAMRRTVETSPLFEPWAASSRDDLTEMRQALLRADLDAVGEIAE 257

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +N+L MHATM++A P + Y    ++  ++ V   R+  I  Y T+DAGPN+K+L      
Sbjct: 258 RNSLGMHATMLSARPAVRYLSPASLTVLDSVLRLRRDGISAYATMDAGPNVKVLCRRADA 317

Query: 316 E 316
           +
Sbjct: 318 D 318


>gi|323466406|gb|ADX70093.1| Mevalonate diphosphate decarboxylase [Lactobacillus helveticus H10]
          Length = 320

 Score =  316 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 114/316 (36%), Positives = 177/316 (56%), Gaps = 11/316 (3%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ 86
              +NIAL KYWGK +++L LPL +SLS++L    T T +    +D +   LNGQK  S+
Sbjct: 6   RAHTNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKT-NDENAFYLNGQKQDSK 64

Query: 87  SSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
            S  ++   +    +     +   ++++ N++PT AGLASS+S FAAL  A  + Y+I  
Sbjct: 65  QS--QRVFSYLTKLQNKFGYHDNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQV 122

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             + LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   
Sbjct: 123 DKKELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQ-MDLHLLAVELNTN 181

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA 
Sbjct: 182 QKKISSTSGMKE-AQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAI 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP- 323
            + A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L   K  + I + F  
Sbjct: 241 NLTAQPEFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLKNSKEIIERFKS 300

Query: 324 ---EITIIDPLDSPDL 336
               + I+     P +
Sbjct: 301 VFNNVNIVIANFGPGI 316


>gi|313222437|emb|CBY39357.1| unnamed protein product [Oikopleura dioica]
          Length = 389

 Score =  316 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 112/331 (33%), Positives = 169/331 (51%), Gaps = 26/331 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +   P NIAL KYWGKRDS+L LP N+S+SL+L    LGT T +    S + D ++LNG+
Sbjct: 9   TVEAPVNIALVKYWGKRDSELILPYNDSVSLTLDEEKLGTRTTVRYSASYEEDSLVLNGK 68

Query: 82  KISSQSSFFKKTTQFCDLFRQFS--------------KVYFLIETSNNIPTKAGLASSAS 127
                S       +    FR+ +              +  F IET+N +PT AGLASSAS
Sbjct: 69  PTVISSRLSNVIEEIRRAFRKHAVRIKMNAQDLMSMSRYRFRIETNNKMPTAAGLASSAS 128

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           G A +T AL     I E    +S++ARLGSGSACRS + G  +W  G +++G DS A  +
Sbjct: 129 GMACITFALCTALGITESV-DMSQLARLGSGSACRSIHGGLVQWEAGKEEDGSDSLAKQI 187

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
              + WP+L+  +L +   +KK+GS E M+ +   S +     +Q    +  +  A   +
Sbjct: 188 YPASTWPELKFIVLVVDGEKKKVGSTEGMQRSMATSEYMLLRPKQCKDRIQEVCWAFQAK 247

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
            F  L EV  K++  +HA    + PP+ Y  + +   ++ V    +    + + +T DAG
Sbjct: 248 LFPALAEVIIKDSNTLHAICRDSYPPVNYLTRTSEALIDFVHRLNEALGDVCVAYTFDAG 307

Query: 304 PNLKLLFTHKIEE----TIKQFFPEITIIDP 330
           PN  ++F  K E      +   F E  +IDP
Sbjct: 308 PNCFVIFEEKHESLLMWLLLHTFIENDVIDP 338


>gi|154335383|ref|XP_001563930.1| diphosphomevalonate decarboxylase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134060961|emb|CAM37978.1| putative mevalonate-diphosphate decarboxylase [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 393

 Score =  316 bits (811), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 93/333 (27%), Positives = 148/333 (44%), Gaps = 23/333 (6%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVI-DSDA 73
               + +   P NIA  KYWGKR+   KL LP N+S S++L      + T + +  D+  
Sbjct: 12  PAPIRVTVEAPINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRRDATE 71

Query: 74  DCIILNGQKISSQS-SFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
           D + LNG+K + Q     +                +   I + NN PT AG+ASSASG+ 
Sbjct: 72  DELWLNGKKSNIQETPRIQSVLSCIRANCPSHLKSLKAYIVSENNFPTAAGMASSASGYC 131

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
           AL  AL + YS       +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++
Sbjct: 132 ALASALVKAYSATVD---VSMLSRLGSGSACRSAYGGFVIWHRGEKPDGTDCIATQFVDE 188

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDF 247
             WPD+++    +   +K + S   M+ +   SP  +      +   +  +K+AI  +DF
Sbjct: 189 KYWPDMQVLCAVLKGEKKDVSSTTGMQQSLKTSPMMSDRIASVVPARMKAVKEAIQQRDF 248

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPN 305
            K  E+A  ++  +        P + Y  +++   +  +      +    + +T DAG N
Sbjct: 249 NKFAEIAMADSDDLQEICHTTVPCIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGAN 308

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPDLWS 338
             +    K         PE+  +     P  W 
Sbjct: 309 CFMFTLKKN-------LPEVVAMLCAHFPTSWE 334


>gi|238623518|emb|CAX48657.1| putative diphosphomevalonate decarboxylase [Streptomyces anulatus]
          Length = 351

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 160/300 (53%), Gaps = 10/300 (3%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISSQS 87
             NIAL KYWGKRD +L LP  +SLS++L  L T TH+ +   ++ D + L+G  +    
Sbjct: 26  HPNIALIKYWGKRDERLVLPRTDSLSMTLDILPTTTHVRLDPEAEHDEVTLDGVPLEGGP 85

Query: 88  SFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              ++   F +L R+ +       +++ N +PT AGLASSASGFAAL +A    Y +   
Sbjct: 86  --RQRVITFLELVRERAGSSRRAAVDSRNTVPTGAGLASSASGFAALAVAASAAYGLGLD 143

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVPFNNQWPDLRIGLLK 200
           + +LSR+AR GSGSA RS +  F  W  G          + S+A P      D  + +  
Sbjct: 144 ATALSRLARRGSGSASRSIFGDFAIWHAGRPTGSATDADLGSYAEPVPAAEFDPALVIAV 203

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +    K + SREAM  T   SP +  W      DL  ++ A+   D   +GE+AE+NAL 
Sbjct: 204 VNAGPKDVSSREAMRRTVETSPLYGPWAASSEGDLVDMRVALRRGDLDAVGEIAERNALG 263

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHATM+AA P + Y    T+  ++ V   R+  +P Y T+DAGPN+K+L      + + Q
Sbjct: 264 MHATMLAARPAVRYLSAPTLDVLDSVLRLRRDGVPAYATMDAGPNVKVLCHRTDADRVAQ 323


>gi|163787351|ref|ZP_02181798.1| hypothetical protein FBALC1_02392 [Flavobacteriales bacterium
           ALC-1]
 gi|159877239|gb|EDP71296.1| hypothetical protein FBALC1_02392 [Flavobacteriales bacterium
           ALC-1]
          Length = 364

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 92/337 (27%), Positives = 152/337 (45%), Gaps = 31/337 (9%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD----ADCI 76
           N       PSNIAL KYWGK++ +  +P N S+S +L +  TIT +T         +  +
Sbjct: 17  NGSVKWSSPSNIALVKYWGKKEHQ--IPENPSISFTLSNCKTITEVTYTKKVGEGFSFDV 74

Query: 77  ILNGQKISSQSSFFKKTTQFCD----LFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
              G+K     +F  K   F +            +F IETSN  P  +G+ASSASG +A+
Sbjct: 75  YFEGEK---NEAFKPKIQTFFERIEVYVPFLRDYHFKIETSNTFPHSSGIASSASGMSAI 131

Query: 133 TLALFRIYSI------------PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
            L L  I                  ++  S +ARLGSGSACRS       W         
Sbjct: 132 ALCLMSIEQKLSDTVISSAAEKSHFNQKASFLARLGSGSACRSIEGELVVWGKNESTESS 191

Query: 181 DSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLA 236
           D F V +    +  + + +  +L +   EK++ S    ++   H PF  +   Q   +LA
Sbjct: 192 DLFGVKYEGEVHTNFKNYQDTILLVDKGEKQVSSTVGHKLMFGH-PFAKERFAQAHDNLA 250

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IP 295
            +K  +   D     ++ E  AL +HA M+ + P  +  +  T++ + ++W  R+++   
Sbjct: 251 KLKSILTSGDLKAFVKIVESEALTLHAMMMTSMPYFILMKPNTLEIINKIWKFREENDSN 310

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           + FTLDAG N+ +L+    ++T+  F  +       +
Sbjct: 311 VCFTLDAGANVHVLYPENEKQTVLDFIKKELTNFCQN 347


>gi|313217596|emb|CBY38658.1| unnamed protein product [Oikopleura dioica]
 gi|313231898|emb|CBY09010.1| unnamed protein product [Oikopleura dioica]
          Length = 389

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 113/331 (34%), Positives = 168/331 (50%), Gaps = 26/331 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQ 81
           +   P NIAL KYWGKRDS+L LP N+S+SL+L    LGT T +    S + D ++LNG+
Sbjct: 9   TVEAPVNIALVKYWGKRDSELILPYNDSVSLTLDEEKLGTRTTVRYSASYEEDSLVLNGK 68

Query: 82  KISSQSSFFKKTTQFCDLFRQ--------------FSKVYFLIETSNNIPTKAGLASSAS 127
                S       +    FR+               S+  F IET+N +PT AGLASSAS
Sbjct: 69  PTVISSRLSNVIEEIRRAFRKQAVRIKMNAQDLMSMSRYRFRIETNNKMPTAAGLASSAS 128

Query: 128 GFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--V 185
           G A +T AL     I E    +S +ARLGSGSACRS + G  +W  G +++G DS A  +
Sbjct: 129 GMACITFALCTALGITESV-DMSELARLGSGSACRSIHGGLVQWEAGKEEDGSDSLAKQI 187

Query: 186 PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
              + WP+L+  +L +   +KK+GS E M+ +   S +     +Q    +  +  A   +
Sbjct: 188 YPASTWPELKFIVLVVDGEKKKVGSTEGMQRSMATSEYMLLRPKQCKDRIQEVCWAFQAK 247

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
            F  L EV  K++  +HA    + PP+ Y  + +   ++ V    +    + + +T DAG
Sbjct: 248 LFPALAEVIIKDSNTLHAICRDSYPPVNYLTRTSEALIDFVHRLNEALGDVCVAYTFDAG 307

Query: 304 PNLKLLFTHKIEE----TIKQFFPEITIIDP 330
           PN  ++F  K E      +   F E  +IDP
Sbjct: 308 PNCFVIFEEKHESLLMWLLLHTFIENDVIDP 338


>gi|320161393|ref|YP_004174617.1| diphosphomevalonate decarboxylase [Anaerolinea thermophila UNI-1]
 gi|319995246|dbj|BAJ64017.1| diphosphomevalonate decarboxylase [Anaerolinea thermophila UNI-1]
          Length = 326

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 156/307 (50%), Gaps = 7/307 (2%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNG 80
            +++A    NIA  KYWG RD+ L +P N S+S++L  L   T +     S  D +ILNG
Sbjct: 2   GQATAIAHPNIAFIKYWGNRDAVLRIPENGSISMNLAELTVKTTVIFEKHSREDTLILNG 61

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                     K+ + F D  R+F+    +  + + NN PT AG+ASSA+ FAAL LA   
Sbjct: 62  ALAD--EPALKRVSHFLDRVREFAGISWHAHVISENNFPTGAGIASSAAAFAALALAATS 119

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
              +      LSR+AR GSGSACRS   GF EWI G       + ++     W  L   +
Sbjct: 120 AIGLHLSERDLSRLARKGSGSACRSIPGGFVEWIPGETDEDSYAVSIAPPEHW-ALTDCI 178

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
             +  + K IGS +        SP            L  +++AI+++DF+ L E+ E ++
Sbjct: 179 AILSTQHKPIGSTQG-HALASTSPLQPARVADTPRRLEIVRRAILERDFLSLAEMIEHDS 237

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
             MHA M+ ++PPL YW+  ++  M+ V + R+  +P  +TLDAGPN+ ++   +  E +
Sbjct: 238 NLMHAVMMTSTPPLFYWEPVSLVIMKSVREWRESGLPCAYTLDAGPNVHVICPSEYAEEV 297

Query: 319 KQFFPEI 325
                 I
Sbjct: 298 IFRLTSI 304


>gi|157867709|ref|XP_001682408.1| diphosphomevalonate decarboxylase [Leishmania major strain
           Friedlin]
 gi|68125862|emb|CAJ03409.1| putative mevalonate-diphosphate decarboxylase [Leishmania major
           strain Friedlin]
          Length = 383

 Score =  316 bits (810), Expect = 3e-84,   Method: Composition-based stats.
 Identities = 89/332 (26%), Positives = 150/332 (45%), Gaps = 27/332 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITV-IDSDADCII 77
           + +   P NIA  KYWGKR+    L LP N+S S++L      + T + +  D+  D + 
Sbjct: 6   RVTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSTKPFRSKTSVELRSDASEDELW 65

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQF-----SKVYFLIETSNNIPTKAGLASSASGFAAL 132
           LNG+K + Q +   +        R         +   I + NN PT AG+ASSASG+ AL
Sbjct: 66  LNGKKSNIQET--PRIQSVLSCIRDNCPDNTKNLKAYIVSENNFPTAAGMASSASGYCAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
             AL + Y        +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  
Sbjct: 124 AAALVKAYGATVD---VSMLSRLGSGSACRSVYGGFVIWHKGEKPDGTDCIATQFLDEKY 180

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++++    +   +K + S   M+ +   S    +  + I    ++ +K+AI  +DF +
Sbjct: 181 WPEVQVMCAVLKGEKKDVSSTSGMQQSLKTSSMMRERIESIVPARMSAVKEAIQQRDFNQ 240

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIPI-YFTLDAGPNLK 307
              +A  ++  +        PP+ Y   ++   +  +     ++   +  +T DAG N  
Sbjct: 241 FAAIAMADSDDLQEICRTTKPPIQYATDDSYAMIRLIRAFNAKKGYNVMAYTFDAGANCF 300

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           +    +         PE+ ++     P  W  
Sbjct: 301 MFTLKQD-------LPEVVVMLRAHFPTSWDK 325


>gi|295397032|ref|ZP_06807146.1| diphosphomevalonate decarboxylase [Aerococcus viridans ATCC 11563]
 gi|294974723|gb|EFG50436.1| diphosphomevalonate decarboxylase [Aerococcus viridans ATCC 11563]
          Length = 337

 Score =  316 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 122/320 (38%), Positives = 182/320 (56%), Gaps = 13/320 (4%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQKISS 85
              +NIAL KYWGK +  L +P  +SLSL+L  L T T +T   + DAD   LN Q  + 
Sbjct: 9   RAHTNIALIKYWGKANKDLFIPTTSSLSLTLDALYTDTRVTFSNELDADIFYLNNQLRNE 68

Query: 86  QSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
             +   K ++F D+FRQ + V     +E+ N++PT AGLASS+S F+AL  A  +  ++ 
Sbjct: 69  AET--AKISKFLDMFRQEAGVDLRAKVESVNHVPTAAGLASSSSAFSALAAATRQALNLE 126

Query: 144 EKSES--LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           ++     LS  AR GSGSA RS + GF EW  GT     +S AV  ++   D+ + ++ I
Sbjct: 127 DQISDQALSTFARQGSGSATRSIFGGFVEWQKGTTNE--NSMAVEIDDASWDVGMVIMAI 184

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              EK++ SRE M  T   SPF+ +W +Q   DL  IK AI  QDF  +GE+AE NA++M
Sbjct: 185 NTAEKRVSSREGMAHTMQTSPFYPEWVRQNMIDLERIKAAIAKQDFQLMGEIAEANAMRM 244

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT +A+ P   Y++ +TI+ ++ V D R   +  Y+T+DAGPN+K+L      + ++ F
Sbjct: 245 HATTMASDPSFTYFEPDTIKAIQAVQDLRATGVLAYYTIDAGPNVKVLCKASQMDEVEAF 304

Query: 322 ----FPEITIIDPLDSPDLW 337
               F ++  I     P + 
Sbjct: 305 FAERFKDMNFIQTTAGPGIK 324


>gi|161507627|ref|YP_001577581.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus DPC
           4571]
 gi|15212071|emb|CAC51371.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus]
 gi|160348616|gb|ABX27290.1| Mevalonate diphosphate decarboxylase [Lactobacillus helveticus DPC
           4571]
          Length = 320

 Score =  316 bits (809), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 113/316 (35%), Positives = 177/316 (56%), Gaps = 11/316 (3%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ 86
              +NIAL KYWGK +++L LPL +SLS++L    T T +    +D +   LNGQK  S+
Sbjct: 6   RAHTNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKT-NDENAFYLNGQKQDSK 64

Query: 87  SSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
            S  ++   +    +     +   ++++ N++PT AGLASS+S FAAL  A  + Y+I  
Sbjct: 65  QS--QRVFSYLTKLQNKFGYHDNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQV 122

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             + LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   
Sbjct: 123 DKKELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQ-MDLHLLAVELNTN 181

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA 
Sbjct: 182 QKKISSTSGMKE-AQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAI 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP- 323
            + A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L   +  + I + F  
Sbjct: 241 NLTAQPKFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLRNSKEIIERFKS 300

Query: 324 ---EITIIDPLDSPDL 336
               + I+     P +
Sbjct: 301 VFNNVNIVIANFGPGI 316


>gi|260101295|ref|ZP_05751532.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus DSM
           20075]
 gi|111610214|gb|ABH11599.1| mevalonate diphosphate decarboxylase [Lactobacillus helveticus
           CNRZ32]
 gi|260084880|gb|EEW69000.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus DSM
           20075]
 gi|328466025|gb|EGF37202.1| diphosphomevalonate decarboxylase [Lactobacillus helveticus MTCC
           5463]
          Length = 320

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 113/316 (35%), Positives = 177/316 (56%), Gaps = 11/316 (3%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ 86
              +NIAL KYWGK +++L LPL +SLS++L    T T +    +D +   LNGQK  S+
Sbjct: 6   RAHTNIALIKYWGKANAELRLPLMSSLSMTLDAFYTDTSVEKT-NDENAFYLNGQKQDSK 64

Query: 87  SSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
            S  ++   +    +     +   ++++ N++PT AGLASS+S FAAL  A  + Y+I  
Sbjct: 65  QS--QRVFSYLTKLQNKFGYHDNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQYYNIQV 122

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             + LSR+AR+GSGSACRS + GF  W  G       ++A+  + Q  DL +  +++   
Sbjct: 123 DKKELSRLARIGSGSACRSIFGGFSVWQKGDSDASSYAYALDEHPQ-MDLHLLAVELNTN 181

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +KKI S   M+     SPFF  W ++  T+L  +  AI + DF  LGE+AE NA +MHA 
Sbjct: 182 QKKISSTSGMKE-AQSSPFFNPWLERNETELNQMIAAIKNDDFTALGELAELNANEMHAI 240

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP- 323
            + A P   Y++  TI+ ++ V D R++ I  Y+T+DAGPN+K+L   +  + I + F  
Sbjct: 241 NLTAQPEFTYFEPNTIRAIKLVEDLRKEGIECYYTIDAGPNIKILCRLRNSKEIIERFKS 300

Query: 324 ---EITIIDPLDSPDL 336
               + I+     P +
Sbjct: 301 VFNNVNIVIANFGPGI 316


>gi|89890109|ref|ZP_01201620.1| diphosphomevalonate decarboxylase [Flavobacteria bacterium BBFL7]
 gi|89518382|gb|EAS21038.1| diphosphomevalonate decarboxylase [Flavobacteria bacterium BBFL7]
          Length = 351

 Score =  315 bits (808), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 87/328 (26%), Positives = 145/328 (44%), Gaps = 21/328 (6%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA-DCIILN 79
           +  +    PSNIAL KYWGK    + LP N S+S +L    TIT +T         I  +
Sbjct: 16  HLSTKWQAPSNIALVKYWGKYG--MQLPANPSISFTLNACRTITTVTASKGTHGFNISYD 73

Query: 80  GQKISSQSSFFKKTTQFC----DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           G+    +  F  K   +     D     +  +F I+T N  P  +G+ASSAS  AA+++ 
Sbjct: 74  GEP---KPEFAPKIEAYFKRIADYCPWIANYHFDIDTHNTFPHSSGIASSASSMAAMSVC 130

Query: 136 LFRIY----SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF-----AVP 186
           +                 S +ARLGSGSACRS       W    + +G   +     +  
Sbjct: 131 MMDFESTLTGQEMDFHKASFLARLGSGSACRSLKGSAVVWGTHDEVDGSSQYFGIDKSDY 190

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
            +  + D +  +L +   EK + S        +   F     +Q   +L+ +K A+ D D
Sbjct: 191 LHPVFQDFQDTILLVDKGEKVVSSTVG-HELMNGHAFAKARFEQAHENLSTLKIALQDGD 249

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPN 305
                ++ E  AL +HA M+ + P  +  + +T+  +E +W  R++  IP+ FTLDAG N
Sbjct: 250 LETFIKITESEALTLHAMMMTSHPYFILMKPKTLSIIEEIWAFRKETGIPVCFTLDAGAN 309

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDS 333
           + +L+ ++  E ++            + 
Sbjct: 310 VHMLYPNENNEAVQGLINSKLAGYCQNG 337


>gi|259047796|ref|ZP_05738197.1| diphosphomevalonate decarboxylase [Granulicatella adiacens ATCC
           49175]
 gi|259035473|gb|EEW36728.1| diphosphomevalonate decarboxylase [Granulicatella adiacens ATCC
           49175]
          Length = 340

 Score =  315 bits (808), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 125/330 (37%), Positives = 184/330 (55%), Gaps = 12/330 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
               +NIAL KYWGK + +L +P+N+SLSL+L    T T + + D+   D   LNG K  
Sbjct: 8   TRAHTNIALIKYWGKENKELFIPMNSSLSLTLEAFYTDTKVELSDTLTEDEFYLNGAKQD 67

Query: 85  SQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +   K T+F DLFR  +       +E+ N +PT AGLASSAS FAAL  A+     +
Sbjct: 68  --EAAIAKITRFLDLFRTETGDTRRARVESLNFVPTAAGLASSASAFAALAGAMNEATGL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
              ++ LS  AR GSGSA RS + GF EW  G      +S A+P ++   D+ + ++ + 
Sbjct: 126 NMPAQKLSTYARRGSGSATRSLFGGFVEWNKGDSNE--NSMAIPVDDANFDIGMIIIVVS 183

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EKKI SR  ME+T   SPF+  W    +TDLA IK+AI D+D  ++G +AE N +KMH
Sbjct: 184 AAEKKISSRAGMELTVSTSPFYEGWVTSAATDLADIKEAIKDRDIHRIGSIAEFNGMKMH 243

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIK-- 319
           ATM+A++PP  Y++ E+I   + +   R++  IP YFT+DAGPN+K++        I   
Sbjct: 244 ATMLASNPPFCYFEPESIVAQQTIRTIREERGIPAYFTMDAGPNVKVICKASDIPAILEE 303

Query: 320 --QFFPEITIIDPLDSPDLWSTKDSLSQKN 347
             + FP   +I  L    + +  +     +
Sbjct: 304 LGKVFPSEKLIPTLPGEGIRTLTEDEWNAS 333


>gi|254495128|ref|ZP_05108052.1| diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
 gi|85819478|gb|EAQ40635.1| diphosphomevalonate decarboxylase [Polaribacter sp. MED152]
          Length = 359

 Score =  315 bits (807), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 90/348 (25%), Positives = 152/348 (43%), Gaps = 30/348 (8%)

Query: 7   HILHRYI--GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
               +++   + N   N K +   PSNIAL KYWGK + +  +P N S+S +L +  TIT
Sbjct: 1   MNTDQFLVKSDINLIENTKFTWKTPSNIALVKYWGKSNPQ--IPKNASISFTLNNCHTIT 58

Query: 65  HITVIDSDA-----DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNN 115
            I     +        +   G+K          FFK+   +C            I + N+
Sbjct: 59  TIEFEKIEKTTEVTFDLFFEGKKKEEFKPKIAEFFKRIQDYCPY---IFNYKMTINSENS 115

Query: 116 IPTKAGLASSASGFAALTLALFRIYS-------IPEKSESLSRVARLGSGSACRSFYRGF 168
            P  +G+ASSASG +A+ + L  + +           ++  S +ARLGSGSA RS     
Sbjct: 116 FPHSSGIASSASGLSAIAMCLMSLENELVQDLSQDFINKKASFLARLGSGSASRSIEGPL 175

Query: 169 CEWICGTDQ-NGMDSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
             W          D + V F    +  + + +  +L +   EK++ S        H+ P+
Sbjct: 176 VVWGEHPAIVESSDLYGVQFPFKVDPIFQNYQDVILLVDKGEKQVSSTVG-HNLMHNHPY 234

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
            T   QQ + +L  I   + +    +   + E  AL +HA M+ +SP  +  +  T++ +
Sbjct: 235 ATNRFQQANDNLGKITTILQEGKIKEFIHLVESEALTLHAMMLTSSPYFILMKPNTLEII 294

Query: 284 ERVWDARQQSI-PIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
             +W+ R  +   I FTLDAG N+ +LF    ++ + QF  +      
Sbjct: 295 NSIWEYRNNTNSNICFTLDAGANVHVLFPENEKDEVLQFIDKELSKYC 342


>gi|154278631|ref|XP_001540129.1| hypothetical protein HCAG_05596 [Ajellomyces capsulatus NAm1]
 gi|150413714|gb|EDN09097.1| hypothetical protein HCAG_05596 [Ajellomyces capsulatus NAm1]
          Length = 371

 Score =  315 bits (807), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 103/332 (31%), Positives = 156/332 (46%), Gaps = 27/332 (8%)

Query: 37  YWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVID----SDADCIILNGQKISSQSS-- 88
           YWGKRD+ LNLP N+SLS++L    L   T  +          D + LN Q  + + S  
Sbjct: 7   YWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPTYPTDAGDSLTLNSQPQNIKDSKR 66

Query: 89  ----------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                       ++         + S     I + NN PT AGLASSA+GFAAL  A+  
Sbjct: 67  TLACLSDLRSLRRELENANPSLPKLSGFPLRIVSENNFPTAAGLASSAAGFAALVRAVAN 126

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRI 196
           +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G DSFA  V   + WP++R 
Sbjct: 127 LYELPQSPSDLSRIARQGSGSACRSMMGGYVAWRTGVLEDGSDSFAEEVAPASHWPEMRA 186

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAE 255
            +L + D +K + S + M+ T   S  F    +  +   +A I+ AI ++DF    E+  
Sbjct: 187 LILVVSDAKKDVPSTQGMQATVATSTLFRTRAETVVPARMAAIESAIKNRDFASFAEITM 246

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHK 313
           K++   HAT +   PP  Y    +   +  V D  +        +T DAGPN  + +  K
Sbjct: 247 KDSNNFHATNLDTWPPTFYLNDVSRAAIRLVHDINRAAGETICAYTFDAGPNAVIYYLDK 306

Query: 314 IEETIKQFFPEITIIDPLDSPDLWSTKDSLSQ 345
             E +   F  I   +     + W    ++++
Sbjct: 307 DSEHVIGTFKSILKAE----TEGWDDSRAVAE 334


>gi|116333505|ref|YP_795032.1| phosphomevalonate kinase [Lactobacillus brevis ATCC 367]
 gi|116098852|gb|ABJ64001.1| diphosphomevalonate decarboxylase [Lactobacillus brevis ATCC 367]
          Length = 324

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 121/325 (37%), Positives = 174/325 (53%), Gaps = 10/325 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
             +A   +NIAL KYWGK D  L LP  +SLSL+L    T T +        D + +N Q
Sbjct: 3   AVTARAHTNIALVKYWGKADPNLMLPQTSSLSLTLDQFYTDTTVEFDPRLTHDMVRINAQ 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +++ +S  +K   F ++ R+ S    +  + + N++PT AGLASSAS FAA+  A  R 
Sbjct: 63  LLAAPAS--QKVVDFLNIVREQSGQSAFAHVTSVNHVPTAAGLASSASAFAAMAGAASRA 120

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     +LSR+AR GSGSA RS Y GF EW  G+D +   +  +     WP + +  L
Sbjct: 121 AGLELTPRALSRLARRGSGSATRSIYGGFVEWQAGSDDHTSLAIPLQETVDWP-IAVVAL 179

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +    K+I SR+ M+ +   SP++  W   ++ DLA IK AI+ QDF  +GEV E NA+
Sbjct: 180 VLDPHHKRISSRQGMQSSVTTSPYYPAWKTVVAQDLATIKPAILHQDFSTMGEVLESNAM 239

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  ++A PP  Y+  +T++ M+ V   RQ     Y+TLDAGPNLK+        TI 
Sbjct: 240 RMHALTLSAQPPYSYFNGDTLRAMDTVRVLRQAGQECYYTLDAGPNLKVFCQTPDLPTIT 299

Query: 320 QFFPE----ITIIDPLDSPDLWSTK 340
           Q F E      +I     P L    
Sbjct: 300 QKFAEQFGAEHVIVAHPGPGLRFLS 324


>gi|300812419|ref|ZP_07092849.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496586|gb|EFK31678.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 319

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 171/318 (53%), Gaps = 12/318 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
             +A   +NIAL KYWGK+D+KL LPL +SLS++L    + T I   DS+     LNGQ 
Sbjct: 2   SKTARAHTNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKI--SDSEQMSFKLNGQA 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S       +   +    +    V     +E+ N +PT AGLASS+S FAA+  A    Y
Sbjct: 60  VSG--PAADRVFAYLRAMQDRFGVKGNLAVESVNQVPTAAGLASSSSAFAAMAAAFADHY 117

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +    + LSR+AR+GSGSA RS + GF  W  G       ++ +       DLR+  ++
Sbjct: 118 QLGVDRQELSRMARMGSGSASRSVFGGFSVWQKGDSDQTSYAYPL-DEEPDMDLRLLAVE 176

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I D+EKKI S + M+     SPF+  W  +  +++  +++AI   DF KLG +AE NA +
Sbjct: 177 INDQEKKISSTKGMK-MSKSSPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASE 235

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA    A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L   +  + I  
Sbjct: 236 MHALTFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVLCQEQNSKDIIN 295

Query: 321 FFPE----ITIIDPLDSP 334
            F      + II+    P
Sbjct: 296 CFESSFDRVKIIEAGFGP 313


>gi|322498235|emb|CBZ33309.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 383

 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 91/334 (27%), Positives = 149/334 (44%), Gaps = 27/334 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITV-IDSDADCII 77
           + +   P NIA  KYWGKR+   KL LP N+S S++L      + T + +  D+  D + 
Sbjct: 6   RVTVEAPINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRKDAAEDELW 65

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQ-----FSKVYFLIETSNNIPTKAGLASSASGFAAL 132
           LNG+K + Q +   +        R         +   I + NN PT AG+ASSASG+ AL
Sbjct: 66  LNGKKSNIQET--PRIQSVLSCIRDNCPGSMKDLKAYIVSDNNFPTAAGMASSASGYCAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
             AL + Y        +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  
Sbjct: 124 AAALVKAYRATVD---VSMLSRLGSGSACRSAYGGFVIWHKGEKPDGTDCIATQFVDEKY 180

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++++    +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF K
Sbjct: 181 WPEVQVMCAVLKGEKKDVPSTAGMQQSLKTSPMMQERIASIVPARMNAVKEAIRHRDFNK 240

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLK 307
              +A  ++  +        P + Y  +++   +  +      +    + +T DAG N  
Sbjct: 241 FAAIAMADSDDLQEICRTTEPRIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCF 300

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD 341
           +    +         PE+ ++     P  W    
Sbjct: 301 MFTLKQD-------LPEVVVMLRAHFPTSWDKMC 327


>gi|146083741|ref|XP_001464819.1| diphosphomevalonate decarboxylase [Leishmania infantum JPCM5]
 gi|134068914|emb|CAM67055.1| putative mevalonate-diphosphate decarboxylase [Leishmania infantum
           JPCM5]
          Length = 383

 Score =  313 bits (802), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 91/334 (27%), Positives = 149/334 (44%), Gaps = 27/334 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITV-IDSDADCII 77
           + +   P NIA  KYWGKR+   KL LP N+S S++L      + T + +  D+  D + 
Sbjct: 6   RVTVEAPINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRKDAAEDELW 65

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQ-----FSKVYFLIETSNNIPTKAGLASSASGFAAL 132
           LNG+K + Q +   +        R         +   I + NN PT AG+ASSASG+ AL
Sbjct: 66  LNGKKSNIQET--PRIQSVLSCIRDNCPGSMKDLKAYIVSDNNFPTAAGMASSASGYCAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
             AL + Y        +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  
Sbjct: 124 AAALVKAYRATVD---VSMLSRLGSGSACRSAYGGFVIWHKGEKPDGTDCIATQFVDEKY 180

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++++    +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF K
Sbjct: 181 WPEVQVMCAVLKGEKKDVPSTAGMQQSLKTSPMMQERIASIVPARMNAVKEAIRHRDFNK 240

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLK 307
              +A  ++  +        P + Y  +++   +  +      +    + +T DAG N  
Sbjct: 241 FAAIAMADSDDLQEICRTTEPRIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCF 300

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKD 341
           +    +         PE+ ++     P  W    
Sbjct: 301 MFTLKQD-------LPEVVVMLRAHFPTSWDKMC 327


>gi|254566013|ref|XP_002490117.1| Mevalonate pyrophosphate decarboxylase [Pichia pastoris GS115]
 gi|238029913|emb|CAY67836.1| Mevalonate pyrophosphate decarboxylase [Pichia pastoris GS115]
          Length = 382

 Score =  312 bits (801), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 99/328 (30%), Positives = 161/328 (49%), Gaps = 24/328 (7%)

Query: 30  SNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNGQKISSQ 86
           +N  + KYWGKRD+ LNLP N+S+S++L    L T+T +    + + D + LNG   S +
Sbjct: 12  TNFQVLKYWGKRDTNLNLPTNSSISVTLSQKDLRTLTTVNSSRNFEKDSLYLNGVSHSIE 71

Query: 87  SSFFKKTTQFCDLFRQ-----------FSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           +       +     RQ            S+    I + NN PT AGLASSA+GFAA+  A
Sbjct: 72  NDRTTNCLEQLRSLRQQLEEDDPNLPKLSQWKLHIISENNFPTAAGLASSAAGFAAMVAA 131

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPD 193
           + ++Y +P+ +  LSR+AR GSGSACRS + G+  W  G   +G DS AV       WP+
Sbjct: 132 ISKLYELPQDASELSRIARKGSGSACRSMFGGYVAWEMGEKLDGTDSKAVQIAPPEHWPN 191

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGE 252
           ++  +  + D +K + S   M+ T   S  F     Q +    + +  AI ++DF   G 
Sbjct: 192 MKAAICIVSDLKKDVSSTSGMQTTVQTSELFQYRVNQVVPPRYSQMVDAIKNRDFETFGT 251

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLF 310
           +  K++   HAT + + PP+ Y    + + ++ +         +   +T DAGPN  + +
Sbjct: 252 LTMKDSNSFHATCLDSYPPIFYLTDTSKKIIKLIHTLNDAIGKVVAAYTFDAGPNAVIYY 311

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWS 338
             + EE +      +       + D W+
Sbjct: 312 ESENEEVVLGVLFGVL-----SNVDGWN 334


>gi|15899699|ref|NP_344304.1| diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus P2]
 gi|284175801|ref|ZP_06389770.1| diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus 98/2]
 gi|13816375|gb|AAK43094.1| Diphosphomevalonate decarboxylase, putative [Sulfolobus
           solfataricus P2]
 gi|261601434|gb|ACX91037.1| diphosphomevalonate decarboxylase [Sulfolobus solfataricus 98/2]
          Length = 325

 Score =  312 bits (800), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 104/312 (33%), Positives = 166/312 (53%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLND--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + +S      +   +  D F++    + +  +E+ +  P  AGLASSA+G AAL  +L 
Sbjct: 61  DRILSEDE-MKEYAGRVLDTFKKIVGKEFHVKVESKSKFPINAGLASSAAGIAALAFSLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  KSE LS++ARLGSGSACRS + GF  W  G  ++G DS+      ++ W +L 
Sbjct: 120 ELLELNLKSEELSKIARLGSGSACRSMFGGFVVWNKGEREDGEDSYCYQIFRHDYWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + I      + +AI ++D  K   +  
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKYIEKTFNEVIEAIRNRDEKKFYYLMM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + D  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAVILDSWPSFFYLNDTSIRIMEWIHDYGKAG----YTFDAGPNPHIFTTERNI 295

Query: 316 ETIKQFFPEITI 327
             I +F   + I
Sbjct: 296 GDILEFLKSLEI 307


>gi|227878668|ref|ZP_03996583.1| possible diphosphomevalonate decarboxylase [Lactobacillus crispatus
           JV-V01]
 gi|256850379|ref|ZP_05555807.1| mevalonate diphosphate decarboxylase [Lactobacillus crispatus
           MV-1A-US]
 gi|262046473|ref|ZP_06019435.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           MV-3A-US]
 gi|293380928|ref|ZP_06626962.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus 214-1]
 gi|312978155|ref|ZP_07789899.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus CTV-05]
 gi|227861732|gb|EEJ69336.1| possible diphosphomevalonate decarboxylase [Lactobacillus crispatus
           JV-V01]
 gi|256712776|gb|EEU27769.1| mevalonate diphosphate decarboxylase [Lactobacillus crispatus
           MV-1A-US]
 gi|260573344|gb|EEX29902.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           MV-3A-US]
 gi|290922503|gb|EFD99471.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus 214-1]
 gi|310894873|gb|EFQ43943.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus CTV-05]
          Length = 320

 Score =  312 bits (800), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 113/318 (35%), Positives = 176/318 (55%), Gaps = 11/318 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK D KL LPL +SLS++L    T T +   D + +   LN Q+ +
Sbjct: 4   TARAHTNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGE-NQFFLNNQQQT 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           + +S  ++   +    +    V    ++++ N++PT AGLASS+S FAAL  A  + Y I
Sbjct: 63  AAAS--QRVFAYLKKLQARFHVTGNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQCYDI 120

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E LSR+AR+GSGSA RS Y GF  W  G       ++A+       DL +  +++ 
Sbjct: 121 NIDLEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYALDETPT-MDLHLLAVELN 179

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            ++KKI S   M+     SPFF  W ++ +++L  + +AI   DF  LG++AE NA +MH
Sbjct: 180 TKQKKISSTYGMKD-AQSSPFFRPWLERNNSELNEMIKAIKSNDFTALGQLAELNANEMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A  + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 239 AINLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298

Query: 323 P----EITIIDPLDSPDL 336
                 + I++    P +
Sbjct: 299 SSEFNNVNIVNASFGPGI 316


>gi|295693038|ref|YP_003601648.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus ST1]
 gi|295031144|emb|CBL50623.1| Diphosphomevalonate decarboxylase [Lactobacillus crispatus ST1]
          Length = 320

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 113/318 (35%), Positives = 175/318 (55%), Gaps = 11/318 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK D KL LPL +SLS++L    T T +   D + +   LN Q+ +
Sbjct: 4   TARAHTNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGE-NQFFLNNQQQT 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           + +S  ++   +    +    V    ++++ N++PT AGLASS+S FAAL  A  + Y I
Sbjct: 63  AAAS--QRVFAYLKKLQARFHVTGNLIVKSVNHVPTSAGLASSSSAFAALAAAFCQCYDI 120

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E LSR+AR+GSGSA RS Y GF  W  G       ++A+       DL +  +++ 
Sbjct: 121 NIDLEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYALDETPT-MDLHLLAVELN 179

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            ++KKI S   M+     SPFF  W ++  ++L  + +AI   DF  LG++AE NA +MH
Sbjct: 180 TKQKKISSTYGMKD-AQSSPFFRPWLERNDSELNEMIKAIKSNDFTALGQLAELNANEMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A  + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 239 AINLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298

Query: 323 P----EITIIDPLDSPDL 336
                 + I++    P +
Sbjct: 299 SSEFNNVNIVNASFGPGI 316


>gi|256843264|ref|ZP_05548752.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           125-2-CHN]
 gi|256614684|gb|EEU19885.1| diphosphomevalonate decarboxylase [Lactobacillus crispatus
           125-2-CHN]
          Length = 320

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 177/318 (55%), Gaps = 11/318 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK D KL LPL +SLS++L    T T +   D + +   LN Q+ +
Sbjct: 4   TARAHTNIALIKYWGKADDKLRLPLMSSLSMTLDAFYTDTSVEKTDGE-NQFFLNNQQQT 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           + +S  ++   +    +    V    ++++ N++PT AGLASS+S FAALT A  + Y I
Sbjct: 63  AAAS--QRVFAYLKKLQARFHVTGNLIVKSVNHVPTSAGLASSSSAFAALTAAFCQCYDI 120

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E LSR+AR+GSGSA RS Y GF  W  G       ++A+       DL +  +++ 
Sbjct: 121 NIDLEDLSRLARIGSGSASRSVYGGFAVWQKGNSDETSYAYALDETPT-MDLHLLAVELN 179

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            ++KKI S   M+     SPFF  W ++ +++L  + +AI   DF  LG++AE NA +MH
Sbjct: 180 TKQKKISSTYGMKD-AQSSPFFRPWLERNNSELNEMIKAIKSNDFTALGQLAELNANEMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A  + A P   Y++ +TIQ ++ V   R + I  Y+T+DAGPN+K+L   +  + I Q F
Sbjct: 239 AINLTAQPEFTYFEPQTIQAIKLVEQLRTEGIECYYTIDAGPNIKVLCQLRNSKDIIQRF 298

Query: 323 P----EITIIDPLDSPDL 336
                 + I++    P +
Sbjct: 299 SSEFNNVNIVNASFGPGI 316


>gi|290973123|ref|XP_002669299.1| mevalonate decarboxylase [Naegleria gruberi]
 gi|284082844|gb|EFC36555.1| mevalonate decarboxylase [Naegleria gruberi]
          Length = 391

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 159/344 (46%), Gaps = 29/344 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILN 79
           K +   P NIA+ KYWGK +   ++PLN+SLS +L    L T T +    +   D +ILN
Sbjct: 7   KFTCTSPVNIAVIKYWGKENEAEHIPLNSSLSATLNQDDLKTTTTVQASTEFPCDELILN 66

Query: 80  GQKISSQ-SSFFKKTTQFC----------DLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
           G+K   Q S   ++  Q            +   +  ++Y  I+++NN PT AGLASSASG
Sbjct: 67  GKKEDVQGSKRIQRVFQEIRKAATAKWYTERPNKDQEIYVHIDSTNNFPTAAGLASSASG 126

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
           +  L  AL +++ +      LS +ARLGSGSACRS Y G+  W  G D     +  V   
Sbjct: 127 YCCLVFALGQLFEVK---SDLSIIARLGSGSACRSLYGGYVAWEKGHDHETSKAIQVLDE 183

Query: 189 NQWPDLR--IGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQ 245
           +     +  I +  + DR+K   S   M+ +   S        + +   +  + +A+  +
Sbjct: 184 HDDFSKQTNIVVCVVSDRQKHTPSTSGMQQSVITSKLLKVRASEIVPQRMIEMDKALKTK 243

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ-------QSIPIYF 298
           DF     +   ++  MHA      P + Y  + + Q ++ V D          +++ + +
Sbjct: 244 DFNLFATLTMDDSDNMHACCADTEPAIYYMNETSNQIVQLVKDFNAFDDGNGVENLKVAY 303

Query: 299 TLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDS 342
           T DAGPN  L F    +E   +F   +    P  + + + +K+ 
Sbjct: 304 TFDAGPNAVLFFP--NKEVTNKFLAILHAFFPPSNQEQFFSKEP 345


>gi|242023989|ref|XP_002432413.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus
           corporis]
 gi|212517836|gb|EEB19675.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus
           corporis]
          Length = 401

 Score =  312 bits (799), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 97/354 (27%), Positives = 160/354 (45%), Gaps = 30/354 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLS--LGHLGTITHITVID-SDADCIILNG 80
            +   P NIA  KYWGKRD  L LPLN+S+S++     +   T I        D I LNG
Sbjct: 4   VTCKAPVNIAAIKYWGKRDETLILPLNDSISVTINTNFMRAKTTIAASPHFKNDRIWLNG 63

Query: 81  QKISSQSSFFKKTTQFCDLFR---------------QFSKVYFLIETSNNIPTKAGLASS 125
           ++    +             +               + +     I + NN PT AGLASS
Sbjct: 64  REEDFTNPRLMACVNESKYRQHSNIKSMQGNAIIIEKAANWKIHIASENNFPTAAGLASS 123

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G+A L  AL R+  I      LS +AR GSGSACRS + GF  W  G +++G DS A 
Sbjct: 124 AAGYACLVYALSRLMGID---GDLSSIARKGSGSACRSMHGGFVMWKMGKEKDGSDSVAE 180

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                  W ++R+ +L +   +K IGS   ME +   S F   +  Q+   ++ +++AI+
Sbjct: 181 QIAPSSHWKEMRMLILIVNGCKKTIGSSAGMERSVKTSDFLKNF--QLDQRVSALRKAIL 238

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLD 301
           ++DF+   E+  K++ ++H+  +   PP+ Y    +   ++ V           + ++ D
Sbjct: 239 NKDFVTFAEITMKDSNRLHSICLDTYPPIQYLNDTSHYIIQLVHFLNDHFGKPKVAYSYD 298

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIELGISK 355
           AGPN  L    +    +      +    P    +  + + S  +   +E G+ +
Sbjct: 299 AGPNACLFLLEENVSLV---LSLVNHYLPPLLAETNTVESSYFKGYKVEGGLER 349


>gi|294790206|ref|ZP_06755364.1| diphosphomevalonate decarboxylase [Scardovia inopinata F0304]
 gi|294458103|gb|EFG26456.1| diphosphomevalonate decarboxylase [Scardovia inopinata F0304]
          Length = 347

 Score =  311 bits (798), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 121/344 (35%), Positives = 179/344 (52%), Gaps = 23/344 (6%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQ 81
           + ++A   +NIAL KYWGKRD KL LP + SLSL+L    T TH++    + D +ILNGQ
Sbjct: 3   QAAAARAHTNIALIKYWGKRDDKLILPTSTSLSLTLDSFYTDTHVSPARGEDDQLILNGQ 62

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVY-------------FLIETSNNIPTKAGLASSASG 128
               Q +   +   F +LFR  ++                 +++ N++PT AGLASS+S 
Sbjct: 63  VGGLQET--SRVHDFINLFRDEARKKDYSGQETALCAAPIRVDSFNHVPTAAGLASSSSA 120

Query: 129 FAALTLALFRIYSIPEKSES--LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP 186
           FAAL  AL   + + +  +   LS  AR GSGSA RS + G  EW+ G+  +  DS+A  
Sbjct: 121 FAALAWALRDYFGLADSMDDRILSTFARQGSGSATRSIFGGLVEWLYGS--DSSDSYAYQ 178

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQD 246
            ++   DL + ++ +    KKI SR+ M+ T   S F+  W Q    DLA  +  I + D
Sbjct: 179 IDDGNWDLGMIVVALSTEHKKISSRKGMKHTVDTSAFYPLWRQASEKDLAQAEAGIRNHD 238

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNL 306
             +LG   E N +K HATM AA PP+ Y    + + +E VWD R++ I  YFT+DAGPN+
Sbjct: 239 LDQLGRAMEANVMKFHATMFAADPPITYLTSRSWEVIEYVWDLRERGISCYFTMDAGPNV 298

Query: 307 KLLFTHKI----EETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
           K+L          E ++  FP+  +          + +     K
Sbjct: 299 KILCHKSQATTLAEDLRTAFPDALVWQAAAGSGPSNIEKGEWDK 342


>gi|58337453|ref|YP_194038.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           NCFM]
 gi|227904089|ref|ZP_04021894.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           ATCC 4796]
 gi|58254770|gb|AAV43007.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           NCFM]
 gi|227868108|gb|EEJ75529.1| mevalonate diphosphate decarboxylase [Lactobacillus acidophilus
           ATCC 4796]
          Length = 320

 Score =  311 bits (798), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 178/318 (55%), Gaps = 11/318 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK D  L LPL +SLS++L    T T I   D+  +   LNG++
Sbjct: 2   KNTARAHTNIALIKYWGKSDPILRLPLMSSLSMTLDAFYTDTLIEKTDA-KNEFYLNGKR 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            + Q+   K+   + D  ++        +++++N++PT AGLASS+S FAAL  +  ++Y
Sbjct: 61  QNRQAK--KRVFSYLDTLKEKFGYTDNLIVKSTNHVPTSAGLASSSSAFAALAASFCKLY 118

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
           ++      LSR+ARLGSGSA RS + GF  W  G       ++A+    +  DL++  ++
Sbjct: 119 NLDVDKTELSRLARLGSGSASRSIFGGFAIWQKGNSNQSSYAYALDEKPK-MDLQLLAVE 177

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +   +KKI S + M+     SPFF+ WT +   +L  + +AI   DF  LG +AE NA +
Sbjct: 178 LNTEQKKISSTKGMKD-AQSSPFFSTWTNRNQLELDEMIKAIKQNDFTALGSLAELNANE 236

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA  + A P   Y+  ETI+ ++ V D R + I  Y+T+DAGPN+K+L   K  + I +
Sbjct: 237 MHAINLTAQPEFTYFMPETIRAIKLVEDLRTKGIECYYTIDAGPNIKVLCQLKNRKEIIE 296

Query: 321 FFP----EITIIDPLDSP 334
            F      + I+     P
Sbjct: 297 HFESVFNNVNIVSASFGP 314


>gi|149642204|ref|XP_001509372.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 412

 Score =  311 bits (798), Expect = 9e-83,   Method: Composition-based stats.
 Identities = 97/320 (30%), Positives = 146/320 (45%), Gaps = 28/320 (8%)

Query: 37  YWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISSQSSFFKKT 93
           YWGKRD +L LP+N+SLS++L    L T T   +  D   D I LN ++        +  
Sbjct: 35  YWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFKEDRIWLNSKEEDVGHPRLQTC 94

Query: 94  TQFCDLFRQFSK-------------VYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            +      +  +                 I + NN PT AGLASSA+G+A L   L R+Y
Sbjct: 95  LREIRRLARKRRSGRDGDSASLSLSYKVHIASVNNFPTAAGLASSAAGYACLVYTLARLY 154

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPDLRIGL 198
            +      LS VAR GSGSACRS Y GF EW+ G   +G DS A        WP+LR+ +
Sbjct: 155 GVE---GELSEVARQGSGSACRSMYGGFVEWLMGERPDGKDSIAQQLVPETHWPELRVLI 211

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           L +   +K +GS   M+ +   SP      +  +   +A +++ I ++DF   G +  K+
Sbjct: 212 LVVSAEKKSVGSTAGMQTSVETSPLLKFRAESVVPGRMAEMRRCIQEKDFQGFGLLTMKD 271

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFT---- 311
           + + HAT +   PP+ Y    +   +  V           + +T DAGPN  +       
Sbjct: 272 SNQFHATCLDTFPPICYLNDTSRHIISLVHRFNAHFGKTRVAYTFDAGPNAVIFTLDNTV 331

Query: 312 HKIEETIKQFFPEITIIDPL 331
                 +K  FP ++  D  
Sbjct: 332 DDFVAVVKHSFPPVSNGDQF 351


>gi|322490250|emb|CBZ25510.1| putative diphosphomevalonate decarboxylase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 383

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 87/332 (26%), Positives = 143/332 (43%), Gaps = 27/332 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVID-SDADCII 77
           + +   P NIA  KYWGKR+   KL LP N+S S++L      + T + +   +  D + 
Sbjct: 6   RVTVEAPINIAFIKYWGKREGGEKLILPTNDSFSITLSTKPFRSKTSVELRSVAAEDELW 65

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQF-----SKVYFLIETSNNIPTKAGLASSASGFAAL 132
           LNG K + Q +   +        R         +   I + NN PT AG+ASSASG+ AL
Sbjct: 66  LNGAKSNIQET--PRIQSVLSCIRDNCPSDVKNLKAYIVSENNFPTAAGMASSASGYCAL 123

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ-- 190
             AL + Y        +S ++RLGSGSACRS Y GF  W  G   +G D  A  F ++  
Sbjct: 124 AAALVKAYRATVD---VSMLSRLGSGSACRSTYGGFVIWNKGEKPDGTDCIATQFVDENY 180

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIK 249
           WP++++    +   +K + S   M+ +   SP   +    I    +  +K+AI  +DF +
Sbjct: 181 WPEMQVMCAVLKGDKKDVSSTAGMQQSLKTSPMMQERIASIVPARMKAVKEAIQQRDFNR 240

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLK 307
             E+   ++  +        P + Y  +++   +  +      +    + +T DAG N  
Sbjct: 241 FAEITMADSDDLQEICRTTEPCIQYATEDSYAMIRLIRAFNAKKGYNAMAYTFDAGANCF 300

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDSPDLWST 339
           +    +    +               P  W  
Sbjct: 301 MFTLKQDLPEVVGTLRA-------HFPTSWEK 325


>gi|325686246|gb|EGD28289.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 319

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 170/318 (53%), Gaps = 12/318 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
             +A   +NIAL KYWGK+D+KL LPL +SLS++L    + T I   DS+     LNGQ 
Sbjct: 2   SKTARAHTNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKI--SDSEQMSFKLNGQA 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S       +   +    +    V     +E+ N +PT AGLASS+S FA++  A    Y
Sbjct: 60  VSG--PAADRVFAYLRAMQDRFGVKGNLAVESVNQVPTAAGLASSSSAFASMAAAFADHY 117

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +      LSR+AR+GSGSA RS + GF  W  G       ++ +       DLR+  ++
Sbjct: 118 QLGVDRRELSRMARMGSGSASRSIFGGFSVWQKGDSDQTSYAYPL-DEEPDMDLRLLAVE 176

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I D+EKKI S + ME     SPF+  W  +  +++  +++AI   DF KLG +AE NA +
Sbjct: 177 INDQEKKISSTKGME-MSKSSPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASE 235

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA    A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L   +  + I  
Sbjct: 236 MHALTFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVLCQGRNSKDIIN 295

Query: 321 FFPE----ITIIDPLDSP 334
            F      + II+    P
Sbjct: 296 CFESSFYRVKIIEAGFGP 313


>gi|313123654|ref|YP_004033913.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280217|gb|ADQ60936.1| Diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 319

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 170/318 (53%), Gaps = 12/318 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
             +A   +NIAL KYWGK+D+KL LPL +SLS++L    + T I   DS+     LNGQ 
Sbjct: 2   SKTARAHTNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKI--SDSEQMSFKLNGQA 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S       +   +    +    V     +E+ N +PT AGLASS+S FA++  A    Y
Sbjct: 60  VSG--PAADRVFAYLRAMQDRFGVKGNLAVESVNQVPTAAGLASSSSAFASMAAAFADHY 117

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +      LSR+AR+GSGSA RS + GF  W  G       ++ +       DLR+  ++
Sbjct: 118 QLGVDRRELSRMARMGSGSASRSIFGGFSVWQKGDSDQTSYAYPLN-EEPDMDLRLLAVE 176

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I D+EKKI S + ME     SPF+  W  +  +++  +++AI   DF KLG +AE NA +
Sbjct: 177 INDQEKKISSTKGME-MSKSSPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASE 235

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA    A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L   +  + I  
Sbjct: 236 MHALTFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVLCQGRNSKDIIN 295

Query: 321 FFPE----ITIIDPLDSP 334
            F      + II+    P
Sbjct: 296 CFESSFYRVKIIEAGFGP 313


>gi|256819342|ref|YP_003140621.1| GHMP kinase [Capnocytophaga ochracea DSM 7271]
 gi|256580925|gb|ACU92060.1| GHMP kinase [Capnocytophaga ochracea DSM 7271]
          Length = 342

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 94/333 (28%), Positives = 146/333 (43%), Gaps = 33/333 (9%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----------D 74
           S   PSNIAL KYWGK+  +  LP N S+S +L H  T T I                  
Sbjct: 3   SFKAPSNIALVKYWGKKGEQ--LPANPSISFTLTHCYTETSIEYERRSESSIASGEPFSF 60

Query: 75  CIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
                GQ   S       FF++   +          +F I + N+ P  +G+ASSAS  A
Sbjct: 61  DFSFEGQPKPSFHPKIHTFFERIVAYLPF---LKDYHFSIASHNSFPHSSGIASSASAMA 117

Query: 131 ALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWIC-----GTDQN 178
           AL++ L +I       Y+     +  S +ARLGSGSACRS       W       G+   
Sbjct: 118 ALSVCLMQISKELGETYAEEAFWQKASFLARLGSGSACRSVRGSIVVWGEHPAIIGSSDE 177

Query: 179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
               + +P +  + + +  +L I   +K++ S        H  PF      Q + ++  +
Sbjct: 178 YSIPYPLPVHEVFQNYQDTILLIDRGQKQVSSTVG-HNLMHGHPFAEARFAQANENINKL 236

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
            ++    D  +  EV E  AL +HA M  + P  +  +  T++ ++R+W  R+++ IP+ 
Sbjct: 237 VRSFASGDVERFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRIWQYRKETNIPLC 296

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
           FTLDAG N+ LL+       +K F  E      
Sbjct: 297 FTLDAGANVHLLYPKTSTTEVKWFIEEELAQFC 329


>gi|149370070|ref|ZP_01889921.1| hypothetical protein SCB49_03314 [unidentified eubacterium SCB49]
 gi|149356561|gb|EDM45117.1| hypothetical protein SCB49_03314 [unidentified eubacterium SCB49]
          Length = 366

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 85/359 (23%), Positives = 153/359 (42%), Gaps = 37/359 (10%)

Query: 7   HILHRYIGEC--NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
                ++ +   N   N   +   PSNIAL KYWGK   +  +P N S+S +L +  T T
Sbjct: 1   MTTSDFLPKPYVNLPENGSITCQSPSNIALVKYWGKYGEQ--MPQNASVSFTLSNCRTET 58

Query: 65  HITVIDSDA-----DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNN 115
            +T    +        + L+G +          FF +  Q+    R +S   F I+T N 
Sbjct: 59  TLTYTKKENNGSYAFEVYLDGNREVGFEPKIKKFFDRIVQYVPFIRAYS---FKIDTKNT 115

Query: 116 IPTKAGLASSASGFAALTLALFRIYSI--------------PEKSESLSRVARLGSGSAC 161
            P  +G+ASSASG +AL + L  I S                  ++  S +ARLGSGSA 
Sbjct: 116 FPHSSGIASSASGMSALAVCLVAIESQLLGATNLSTAEETKNSTTQKASFLARLGSGSAA 175

Query: 162 RSFYRGFCEWICGTDQNGMDS-----FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEI 216
           RS       W    +  G  +     +    +  + + +  +L +   EK++ S      
Sbjct: 176 RSLEGPLVVWGEHPNIKGSSNLFGVKYEGEVHENFRNYQDTILLVDKGEKQVSSTVG-HD 234

Query: 217 TRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQ 276
             + +P+     ++ + +L  +     + +     ++ E  AL++H  M+A+ P  +  +
Sbjct: 235 LMNDNPYAEARFKEANDNLLKLTTVFKNGNVDTFIKLVESEALQLHGMMMASKPYFILMK 294

Query: 277 KETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
             T++ + R+W  R ++   + FTLDAG N+ +L+    +  I++F          +  
Sbjct: 295 PNTLEIINRIWAYRNETESKVCFTLDAGANVHVLYPENEKTVIQEFIKNELSSYCKNGE 353


>gi|284998885|ref|YP_003420653.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.D.8.5]
 gi|284446781|gb|ADB88283.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.D.8.5]
          Length = 325

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 99/312 (31%), Positives = 163/312 (52%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + +       +   +  + F++    + +  +E+    P  AGLASSA+G AALT  + 
Sbjct: 61  DRILPEDE-MKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGVN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + I +F   + I
Sbjct: 296 QDILEFLKSLEI 307


>gi|295424860|ref|ZP_06817575.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065426|gb|EFG56319.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
          Length = 320

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 113/319 (35%), Positives = 174/319 (54%), Gaps = 13/319 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K +A   +NIAL KYWGK++++L LPL +SLS++L    + T +       +   LN QK
Sbjct: 2   KKTARAHTNIALIKYWGKKNAELRLPLMSSLSMTLDAFYSETSLET--GQQNEFYLNNQK 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY---FLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            S QS+  ++  Q+    +    +      + + N++PT AGLASS+S FAAL  +    
Sbjct: 60  QSDQSA--QRVFQYLHKLQDSFGLPYDALKVSSINHVPTAAGLASSSSAFAALAASFCAY 117

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           Y +    + LSR+AR+GSGSA RS Y GF  W  G D     ++ +       DL +  +
Sbjct: 118 YDLDVDRKMLSRLARIGSGSASRSIYGGFAIWQKGHDDKSSYAYPL-DEKPAMDLHLLAV 176

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           ++  + KK+ S + M+    +SPFF  W  +   +L  +  AI + DF KLG +AE NA 
Sbjct: 177 ELDQKPKKLSSTKGMQ-AAQNSPFFQPWLARNDAELNDMIAAIKNNDFTKLGSLAELNAN 235

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  + A P   Y++  TI+ ++ V + RQQ I  Y+T+DAGPN+K+L   K  + IK
Sbjct: 236 EMHAINLTAQPEFTYFEPNTIKAIKLVEELRQQGIECYYTIDAGPNVKILTPLKNIKEIK 295

Query: 320 QF----FPEITIIDPLDSP 334
           +     F  + II+    P
Sbjct: 296 KLFLSEFSNVKIINASFGP 314


>gi|156545060|ref|XP_001600914.1| PREDICTED: similar to diphosphomevalonate decarboxylase [Nasonia
           vitripennis]
          Length = 379

 Score =  310 bits (795), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 108/312 (34%), Positives = 156/312 (50%), Gaps = 15/312 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILN 79
             +   P NIA+ KYWGKRD  L LP+N+SLS +L   HL   T +        + I LN
Sbjct: 4   TVTCVAPVNIAVIKYWGKRDEDLILPINDSLSATLDTEHLCAKTTVRASPEFKENKIWLN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSK----VYFLIETSNNIPTKAGLASSASGFAALTLA 135
           G++ S  +   +   +      Q SK        I + NN PT AGLASSA+G+A L  A
Sbjct: 64  GREESMDNPRLQNCLKEIKKRSQLSKDMESWKIHICSENNFPTAAGLASSAAGYACLAAA 123

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L ++Y +      +S +AR GSGSACRS Y GF  W  G+D  G+DS A P      WPD
Sbjct: 124 LAKLYRVE---GDISGIARAGSGSACRSVYGGFVRWYKGSDPTGIDSIAKPIAPASHWPD 180

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGE 252
           +RI +L + D +KK+ S   M+ T   S F T   ++ I   +  I++AI+ +DF    E
Sbjct: 181 MRILVLVVNDSKKKVSSAIGMKRTLLTSEFLTYKAEKIIPQRIEQIQEAILKRDFETFAE 240

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLF 310
              +++ +MHA  +AA PP +Y    +   +E +           + ++ DAGPN  L  
Sbjct: 241 HTMRDSNEMHAACLAAYPPCIYMNDTSHLIVELMHQYNSTSDRTKVAYSFDAGPNATLFL 300

Query: 311 THKIEETIKQFF 322
             K    +    
Sbjct: 301 LEKDVAELLGIL 312


>gi|104773998|ref|YP_618978.1| mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116514014|ref|YP_812920.1| mevalonate pyrophosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|103423079|emb|CAI97800.1| Mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116093329|gb|ABJ58482.1| diphosphomevalonate decarboxylase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125703|gb|ADY85033.1| Mevalonate diphosphate decarboxylase [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 319

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 116/318 (36%), Positives = 170/318 (53%), Gaps = 12/318 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
             +A   +NIAL KYWGK+D+KL LPL +SLS++L    + T I   DS+     LNGQ 
Sbjct: 2   SKTARAHTNIALIKYWGKKDAKLRLPLMSSLSMTLDAFYSDTKI--SDSEQMSFKLNGQA 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S       +   +    +    V     +E+ N +PT AGLASS+S FAA+  A    Y
Sbjct: 60  VSG--PAADRVFAYLRAMQDRFGVKGNLAVESVNQVPTAAGLASSSSAFAAMAAAFADHY 117

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +    + LSR+AR+GSGSA RS + GF  W  G       ++ +       DLR+  ++
Sbjct: 118 QLGVDRQELSRMARMGSGSASRSVFGGFSVWQKGDSDQTSYAYPL-DEEPDMDLRLLAVE 176

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           I D+EKKI S + ME     SPF+  W  +  +++  +++AI   DF KLG +AE NA +
Sbjct: 177 INDQEKKISSTKGME-MSKSSPFYQVWLDRNDSEIKEMEEAIKQADFSKLGSLAELNASE 235

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A P   Y++  TI+ ++ V D RQQ +  Y+T+DAGPN+K+L   K  + I  
Sbjct: 236 MHTLTFTAVPGFTYFEPNTIKAIKLVQDLRQQGLECYYTIDAGPNVKVLCQGKNSKDIIN 295

Query: 321 FFPE----ITIIDPLDSP 334
            F      + II+    P
Sbjct: 296 CFESSFDRVKIIEAGFGP 313


>gi|326334928|ref|ZP_08201129.1| mevalonate diphosphate decarboxylase [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325692965|gb|EGD34903.1| mevalonate diphosphate decarboxylase [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 354

 Score =  309 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 95/352 (26%), Positives = 151/352 (42%), Gaps = 30/352 (8%)

Query: 7   HILHRYIGE--CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            ++ R+I +         +     PSNIAL KYWGK+  +  LP+N S+S +L H  T T
Sbjct: 1   MLVDRFIPKPYTQKVDVAQVRHRAPSNIALVKYWGKK--EGQLPMNPSISFTLTHSYTET 58

Query: 65  HITVIDSDADC------IILNGQKISSQSSFFKKTTQFC----DLFRQFSKVYFLIETSN 114
            I +                +    + + +F  K   F     +        YF++ T N
Sbjct: 59  VIEIAPRTDFTTSFQIDFYFD---ETPKDNFLPKIETFFTRIRNYLPFLRDYYFIVRTHN 115

Query: 115 NIPTKAGLASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRG 167
           + P  +G+ASSASG AAL + L +I        S     E  S +ARLGSGSACRS    
Sbjct: 116 SFPHSSGIASSASGMAALAMCLMKIERLFSPEMSELYFYEKASFLARLGSGSACRSITGS 175

Query: 168 FCEWICGTD-QNGMDSFAVPF---NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
              W       +  D + VP    +  +   +  +L I   +K + S           P+
Sbjct: 176 VVIWGEHPAVADSSDFYGVPIGDVHEVFDTYQDAILLIDKGQKPVSSSMG-HRLMQGHPY 234

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
                 Q    +A +K  + + D +    + E  AL +HA M+ + P  L  +  T+  +
Sbjct: 235 AEARFVQARQHIAQLKDILREGDLLAFTSLVESEALSLHAMMMTSDPYYLLMRPNTLAAI 294

Query: 284 ERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
           E++W  R  + +P+ FTLDAG N+ LL+ H   + ++ F  +       D  
Sbjct: 295 EQIWYYRMSTQVPVCFTLDAGANIHLLYPHSYHKEVENFIEQTLRKYCQDGE 346


>gi|295136033|ref|YP_003586709.1| diphosphomevalonate decarboxylase [Zunongwangia profunda SM-A87]
 gi|294984048|gb|ADF54513.1| diphosphomevalonate decarboxylase [Zunongwangia profunda SM-A87]
          Length = 363

 Score =  309 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 94/352 (26%), Positives = 158/352 (44%), Gaps = 34/352 (9%)

Query: 10  HRYIGECNPKINEKSS--AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH-- 65
             ++        E  S     PSNIAL KYWGK+  +  +P N S+S +L +  T T   
Sbjct: 4   KEFVSAPLKNAVESGSVCWEAPSNIALVKYWGKK--ENQIPANPSISFTLKNCKTTTRLN 61

Query: 66  -ITVIDSD------ADCIILNG-QKISSQS---SFFKKTTQFCDLFRQFSKVYFLIETSN 114
            + V D+          +I  G +K S +    SFFK+   +C    +F    F + + N
Sbjct: 62  YVKVSDNSTTSRGIEFDVIFEGVKKESFKPKIVSFFKRILPYCSYLEEF---KFEVVSDN 118

Query: 115 NIPTKAGLASSASGFAALTLALFRIYS-------IPEKSESLSRVARLGSGSACRSFYRG 167
           + P  +G+ASSASG +AL L +  +              +  S +ARLGSGSACRS    
Sbjct: 119 SFPHSSGIASSASGMSALALCVMSLEKSLFPETEDDFFYKKASFLARLGSGSACRSVRGD 178

Query: 168 FCEWICG-----TDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSP 222
              W        +       +     + + D +  +L +   +K++ S        H   
Sbjct: 179 LVVWGQHQEIPLSSDTYGVQYPFKIADVFKDYQDTILLVDKGKKQVSSTVG-HDLMHGHA 237

Query: 223 FFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           F     QQ    L+ +  A    D  +  ++ E+ AL +HA M+++ P  L  +  T+  
Sbjct: 238 FAAARFQQAHDHLSALIPAFEKGDVKQFIKIVEREALTLHAMMMSSDPYFLLMKPNTLAI 297

Query: 283 MERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           + ++W+ R++S IP+ FTLDAG N+ +L+  + +E I +F     ++   + 
Sbjct: 298 INKIWEKREESKIPVCFTLDAGANVHMLYPSQFKEEILEFVKNELVVYCENG 349


>gi|227529133|ref|ZP_03959182.1| diphosphomevalonate decarboxylase [Lactobacillus vaginalis ATCC
           49540]
 gi|227350977|gb|EEJ41268.1| diphosphomevalonate decarboxylase [Lactobacillus vaginalis ATCC
           49540]
          Length = 323

 Score =  309 bits (793), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 113/321 (35%), Positives = 179/321 (55%), Gaps = 12/321 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A   +NIAL KYWGK+D KL +P  +SLSL+L      T +   D   AD I ++GQ +
Sbjct: 3   TARAHTNIALVKYWGKKDQKLIIPQTDSLSLTLNEFYADTGVEFRDDLTADDIEIDGQPV 62

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +  S+  +K   F D  RQ S  +    + ++N++P  AGLASSAS FAAL  A  +   
Sbjct: 63  TGHSA--EKVKDFLDHIRQISGNHNYAKVISTNHVPVSAGLASSASAFAALATAASKAAG 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +     SLSR+AR GSGSA RS Y G  EW  GTD     +  +     +  + +  + I
Sbjct: 121 LNLDRRSLSRLARRGSGSATRSIYGGLVEWHRGTDDQSSFAEPIMEKVDF-GIEMIAILI 179

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              +KKI SR+ M+ +   SP++  W + ++ D+  +K+AI ++D  ++G +AE+NAL+M
Sbjct: 180 NTTKKKISSRQGMQSSVESSPYYPTWRKVVAHDMVAMKEAISNKDIDQIGHIAEENALRM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA  ++A P   Y+  +TI  ++ + D R Q +  Y+T+DAGPN+K+++  K  + I Q+
Sbjct: 240 HALTLSADPGYTYFNGDTIHAIQAINDLRSQGVSCYYTMDAGPNVKVIYDQKDRKKIVQY 299

Query: 322 F------PEITIIDPLDSPDL 336
                    + I  P    ++
Sbjct: 300 LGNLFGKERLIISQPGPGVEI 320


>gi|227831354|ref|YP_002833134.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.S.2.15]
 gi|229580265|ref|YP_002838665.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.G.57.14]
 gi|229581089|ref|YP_002839488.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.N.15.51]
 gi|227457802|gb|ACP36489.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus L.S.2.15]
 gi|228010981|gb|ACP46743.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.G.57.14]
 gi|228011805|gb|ACP47566.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.N.15.51]
          Length = 325

 Score =  309 bits (791), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 101/312 (32%), Positives = 165/312 (52%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            ++I  +    +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L 
Sbjct: 61  -ERILPEDEMKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + I +F   + I
Sbjct: 296 QDILEFLKSLEI 307


>gi|238854636|ref|ZP_04644966.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 269-3]
 gi|260664421|ref|ZP_05865273.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii SJ-7A-US]
 gi|282932973|ref|ZP_06338370.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|313472180|ref|ZP_07812672.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 1153]
 gi|238832426|gb|EEQ24733.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 269-3]
 gi|239529554|gb|EEQ68555.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 1153]
 gi|260561486|gb|EEX27458.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii SJ-7A-US]
 gi|281303008|gb|EFA95213.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
          Length = 320

 Score =  308 bits (789), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 116/321 (36%), Positives = 189/321 (58%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK+D+ L LPL +S+S++L    T T + +ID++    ILNGQ+
Sbjct: 2   KNTARAHTNIALIKYWGKKDADLRLPLMSSISMTLDAFYTDTSL-IIDTEDKKFILNGQE 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++ Q++   +   + +  ++   V   F + + N++PT AGLASS+S FAAL  +  + Y
Sbjct: 61  VTGQAA--NRVFAYVERLQKLFNVSGNFHVISDNHVPTAAGLASSSSAFAALAASFVKAY 118

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGLL 199
           ++   ++ LS +ARLGSGSA RS Y GF +W  GT  N  +SFA         DLR+  +
Sbjct: 119 NLSISTKGLSILARLGSGSATRSVYGGFVKWNKGT--NSSNSFAEVIEEKPQMDLRLLAV 176

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           ++   EKK+ S E M+     SPFF  W  +   ++  ++ AI + DF KLG++AE +A 
Sbjct: 177 EVNVAEKKLSSTEGMK-LAQTSPFFKPWIARNDEEIEQMETAIKNNDFTKLGQLAELSAS 235

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH----KIE 315
           +MHA  +AA P   Y+  ET++ ++ + + R   +  Y+T+DAGPN+K+L        I+
Sbjct: 236 EMHAINLAAQPGFTYFANETLEIIKLIQELRNNGLECYYTIDAGPNVKILCQKNSCSDIK 295

Query: 316 ETIKQFFPEITIIDPLDSPDL 336
           + +K   P + I++    P +
Sbjct: 296 KYVKNILPNVKIVEAGFGPGI 316


>gi|74692165|sp|Q751D8|MVD1_ASHGO RecName: Full=Diphosphomevalonate decarboxylase; AltName:
           Full=Mevalonate pyrophosphate decarboxylase; AltName:
           Full=Mevalonate-5-diphosphate decarboxylase;
           Short=MDDase
          Length = 372

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 95/322 (29%), Positives = 155/322 (48%), Gaps = 26/322 (8%)

Query: 45  LNLPLNNSLSLSLGH--LGTITHI-TVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFR 101
           LNLP N+S+S++L    L T+T   T  +   D + LNG+  S  ++  ++        R
Sbjct: 2   LNLPTNSSISVTLSQEDLRTLTSAATGPELAEDRLWLNGKPESLGNARTQQCLADLRALR 61

Query: 102 Q-----------FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
           +            S+    I + NN PT AGLASSA+GFAAL +A+ ++Y +P+    +S
Sbjct: 62  RALETEEPDLPRMSEWKLHIVSENNFPTAAGLASSAAGFAALVVAVAKLYGLPQDYSEIS 121

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKI 208
           ++AR GSGSACRS Y G+  W  G + +G DS AV   +   WP++R  +L +    K  
Sbjct: 122 KIARKGSGSACRSLYGGYVAWEMGAEADGSDSRAVQIADVEHWPEMRAAILVVSADRKDT 181

Query: 209 GSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
            S   M+ T H S  F +     +      +  AI  +DF     +  +++   HAT + 
Sbjct: 182 PSTSGMQQTVHTSDLFKERVATVVPRRYGEMAAAIRARDFATFARLTMQDSNSFHATCLD 241

Query: 268 ASPPLLYWQKETIQGM---ERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           + PP+ Y    + + +     + +   ++I + +T DAGPN  L +  + E  +  F   
Sbjct: 242 SFPPIFYMNDTSRRIVKLCHLINEFYNETI-VAYTFDAGPNAVLYYLAENEARLCGFLSA 300

Query: 325 ITIIDPLDSPDLWSTKDSLSQK 346
           +       + D W T  S  Q+
Sbjct: 301 V-----FGANDGWETTFSTEQR 317


>gi|315224790|ref|ZP_07866611.1| diphosphomevalonate decarboxylase [Capnocytophaga ochracea F0287]
 gi|314945193|gb|EFS97221.1| diphosphomevalonate decarboxylase [Capnocytophaga ochracea F0287]
          Length = 342

 Score =  308 bits (789), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 93/333 (27%), Positives = 144/333 (43%), Gaps = 33/333 (9%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----------D 74
           S   PSNIAL KYWGK+  +  LP N S+S +L H  T T I                  
Sbjct: 3   SFKAPSNIALVKYWGKKGKQ--LPANPSISFTLTHCYTETSIEYERRSESSIASGEPFSF 60

Query: 75  CIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFA 130
                GQ   S       FF++   +          +F I + N+ P  +G+ASSAS  A
Sbjct: 61  DFSFEGQPKPSFHPKIHTFFERIVAYLPF---LKDYHFSIASHNSFPHSSGIASSASAMA 117

Query: 131 ALTLALFRIYSI-------PEKSESLSRVARLGSGSACRSFYRGFCEWIC-----GTDQN 178
           AL++ L +I              +  S +ARLGSGSACRS       W       G+   
Sbjct: 118 ALSVCLMQISKELGETSTEEAFWQKASFLARLGSGSACRSVQGNIVVWGEHPAIIGSSDE 177

Query: 179 GMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHI 238
               + +P +  + + +  +L I   +K++ S        H  PF      Q + ++  +
Sbjct: 178 YGIPYPLPVHEVFQNYQDTILLIDRGQKQVSSTVG-HNLMHGHPFAEARFAQANENINKL 236

Query: 239 KQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIY 297
            ++    D  +  EV E  AL +HA M  + P  +  +  T++ ++R+W  R+++ IP+ 
Sbjct: 237 VRSFASGDVERFIEVVESEALTLHAMMQTSIPYFILMRPNTLEVIQRIWQYRKETNIPLC 296

Query: 298 FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDP 330
           FTLDAG N+ LL+       +K F  E      
Sbjct: 297 FTLDAGANVHLLYPKTSTTEVKWFIEEELAQFC 329


>gi|17537201|ref|NP_496966.1| hypothetical protein Y48B6A.13 [Caenorhabditis elegans]
 gi|5824811|emb|CAB54454.1| C. elegans protein Y48B6A.13b, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 377

 Score =  307 bits (788), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 103/360 (28%), Positives = 168/360 (46%), Gaps = 28/360 (7%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS- 71
           + + +     +++  +P NIAL KYWGKRD  L LPLN+S+SL++  L   T I ++   
Sbjct: 1   MSQDDGAAEAEATVRVPMNIALVKYWGKRDDLLILPLNDSISLTVDRLTAETTIRMVPGV 60

Query: 72  DADCIILNGQKISSQSS-----------FFKKTTQFCDLFRQFSK--------VYFLIET 112
               + +NG+ +   S+             ++  +  +     S          +F + +
Sbjct: 61  GKHTVEINGKSVELSSNKRYQTVFDEALRLQRKRKEAEASSADSNGNDPPPIFYHFHVTS 120

Query: 113 SNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWI 172
           + N P  AGLASSA+GFAA+ LA+ RI          +R+AR+GSGSACRS Y G   W 
Sbjct: 121 TTNFPVAAGLASSAAGFAAIALAIQRILR--LDDSQANRLARIGSGSACRSMYGGLVHWR 178

Query: 173 CGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ 230
            G   +G D  AV       W DL   +L   D  KK+GS E M  +R  S       + 
Sbjct: 179 KGEMDDGSDCLAVRTEAAANWEDLYCIILVFDDGRKKVGSSEGMRRSRETSQLLKHRIES 238

Query: 231 I-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA 289
           I    +  I++A   ++F +L  V   ++ + HA  + ++PP+ Y  + + Q ++ V + 
Sbjct: 239 IVPQRIQQIQEAYTSRNFEQLARVIMADSNQFHAVCMDSTPPIRYLNEASWQLIDTVEEF 298

Query: 290 RQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSI 349
               I   +T DAGPN  ++   +      QF   +     + S DL      L+++  +
Sbjct: 299 NIGGIRAAYTFDAGPNACVIVQKENAS---QFLKAVLQTIQVPSEDLQVIGKELAEQFDV 355


>gi|114664085|ref|XP_001135547.1| PREDICTED: diphosphomevalonate decarboxylase isoform 1 [Pan
           troglodytes]
          Length = 434

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 98/386 (25%), Positives = 150/386 (38%), Gaps = 56/386 (14%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSD 72
            + K     +   P NIA+ KYWGKRD +L LP+N+SLS++L    L T T   +  D  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFT 61

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDL-------------FRQFSKVYFLIETSNNIPTK 119
            D I LNG++        +   +                           + + NN PT 
Sbjct: 62  EDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTA 121

Query: 120 AGLASSASGFAALTLA----------LFRIYSIPEK---------------------SES 148
           AGLASSA+G+A L  A          L R+                              
Sbjct: 122 AGLASSAAGYACLVAAGVGLSPVIPVLKRLMGEKHFRPGVQDQPGQHTYTLARVYGVESD 181

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREK 206
           LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + WP+LR+ +L +    +
Sbjct: 182 LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSGVGR 241

Query: 207 KIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
                  +              +  +   +A + + I ++DF    ++  K++ + HAT 
Sbjct: 242 VEQQPCGLSAPWETPCALQFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATC 301

Query: 266 IAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
           +   PP+ Y    + + +  V           + +T DAGPN  +       +T+ +F  
Sbjct: 302 LDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLD---DTVAEFVA 358

Query: 324 EITIIDPLDSP-DLWSTKDSLSQKNS 348
            +    P  S  D +     +     
Sbjct: 359 AVRHGFPPGSNGDTFLKGLQVRPAPL 384


>gi|88801344|ref|ZP_01116872.1| hypothetical protein PI23P_01757 [Polaribacter irgensii 23-P]
 gi|88782002|gb|EAR13179.1| hypothetical protein PI23P_01757 [Polaribacter irgensii 23-P]
          Length = 359

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 81/350 (23%), Positives = 146/350 (41%), Gaps = 30/350 (8%)

Query: 7   HILHRYIGECNPKINEKS--SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
               ++I +   +  EK   +   PSNIAL KYWGK D +  LP N S+S +L +  T T
Sbjct: 1   MNTAQFIPKTRSEKIEKVSFTWQTPSNIALVKYWGKSDPQ--LPKNASISFTLNNCHTRT 58

Query: 65  HITVIDSDA-----DCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNN 115
            I     ++       +   G++          FFK+   +C           +I ++N+
Sbjct: 59  TIGFSKQESKACADFDLFFEGKEKEEFKPKIADFFKRVQIYCPYV---LDYKMIISSTNS 115

Query: 116 IPTKAG-------LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGF 168
            P  +G       L++ A    +L  AL    +     +  S +ARLGSGSA RS     
Sbjct: 116 FPHSSGIASSASGLSAIAMCLMSLEQALNPSLTAAFIIKKASFLARLGSGSASRSIEGPL 175

Query: 169 CEWICGTDQNGMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
             W       G        F    +  + + +  +L +   EK++ S        H  P+
Sbjct: 176 VVWGEHPAIVGSSDVFGIQFPYKVHAVFENYQDAILLVDKGEKQVSSTLG-HNLMHDHPY 234

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
                 Q + +++ + + +          + E  AL +HA M+ ++P  +  +  T++ +
Sbjct: 235 AENRFVQANENVSKMSEILQKGALKAFVNLVESEALALHAMMLTSTPYFILMKPNTLEII 294

Query: 284 ERVWDAR-QQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           +++W+ R  ++  I FTLDAG N+ +L+    +E I +F          +
Sbjct: 295 QKIWEFRVAENSNICFTLDAGANVHILYPFNEKEKINRFIESELAQYCQN 344


>gi|325186978|emb|CCA21522.1| diphosphomevalonate decarboxylase putative [Albugo laibachii Nc14]
          Length = 429

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 148/302 (49%), Gaps = 11/302 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIILNG 80
            +   P+NIA+ KYWGK +  LN PLN+S+S++L    L   T I V  S  A  + LNG
Sbjct: 4   VTCLSPTNIAIIKYWGKENPVLNTPLNSSVSVTLDPTLLYAKTSIAVDQSFSATRMWLNG 63

Query: 81  QKISSQSSFFKKTTQFCDLF---RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
           +++S   S      +         +  K++F I + N+ PT AGLASSA+G+A+L   L 
Sbjct: 64  KELSQLPSRAIAVIELLKSLSGDPKCRKMHFHIVSENSFPTGAGLASSAAGYASLVYTLA 123

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIG 197
           +I  +    E LS +AR GSGSACRS + G   W  GTD     +  +     WP+L   
Sbjct: 124 QILDLHIPLEELSVIARQGSGSACRSLFGGLVRWDKGTDSASSKAIHIADETSWPELCAV 183

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGEVAEK 256
           +  + ++EK+  S   M++++  S      T + +   +  ++ A ++++F + G +  +
Sbjct: 184 ICVVNEKEKETSSTFGMQLSKRTSALLPFRTSKIVPERIEAMQSAFLEKNFTQFGRILMQ 243

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQ----QSIPIYFTLDAGPNLKLLFTH 312
           ++ + HA  +   PP+ Y    +   +  +           I   +T DAGPN  +  T 
Sbjct: 244 DSNQFHAICLDTQPPIFYMNATSQHIISLIHAYNNISEDGEIRAAYTFDAGPNAVVYTTR 303

Query: 313 KI 314
             
Sbjct: 304 AY 305


>gi|225010110|ref|ZP_03700582.1| GHMP kinase [Flavobacteria bacterium MS024-3C]
 gi|225005589|gb|EEG43539.1| GHMP kinase [Flavobacteria bacterium MS024-3C]
          Length = 371

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 96/350 (27%), Positives = 149/350 (42%), Gaps = 36/350 (10%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD- 72
            +   + N+  +   PSNIAL KYWGK D +  +P N S+S +L H  T T +T++D   
Sbjct: 10  SQHLVQTNKTVTWASPSNIALVKYWGKYDPQ--IPANPSISFTLNHCNTKTSVTLVDQSM 67

Query: 73  ---------ADCIILNGQKISSQSSFFKKTTQFC----DLFRQFSKVYFLIETSNNIPTK 119
                    +      G     +  F  K   F     D        + +I + N  P  
Sbjct: 68  LSDKSTGAFSFEFSFEGAP---KPDFHPKIASFFARVFDYLPFLKTYHLVINSENTFPHS 124

Query: 120 AGLASSASGFAALTLALFRIYSI----------PEKSESLSRVARLGSGSACRSFYRGFC 169
           +G+ASSAS  AAL+L L  +                    S +ARLGSGSA RS      
Sbjct: 125 SGIASSASAMAALSLCLLELSDEFPPNDQNVFSEAFYAKASFLARLGSGSAARSISGPLM 184

Query: 170 EWICGTD-QNGMDSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF 224
           +W      +   D  AVPF       + + +  +L +   EK + S           PF 
Sbjct: 185 QWGKTPGFKASQDLVAVPFNKVLAPIFKNFQDTILLVDKGEKVVSSTVG-HGLMKDHPFA 243

Query: 225 TQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
               QQ    LA + +A++  D      V E  AL +HA M+ +SP  +  +  T+  +E
Sbjct: 244 KARFQQAHDQLALLTEALVSGDMETFISVVESEALTLHAMMLTSSPYFILMKPGTLSIIE 303

Query: 285 RVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           ++W+ R+ + +P+ FTLDAG N+ LL+    +  + QF     +    + 
Sbjct: 304 KIWNFRKNTALPVCFTLDAGANVHLLYPEMHKVQVLQFIENELVAYCQNG 353


>gi|323475698|gb|ADX86304.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus REY15A]
          Length = 325

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 100/312 (32%), Positives = 164/312 (52%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            ++I  +    +   +  + F++    +    +E+    P  AGLASSA+G AALT  L 
Sbjct: 61  -ERILPEDEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + +      + +AI ++D  K   +  
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + + +F   + I
Sbjct: 296 QDVLEFLKSLEI 307


>gi|229585836|ref|YP_002844338.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.27]
 gi|228020886|gb|ACP56293.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.27]
          Length = 325

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 101/312 (32%), Positives = 162/312 (51%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + +       +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L 
Sbjct: 61  DRILPEDE-MKEYAGRVLEAFKKIIGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKLEELSKIARLGSGSACRSMFGGFVVWNKGLREDGGDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + I      + +AI ++D  K      
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYFVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + I +F   + I
Sbjct: 296 QDILEFLKSLEI 307


>gi|153799376|gb|ABS50447.1| NapT5 [Streptomyces aculeolatus]
          Length = 378

 Score =  306 bits (785), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 109/296 (36%), Positives = 159/296 (53%), Gaps = 10/296 (3%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISSQS 87
             NIAL KYWGKRD  L LP  +SLS++L    T T + +   +  D ++L G+    ++
Sbjct: 53  HPNIALIKYWGKRDEHLVLPRTDSLSMTLDIFPTTTRVRLAPEAGRDVVVLGGRPAEGEA 112

Query: 88  SFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
              ++   F DL R  ++V    ++E+ N +PT AGLASSASGFAAL +A  R Y +   
Sbjct: 113 --LRRIVTFLDLVRHSARVPHRAVVESHNTVPTGAGLASSASGFAALAVAAARAYGLSLT 170

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICG-----TDQNGMDSFAVPFNNQWPDLRIGLLK 200
           +  LSR+AR GSGSA RS + GF  W  G     T    + S+A P      D  + +  
Sbjct: 171 ATGLSRLARRGSGSASRSVFGGFAVWHAGRPGQDTKAADLGSYAEPVPVADLDPALVVAV 230

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +    K + SR AM  T   SP +  W      DL  ++ A++  D   +GE+AE+NAL 
Sbjct: 231 VDAGPKAVSSRAAMRRTVDTSPLYEPWAASSRDDLTQMRAALLRGDLQVVGEIAERNALG 290

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           MHATM+AA P + Y    T+  ++ V   R+  +  + T+DAGPN+K+L      +
Sbjct: 291 MHATMLAARPAVRYLAPATLTVLDAVAQLRRDGVGAWATMDAGPNVKVLCRRLEAD 346


>gi|227828609|ref|YP_002830389.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.14.25]
 gi|238620809|ref|YP_002915635.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.4]
 gi|227460405|gb|ACP39091.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.14.25]
 gi|238381879|gb|ACR42967.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus M.16.4]
          Length = 325

 Score =  306 bits (783), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 101/312 (32%), Positives = 162/312 (51%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            + +       +   +  + F++    + +  +E+    P  AGLASSA+G AALT  L 
Sbjct: 61  DRILPEDE-MKEYAGRVLEAFKKIIGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++ARLGSGSACRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKLEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + I      + +AI ++D  K      
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYFVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + I +F   + I
Sbjct: 296 QDILEFLKSLEI 307


>gi|298709542|emb|CBJ48557.1| Diphosphomevalonate decarboxylase [Ectocarpus siliculosus]
          Length = 433

 Score =  305 bits (782), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 94/327 (28%), Positives = 148/327 (45%), Gaps = 30/327 (9%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI-DSDADCIILNG 80
            +   P+NIA+ KYWGK    LN P+N+S S++L    L  IT +    D + D + LNG
Sbjct: 11  VTCSAPTNIAVIKYWGKDSVALNTPINSSASVTLSQDDLRAITTVAASKDFEKDQLWLNG 70

Query: 81  QKISSQSSFFKKTTQFCDLFR-------------------QFSKVYFLIETSNNIPTKAG 121
            +     +  K+        R                    + +    I + N  PT AG
Sbjct: 71  TEEDVSKN--KRFQAVIRQVRALATEKRDEATGEVVVAEGDWDQYRVRIASRNTFPTAAG 128

Query: 122 LASSASGFAALTLALFRIYSIPEKSE-SLSRVARLGSGSACRSFYRGFCEWICGTDQNGM 180
           LASSA+G A LT +L ++++  E  +  LS +AR GSGSACRS Y GF +W  G  ++  
Sbjct: 129 LASSAAGLACLTFSLAKLFNAKESFDGELSSIARQGSGSACRSLYGGFVKWQKGVREDAR 188

Query: 181 DSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAH 237
           DS AV   +   WP++R  +L +   +K   S   M  +   SP       + +   LA 
Sbjct: 189 DSIAVQVADEHHWPEMRALILVVSADKKDTSSTSGMSTSVQTSPLLGFRAKEVVEPRLAE 248

Query: 238 IKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIP 295
           I++A +++DF   G++  +++ + HAT +   PP+ Y    +   +  V         I 
Sbjct: 249 IEKAYLEKDFATFGKITMQDSNQFHATCLDTYPPIFYMNDVSRSVIRIVHAYNAFHGEIR 308

Query: 296 IYFTLDAGPNLKLLFTHKIEETIKQFF 322
             +T DAGPN  +         +    
Sbjct: 309 AAYTFDAGPNAVVYHLAGDSAELLALL 335


>gi|226287852|gb|EEH43365.1| diphosphomevalonate decarboxylase [Paracoccidioides brasiliensis
           Pb18]
          Length = 388

 Score =  305 bits (782), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 103/326 (31%), Positives = 151/326 (46%), Gaps = 27/326 (8%)

Query: 37  YWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS----DADCIILNGQKISSQSS-- 88
           YWGKRD+ LNLP N+SLS++L    L   T  +   S      D + LN +  S Q S  
Sbjct: 6   YWGKRDAVLNLPTNSSLSVTLSQSSLRAYTTASCSPSYPTDAGDTLTLNSEPHSIQDSKR 65

Query: 89  ----------FFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
                       ++         + S     I + NN PT AGLASSA+GFAAL  A+  
Sbjct: 66  TLACLADLRALRQQLENTDPSLPKLSTFPLRIVSENNFPTAAGLASSAAGFAALVCAIAN 125

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRI 196
           +Y +P+    LSR+AR GSGSACRS   G+  W  G  ++G+DS A  V   + WPD+R 
Sbjct: 126 LYKLPQSPRELSRIARQGSGSACRSMMGGYVAWRAGVLEDGIDSLAEEVAPASHWPDMRA 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAE 255
            +L + D +K++ S + M+ T   S  F    +  +   +  I+ AI ++DF    E+  
Sbjct: 186 LILVVSDAQKEVPSTKGMQATVATSSLFPTRAETVVPARITAIEAAIQNRDFPSFAEITM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHK 313
           +++   HAT +   PP  Y    +   +  V D  +        +T DAGPN  + +  K
Sbjct: 246 RDSNNFHATNLDTWPPTFYLNDVSRAAIRIVHDINRVAGETICAYTFDAGPNAVIYYLKK 305

Query: 314 IEETIKQFFPEITIIDPLDSPDLWST 339
             E +   F  I           W  
Sbjct: 306 ESERVIGTFKSIL----SAETRGWDG 327


>gi|258539705|ref|YP_003174204.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus Lc 705]
 gi|257151381|emb|CAR90353.1| Diphosphomevalonate decarboxylase [Lactobacillus rhamnosus Lc 705]
          Length = 334

 Score =  305 bits (782), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 108/335 (32%), Positives = 169/335 (50%), Gaps = 14/335 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + +L LP  +S+SL+L    T T +T   + D D   LN Q  S
Sbjct: 5   ARAHTNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPALDQDQFTLNHQMQS 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +
Sbjct: 65  PTA-----VSRFLDHVRHLAQIDTRARVNSLNHVPTAAGLASSASAFAALALATSRAAGL 119

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LSR+AR GSGSA RS + G   W  G+D     +  +      P LR+ ++ + 
Sbjct: 120 NLTPTALSRLARRGSGSATRSIFGGAVIWHRGSDDQSSFAEPLTIQPTLP-LRMLVVTVS 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MH
Sbjct: 179 DQKKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 239 AAIMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTAPYVDVLMTAL 298

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
             +    I+     PD           N  E  I+
Sbjct: 299 QPVFGDRILSTRLGPDAQVITKEQF--NDTESAIT 331


>gi|223994695|ref|XP_002287031.1| mevalonate disphosphate decarboxylase-like protein [Thalassiosira
           pseudonana CCMP1335]
 gi|220978346|gb|EED96672.1| mevalonate disphosphate decarboxylase-like protein [Thalassiosira
           pseudonana CCMP1335]
          Length = 346

 Score =  305 bits (781), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 102/344 (29%), Positives = 156/344 (45%), Gaps = 33/344 (9%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
             ++   P+NIA  KYWGK  SK N P+N+SLSL+L    L  +T      S   D + L
Sbjct: 2   HTATVSAPTNIACIKYWGKASSKYNTPINSSLSLTLDQSDLRAVTTAAASTSFTKDRLWL 61

Query: 79  NGQKISSQSSFFKKTTQFCDLFR-------------------QFSKVYFLIETSNNIPTK 119
           NG +  + +   K+     D  R                   Q+  ++  + + N  PT 
Sbjct: 62  NGSEE-ANAFTSKRFRACIDGLRALATDKVDPTTNEVIVSKSQWQSMHVHVASYNTFPTA 120

Query: 120 AGLASSASGFAALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWIC-GTDQ 177
           AGLASSA+G+AAL  +L  +Y+  E      + +AR GSGSACRS Y GF  W   G  +
Sbjct: 121 AGLASSAAGYAALVASLVELYNAKESYPGEFTAIARQGSGSACRSLYGGFVAWRAGGMKE 180

Query: 178 NGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STD 234
           +  DS A    +   W ++R  +L + D +K+  S   ME +   S       ++I    
Sbjct: 181 DWSDSIAEQVADEMHWKEMRAVILVVSDAKKETSSTVGMETSVATSELLAHRAKEIVPKR 240

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
           +  I+ AI  +DF   G+V   ++ + HAT +   PP+ Y    +   ++ V    +   
Sbjct: 241 MKIIEDAIQAKDFEAFGKVTMMDSNQFHATCLDTYPPIFYMNDVSRSVIQMVTRYNEWAG 300

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
            I   +T DAGPN  L    K    + +    +    P  SP+L
Sbjct: 301 EIRAAYTFDAGPNAVLYTLDKY---VVELLALVLKHYPAQSPEL 341


>gi|320170681|gb|EFW47580.1| diphosphomevalonate decarboxylase [Capsaspora owczarzaki ATCC
           30864]
          Length = 398

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 149/307 (48%), Gaps = 22/307 (7%)

Query: 39  GKRDSKLNLPLNNSLSLSL--GHLGTITHITV-IDSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD +L LP+N+SLS +L    L   T +    D  +D I LNG++ S ++   +   +
Sbjct: 23  GKRDEELILPINSSLSGTLSQDQLHARTSVMARADFASDAIWLNGKQESIENPRLQNCLR 82

Query: 96  FCDLFRQFSKVY----------FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
                    + +            I + NN PT AGLASSA+G+A L  AL ++Y + + 
Sbjct: 83  EIRKLAAAKQTHQQGAPLPTDKVHICSVNNFPTAAGLASSAAGYACLVYALAQLYKVGDS 142

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIID 203
              ++++AR+GSGSACRS Y G+  W+ G   +G DS A      + WP++ + +L + D
Sbjct: 143 LAEVTKLARVGSGSACRSIYGGWVRWVMGEAADGSDSIAEQVVDEHHWPEIEVLILVVSD 202

Query: 204 REKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            +K   S   M+ T   S        + +   +  I+ AI  +DF   G +  +++ + H
Sbjct: 203 HKKTTSSTAGMQTTVETSSLVKHRADKVVPQRMEDIQNAIRARDFETFGRITMQDSNQFH 262

Query: 263 ATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLFTHKIEET--- 317
           A  +   PP+ Y    +   ++ +  ++A +  I   +T DAGPN  +    +       
Sbjct: 263 AVCLDTYPPITYLNDVSRGIIDMLTKYNAHKGKIQAAYTFDAGPNAVIYLPRENVNEVVN 322

Query: 318 -IKQFFP 323
            ++ FFP
Sbjct: 323 LVRHFFP 329


>gi|315038486|ref|YP_004032054.1| mevalonate pyrophosphate decarboxylase [Lactobacillus amylovorus
           GRL 1112]
 gi|312276619|gb|ADQ59259.1| mevalonate pyrophosphate decarboxylase [Lactobacillus amylovorus
           GRL 1112]
          Length = 321

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 112/317 (35%), Positives = 176/317 (55%), Gaps = 12/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S
Sbjct: 4   TARAHTNIALIKYWGKKDATLRIPLMSSLSMTLDAFYTDTSIE-KGTDTNEFYLNDKKQS 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +S  ++   + +  +Q   +     +I+++N++PT AGLASS+S FAAL  A    Y 
Sbjct: 63  LANS--QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYH 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           I      LSR+AR+GSGSA RS + GF  W  G       ++A+  + +  DL +  +++
Sbjct: 121 IDADKTLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYALDEHPKI-DLHLLAIEL 179

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             ++KKI S   M+     SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +M
Sbjct: 180 NTKQKKISSTRGMKD-AQSSPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA  + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L   +  + I + 
Sbjct: 239 HAINLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIEN 298

Query: 322 FP----EITIIDPLDSP 334
           F      + I+     P
Sbjct: 299 FESEFNNVKIVSASFGP 315


>gi|229552296|ref|ZP_04441021.1| possible diphosphomevalonate decarboxylase [Lactobacillus rhamnosus
           LMS2-1]
 gi|229314278|gb|EEN80251.1| possible diphosphomevalonate decarboxylase [Lactobacillus rhamnosus
           LMS2-1]
          Length = 341

 Score =  304 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 108/335 (32%), Positives = 169/335 (50%), Gaps = 14/335 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + +L LP  +S+SL+L    T T +T   + D D   LN Q  S
Sbjct: 12  ARAHTNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPALDQDQFTLNHQMQS 71

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +
Sbjct: 72  PTA-----VSRFLDHVRHLAQIDTRARVNSLNHVPTAAGLASSASAFAALALATSRAAGL 126

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LSR+AR GSGSA RS + G   W  G+D     +  +      P LR+ ++ + 
Sbjct: 127 NLTPTALSRLARRGSGSATRSIFGGAVIWHRGSDDQSSFAEPLTIQPTLP-LRMLVVTVS 185

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MH
Sbjct: 186 DQKKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMH 245

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 246 AAIMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTAPYVDVLMTAL 305

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
             +    I+     PD           N  E  I+
Sbjct: 306 QPVFGDRILSTRLGPDAQVITKEQF--NDTESAIT 338


>gi|241735356|ref|XP_002413928.1| diphosphomevalonate decarboxylase, putative [Ixodes scapularis]
 gi|215507782|gb|EEC17236.1| diphosphomevalonate decarboxylase, putative [Ixodes scapularis]
          Length = 357

 Score =  304 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 97/329 (29%), Positives = 154/329 (46%), Gaps = 27/329 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITV-IDSDADCIILNG 80
           ++A  P NIA+ KYWGK + +L +P N+SLSL+L   HL   T + V  D   D I LNG
Sbjct: 14  ATARAPVNIAVVKYWGKTNEELIIPANDSLSLTLHIDHLCAKTTVAVGRDFKEDRIWLNG 73

Query: 81  QKISSQSS-------FFKKTTQFCDL----FRQFSKVYFLIETSNNIPTKAGLASSASGF 129
           ++    +          K++ +F  +       +S  +  I + NN PT AGLASSA+G+
Sbjct: 74  KEERVTTRIQNCLLEIRKRSREFMHMHNTGLPDYSDWHLHICSVNNFPTAAGLASSAAGY 133

Query: 130 AALTLALFRIYSIPEK-SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VP 186
           A L  A F +         +L  +   GSGSACRS Y GF  W+ G  Q+G DS A  + 
Sbjct: 134 ACLEWAYFMLLRHKYNVMRTLHYIPLRGSGSACRSMYGGFVAWLKGLRQDGKDSVAKQIA 193

Query: 187 FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQ 245
             N WP++R       D +K  GS + ME++   S        + +   +  I +AI+++
Sbjct: 194 PENHWPEMRXXF----DVKKDTGSTQGMELSMLTSSLLEYRATKVVPQRMKDITEAIVNR 249

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAG 303
           +F K  E+  + + ++HA  +   PP+ Y    +   +  V    +   +  + ++ DAG
Sbjct: 250 NFHKFAEITMQESNQLHAVCLDTYPPIRYMNLVSWDIVHLVHRYNRYYGTNKLAYSFDAG 309

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           PN  L         +      +    P  
Sbjct: 310 PNACLFMLEDSLSEV---LSIVQHAFPSS 335


>gi|86132443|ref|ZP_01051037.1| diphosphomevalonate decarboxylase [Dokdonia donghaensis MED134]
 gi|85817004|gb|EAQ38188.1| diphosphomevalonate decarboxylase [Dokdonia donghaensis MED134]
          Length = 360

 Score =  304 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 88/347 (25%), Positives = 155/347 (44%), Gaps = 31/347 (8%)

Query: 12  YIGECNPKI--NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH---- 65
           +I   N K+      +   PSNIAL KYWGK   +  LP N S+S +L +  T T     
Sbjct: 6   FIPSENYKVLTQGSVTYQSPSNIALVKYWGKHGEQ--LPQNPSISFTLSNCHTTTTLTYK 63

Query: 66  --ITVIDSDADCIILNGQKISSQSS----FFKKTTQFCDLFRQFSKVYFLIETSNNIPTK 119
              +        ++L+G+           FF++  ++    +++S   ++I+T+N+ P  
Sbjct: 64  KTASATGEIEFDVLLDGKSEPDFKPKIAKFFERIEKYIPFVKEYS---YVIDTANSFPHS 120

Query: 120 AGLASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWI 172
           +G+ASSASG +AL L L  I        +     +  S +ARLGSGSACRS       W 
Sbjct: 121 SGIASSASGMSALALCLMEIERQSNPDMTPAYFLQKASFLARLGSGSACRSLDGPLVVWG 180

Query: 173 CGTDQNGMD-----SFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
              + +        S+    ++ + + +  +L +   EK++ S        H   F    
Sbjct: 181 NHKEISNSSDIFGTSYNSNVHDNFKNYQDTILLVDKGEKQVSSTVG-HGLMHGHAFAKAR 239

Query: 228 TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW 287
             Q   +L+ + +     D     ++ E  AL +HA M+ + P  +  + +T++ +  +W
Sbjct: 240 FSQAHDNLSELMRVFEAGDVDAFIKLVESEALTLHAMMMTSHPYFILMKPKTLEIINEIW 299

Query: 288 DARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           D RQQ    + FTLDAG N+ +L+    + +++ F          + 
Sbjct: 300 DYRQQTGSKVCFTLDAGANVHVLYPENEKYSVQDFIAAKLSKFCQNG 346


>gi|241896116|ref|ZP_04783412.1| diphosphomevalonate decarboxylase [Weissella paramesenteroides ATCC
           33313]
 gi|241870630|gb|EER74381.1| diphosphomevalonate decarboxylase [Weissella paramesenteroides ATCC
           33313]
          Length = 326

 Score =  304 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 115/323 (35%), Positives = 177/323 (54%), Gaps = 11/323 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A   +NIAL KYWGK D  L  P   S+SL+L    T T +    S  +D +IL+G+ I
Sbjct: 4   TARAHTNIALLKYWGKVDEALITPTTTSISLTLDEFYTDTTVWFDKSLQSDQLILDGETI 63

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           S  ++  +K ++F D+ R+ + +     + ++N++PT AGLASSAS FAAL  A  +   
Sbjct: 64  SGSAA--QKVSRFLDVVREMADINDKAYVVSNNHVPTAAGLASSASAFAALAGAASKAAG 121

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      LSR+AR GSGSA RS + GF +W+ G D     +  +     WP +++  + I
Sbjct: 122 LNLSVTELSRLARHGSGSATRSIFGGFAKWVPG-DDRTSFATPIFEKVDWP-IQLLTVVI 179

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D+ KKIGSR  M+  ++ +PF+  W +  ++ +  +  AI   D +KLGE+AE NAL+M
Sbjct: 180 NDQPKKIGSRLGMQHAKNTAPFYDMWVRLANSQVNDMILAIQQHDIVKLGELAEANALQM 239

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA    + P   Y   ++ Q +    + R+Q IP+Y T+DAGPN+KL+   +    IK+ 
Sbjct: 240 HAMNTTSVPSFNYLTDKSWQVIMIAQELREQGIPVYATMDAGPNVKLISRPEDTFIIKKE 299

Query: 322 FPEI----TIIDPLDSPDLWSTK 340
              I     II     P +  T 
Sbjct: 300 LANIVTSSQIIIASPGPGIKVTS 322


>gi|256851166|ref|ZP_05556555.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 27-2-CHN]
 gi|260660590|ref|ZP_05861505.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii
           115-3-CHN]
 gi|282934632|ref|ZP_06339875.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|297206031|ref|ZP_06923426.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii JV-V16]
 gi|256616228|gb|EEU21416.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 27-2-CHN]
 gi|260548312|gb|EEX24287.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii
           115-3-CHN]
 gi|281301207|gb|EFA93508.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii 208-1]
 gi|297149157|gb|EFH29455.1| diphosphomevalonate decarboxylase [Lactobacillus jensenii JV-V16]
          Length = 320

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 115/321 (35%), Positives = 187/321 (58%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A   +NIAL KYWGK+D+ L LPL +S+S++L    T T + +ID++    ILNGQ+
Sbjct: 2   KNTARAHTNIALIKYWGKKDADLRLPLMSSISMTLDAFYTDTSL-LIDTEDKKFILNGQE 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           ++       +   + +  ++   V   F + + N++PT AGLASS+S FAAL  +  + Y
Sbjct: 61  VTG--PAANRVFDYVERLQKLFNVAGNFHVISDNHVPTAAGLASSSSAFAALAASFVKAY 118

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN-QWPDLRIGLL 199
           ++    + LS +ARLGSGSA RS Y GF +W  GT  N  +SFA   +     DL++  +
Sbjct: 119 NLSISPKGLSILARLGSGSATRSIYGGFVKWNKGT--NSANSFAEVIDEKPQMDLKLLAV 176

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           +I + EKK+ S + M+     SPFF  W  +   ++A ++ AI   DF KLG++AE +A 
Sbjct: 177 EISEAEKKLSSTKGMK-LAQTSPFFKPWIARNDEEIAQMEAAIKSNDFTKLGQLAELSAS 235

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHA  +AA P   Y+  ET++ ++ + + R + +  Y+T+DAGPN+K+L        IK
Sbjct: 236 EMHAINLAAQPGFTYFANETLEIIKLIQELRNKGLECYYTIDAGPNVKILCQKNSCSNIK 295

Query: 320 QF----FPEITIIDPLDSPDL 336
           ++     P + I++    P +
Sbjct: 296 KYVKNILPNVKIVEAGFGPGI 316


>gi|325956902|ref|YP_004292314.1| diphosphomevalonate decarboxylase [Lactobacillus acidophilus 30SC]
 gi|325333467|gb|ADZ07375.1| diphosphomevalonate decarboxylase [Lactobacillus acidophilus 30SC]
          Length = 321

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 112/317 (35%), Positives = 176/317 (55%), Gaps = 12/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S
Sbjct: 4   TARAHTNIALIKYWGKKDAILRIPLMSSLSMTLDAFYTDTSIE-KGTDTNEFYLNDKKQS 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +S  ++   + +  +Q   +     +I+++N++PT AGLASS+S FAAL  A    Y 
Sbjct: 63  LANS--QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYH 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           I      LSR+AR+GSGSA RS + GF  W  G       ++A+  + +  DL +  +++
Sbjct: 121 IDTDKTLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYALDEHPKI-DLHLLAIEL 179

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             ++KKI S   M+     SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +M
Sbjct: 180 NTKQKKISSTRGMKD-AQSSPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA  + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L   +  + I + 
Sbjct: 239 HAINLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIEN 298

Query: 322 FP----EITIIDPLDSP 334
           F      + I+     P
Sbjct: 299 FESEFNNVKIVSASFGP 315


>gi|327183681|gb|AEA32128.1| diphosphomevalonate decarboxylase [Lactobacillus amylovorus GRL
           1118]
          Length = 321

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 112/317 (35%), Positives = 176/317 (55%), Gaps = 12/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +A   +NIAL KYWGK+D+ L +PL +SLS++L    T T I    +D +   LN +K S
Sbjct: 4   TARAHTNIALIKYWGKKDAILRIPLMSSLSMTLDAFYTDTSIE-KGTDTNEFYLNDKKQS 62

Query: 85  SQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +S  ++   + +  +Q   +     +I+++N++PT AGLASS+S FAAL  A    Y 
Sbjct: 63  LANS--QRVFNYIEKLQQRFNLDKENLVIKSTNHVPTAAGLASSSSAFAALAAAFCAYYH 120

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           I      LSR+AR+GSGSA RS + GF  W  G       ++A+  + +  DL +  +++
Sbjct: 121 IDADKTLLSRLARIGSGSASRSVFGGFSIWQKGDSDETSYAYALDEHPKI-DLHLLAIEL 179

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             ++KKI S   M+     SPFF  W  +   +L  +  AI D+DF  LGE+AE NA +M
Sbjct: 180 NTKQKKISSTRGMKD-AQSSPFFKPWLARNELELNKMISAIKDEDFTVLGELAELNANEM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HA  + A P   Y++ +TIQ ++ + + R + I  Y+T+DAGPN+K+L   +  + I + 
Sbjct: 239 HAINLTAQPEFTYFEPDTIQAIKLIENLRHKGIECYYTIDAGPNIKVLCQLRNIKEIIEN 298

Query: 322 FP----EITIIDPLDSP 334
           F      + I+     P
Sbjct: 299 FESEFNNVKIVSASFGP 315


>gi|323478406|gb|ADX83644.1| diphosphomevalonate decarboxylase [Sulfolobus islandicus HVE10/4]
          Length = 325

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 100/312 (32%), Positives = 163/312 (52%), Gaps = 13/312 (4%)

Query: 22  EKSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLG-HLGTITHITVIDSDADCIILN 79
           +  +   PSNIA+ KYWGKR D +LNLPLNNSLS++L   L  IT +T+ D   + +I+N
Sbjct: 3   KSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSD--KNIVIVN 60

Query: 80  GQKISSQSSFFKKTTQFCDLFRQF--SKVYFLIETSNNIPTKAGLASSASGFAALTLALF 137
            ++I  +    +   +  + F++    +    +E+    P  AGLASSA+G AALT  L 
Sbjct: 61  -ERILPEDEMKEYAGRVLEAFKKIVGKEFNVKVESKAKFPVNAGLASSAAGIAALTFGLN 119

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLR 195
            +  +  K E LS++AR+GSGS CRS + GF  W  G  ++G DS+      +  W +L 
Sbjct: 120 ELLELELKPEELSKIARVGSGSGCRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELV 179

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
             +  + ++EKKI SR+ M  +   S       + I      + +AI ++D  K   +  
Sbjct: 180 DIIPILSEKEKKISSRKGMIRSAETSELMECRLKFIEKTFNEVIEAIRNRDERKFYYLVM 239

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +++  MHA ++ + P   Y    +I+ ME + +  +      +T DAGPN  +  T +  
Sbjct: 240 RHSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAG----YTFDAGPNPHIFTTERYV 295

Query: 316 ETIKQFFPEITI 327
           + I +F   + I
Sbjct: 296 QDILEFLKSLEI 307


>gi|118096575|ref|XP_423130.2| PREDICTED: hypothetical protein, partial [Gallus gallus]
          Length = 366

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 92/314 (29%), Positives = 145/314 (46%), Gaps = 25/314 (7%)

Query: 39  GKRDSKLNLPLNNSLSLSL--GHLGTITHIT-VIDSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD+ L LP+N+SLS++L    L T T      D   D + LNG+++ +     +   +
Sbjct: 56  GKRDTDLILPINSSLSVTLHQDQLRTTTTAAACRDFTEDRLWLNGEEVDAAQPRLQACLR 115

Query: 96  FCDL-FRQFSK----------VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
                 R+                 + + NN PT AGLASSA+G+A L  AL R+Y +  
Sbjct: 116 EVRRLARKRRGDDAAAPLSLSYKVHVASENNFPTAAGLASSAAGYACLVSALARLYGVE- 174

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKII 202
               LS VAR GSGSACRS   GF +W  G   +G DS A        WP+L + +L + 
Sbjct: 175 --GELSEVARRGSGSACRSMLGGFVQWHRGERPDGRDSVAQQLAPETHWPELSVLVLVVS 232

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             +K +GS   M+ +   SP      + +    +  + + I D+DF   G++  +++ + 
Sbjct: 233 GEKKAVGSTAGMQTSVDTSPLLKYRAEVVVPERMTRMARCIRDRDFEAFGQLTMQDSNQF 292

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           HAT +   PP+ Y    + + +              + +T DAGPN  +       +T+ 
Sbjct: 293 HATCLDTFPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVVFMLE---DTVD 349

Query: 320 QFFPEITIIDPLDS 333
           +F   +    P DS
Sbjct: 350 EFVEVVRRSFPPDS 363


>gi|91215117|ref|ZP_01252089.1| hypothetical protein P700755_12507 [Psychroflexus torquis ATCC
           700755]
 gi|91186722|gb|EAS73093.1| hypothetical protein P700755_12507 [Psychroflexus torquis ATCC
           700755]
          Length = 355

 Score =  302 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 97/348 (27%), Positives = 150/348 (43%), Gaps = 31/348 (8%)

Query: 10  HRYIGECNPKIN--EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI- 66
             +I +  P +    K S+  PSNIAL KYWGK   +  LP N S+S +L    T T + 
Sbjct: 4   QDFIYKVTPVLPELGKYSSEAPSNIALVKYWGKYGEQ--LPKNTSISYTLEDCKTKTEVV 61

Query: 67  -----TVIDSDADCIILNGQK----ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIP 117
                   D     +   G++         +F K+   +           F I T N  P
Sbjct: 62  LKKKIKADDQFHFEVFFEGKRKASFEPKIETFLKRIETYVPF---LKSFEFEIHTENTFP 118

Query: 118 TKAGLASSASGFAALTLALFRIY-------SIPEKSESLSRVARLGSGSACRSFYRGFCE 170
             +G+ASSASG AAL     +I        S        S +ARLGSGSACRS       
Sbjct: 119 HSSGIASSASGMAALAKCFMKIEVSVSPEISNLYLEHKTSFLARLGSGSACRSTGGKLVV 178

Query: 171 WICGTDQNGMDS-----FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT 225
           W    +  G  S     +    +  +   R  +L I + +K++ S        H+ PF  
Sbjct: 179 WGEHKEIEGSSSFYGIDYPYDVHPNFRSFRDSILLIDEGQKQVSSSLG-HNLMHNHPFAE 237

Query: 226 QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER 285
           Q  QQ   ++  +K  +I  D+     + E  AL +HA M+ +SP  +  Q  T+Q +E+
Sbjct: 238 QRFQQADENILKLKSILISGDYEAFFALVESEALSLHAMMMTSSPYFILMQPNTLQVIEK 297

Query: 286 VWDARQ-QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLD 332
           +   R+ +++ + FTLDAG N+ LL+    E  ++ F     +    +
Sbjct: 298 ICKFRKEENVYLGFTLDAGANVHLLYPESSETMVRPFIDSQLLPFCSN 345


>gi|71419541|ref|XP_811200.1| diphosphomevalonate decarboxylase [Trypanosoma cruzi strain CL
           Brener]
 gi|70875837|gb|EAN89349.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 94/330 (28%), Positives = 152/330 (46%), Gaps = 23/330 (6%)

Query: 21  NEKSSAFLPSNIALCKYWGKR--DSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADC 75
           N + +   P NIA  KYWGKR    KL LP N+S S++L      T T + + D  + D 
Sbjct: 3   NLQVTVEAPINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDT 62

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR-----QFSKVYFLIETSNNIPTKAGLASSASGFA 130
           +ILNG+K   +S+   +     D  R     +       I + NN PT AG+ASSASG+ 
Sbjct: 63  LILNGEKSDVRST--PRIQSVLDYVRSTCPDELKNKRVYIVSENNFPTAAGMASSASGYC 120

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
           AL  AL R+++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F ++
Sbjct: 121 ALAAALVRVFN---STANVSMLARMGSGSACRSTLGGFVIWHKGEKEDGSDCVATQFVDE 177

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS-TDLAHIKQAIIDQDF 247
             WP++++    +   +K   S   M+ +   SP   +         +  + +AI  +DF
Sbjct: 178 NYWPEMQVLCAVLQGGKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDF 237

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPN 305
               ++A   +  + A      P + Y  +++   +  V  ++A++    + +T DAG N
Sbjct: 238 YTFAQIAMNESDDLQAICATTQPQIQYATEDSYAMIRLVKTYNAKKGHPTLAYTFDAGAN 297

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
             L    K          +     P  S  
Sbjct: 298 CFLFVLEKDLPEAVAMLMQ---HFPTPSER 324


>gi|326927540|ref|XP_003209950.1| PREDICTED: diphosphomevalonate decarboxylase-like [Meleagris
           gallopavo]
          Length = 332

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 91/314 (28%), Positives = 145/314 (46%), Gaps = 25/314 (7%)

Query: 39  GKRDSKLNLPLNNSLSLSL--GHLGTITHIT-VIDSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD+ L LP+N+SLS++L    L T T      D   D + LNG+++ +     +   +
Sbjct: 21  GKRDTDLILPINSSLSVTLHQDQLRTTTTAAACRDFTEDRLWLNGEEVDAGQPRLQACLR 80

Query: 96  FCDL-FRQFSK----------VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
                 R+                 + + NN PT AGLASSA+G+A L  AL R+Y +  
Sbjct: 81  EVRRLARKRRGDDAAAPLSLSYKVHVASENNFPTAAGLASSAAGYACLVSALARLYGVE- 139

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKII 202
               LS VAR GSGSACRS   GF +W  G   +G DS A        WP+L + +L + 
Sbjct: 140 --GELSEVARRGSGSACRSMLGGFVQWHRGERPDGKDSVAQQLAPETHWPELSVLVLVVS 197

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
             +K +GS   M+ +   SP      +  +   +  + + I D+DF   G++  +++ + 
Sbjct: 198 GEKKAVGSTAGMQTSVDTSPLLKYRAEMVVPERMTRMARCIQDRDFEAFGQLTMQDSNQF 257

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           HAT +   PP+ Y    + + +              + +T DAGPN  +       +T+ 
Sbjct: 258 HATCLDTFPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVIFMLE---DTVD 314

Query: 320 QFFPEITIIDPLDS 333
           +F   +    P +S
Sbjct: 315 EFVEVVRRSFPPNS 328


>gi|322818236|gb|EFZ25707.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  302 bits (773), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 92/317 (29%), Positives = 147/317 (46%), Gaps = 20/317 (6%)

Query: 21  NEKSSAFLPSNIALCKYWGKR--DSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADC 75
           N + +   P NIA  KYWGKR    KL LP N+S S++L      T T + + D  + D 
Sbjct: 3   NLQVTVEAPINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDT 62

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR-----QFSKVYFLIETSNNIPTKAGLASSASGFA 130
           +ILNG+K   +S+   +     D  R     +       I + NN PT AG+ASSASG+ 
Sbjct: 63  LILNGEKSDVRST--PRIQSVLDYVRSTCPDELKNKRVYIVSENNFPTAAGMASSASGYC 120

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
           AL  AL R+++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F ++
Sbjct: 121 ALAAALVRVFN---STANVSMLARMGSGSACRSALGGFVIWHKGEKEDGSDCVATQFVDE 177

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS-TDLAHIKQAIIDQDF 247
             WP++++        +K   S   M+ +   SP   +         +  + +AI  +DF
Sbjct: 178 NYWPEMQVLCAVFQGGKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDF 237

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIP-IYFTLDAGPN 305
               ++A   +  + A      P + Y  +++   +  V +   ++  P + +T DAG N
Sbjct: 238 YAFAQIAMSESDDLQAICATTQPQIQYATEDSYAMIRLVKNYNAKKGHPTLAYTFDAGAN 297

Query: 306 LKLLFTHKIEETIKQFF 322
             L    K         
Sbjct: 298 CFLFVLEKDLPEAVAML 314


>gi|300776785|ref|ZP_07086643.1| mevalonate diphosphate decarboxylase [Chryseobacterium gleum ATCC
           35910]
 gi|300502295|gb|EFK33435.1| mevalonate diphosphate decarboxylase [Chryseobacterium gleum ATCC
           35910]
          Length = 352

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 96/340 (28%), Positives = 163/340 (47%), Gaps = 22/340 (6%)

Query: 7   HILHRYIGECNPKINEKSSAFL-PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITH 65
                +IG+ N  I+ ++ +   PSNIAL KYWGK   +  +P N S+S +L H  T T 
Sbjct: 1   MTTQEFIGKENFTIHTQTVSESCPSNIALIKYWGKYADQ--IPANPSISYTLNHCKTNTS 58

Query: 66  ITVIDSDADCI--ILNGQKISSQSSFFKKTTQFCDLFRQF-SKVYFLIETSNNIPTKAGL 122
           +  + ++   +   L G +    +   +K  +  + +  +  K  ++I T N  P  +G+
Sbjct: 59  MEFVANEPFSVQTFLAGNEEVKFAEKIEKYFRNIEQYLPWILKGKYIIRTENTFPHSSGI 118

Query: 123 ASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT 175
           ASSASGF A+   L  +        S  E     S +ARLGSGSACRS Y G   W    
Sbjct: 119 ASSASGFGAIAKCLMALDASFTEKTSEEESLRKASFLARLGSGSACRSLYNGLVVWGETD 178

Query: 176 D-QNGMDSFAVP-----FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ 229
           + +   D F V       +  + +    +L I + +K + S          +P+  +  Q
Sbjct: 179 EVEESSDLFGVQYPDTEIHEIFKNFNDWVLLIHEGQKSVSSTVG-HGLMKTNPYAERRFQ 237

Query: 230 QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA 289
           +   +   +K+ + + D  +  ++ E  AL +HA M+ + P  +  +  T++ + ++WD 
Sbjct: 238 EARENFVPMKEILKNGDMERFIKLVEHEALTLHAMMMMSDPAFILMKTGTLEVINKIWDF 297

Query: 290 RQQ-SIPIYFTLDAGPNLKLLFTHK-IEETIKQFFPEITI 327
           R++   P++FTLDAG N+ LLF +   EE IK F     +
Sbjct: 298 RRETGSPLFFTLDAGANVHLLFPNNGSEEQIKAFIEAELL 337


>gi|307179520|gb|EFN67834.1| Diphosphomevalonate decarboxylase [Camponotus floridanus]
          Length = 373

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 98/306 (32%), Positives = 145/306 (47%), Gaps = 19/306 (6%)

Query: 39  GKRDSKLNLPLNNSLSLSLG--HLGTITHITVI-DSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD  L LP N+S+S +L    L   T + +  D   D I LNG++   ++   +   +
Sbjct: 5   GKRDESLILPTNDSISATLDIDQLHAKTSVMISLDFKEDHIWLNGREQDIKNPRLQNCLK 64

Query: 96  FCDLFRQFSKV----YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSR 151
                 Q           I + NN PT AGLASSA+G+A L  AL ++Y +      +S 
Sbjct: 65  EIKKRSQLPGYMNDWKIHICSKNNFPTAAGLASSAAGYACLATALAKLYKVE---GDISV 121

Query: 152 VARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIG 209
           +AR GSGSACRS + GF  W  G D+NG DS A      + WP++RI +L + D +KKI 
Sbjct: 122 IARSGSGSACRSIFGGFVRWHMGVDKNGADSIAKQIVPASHWPEMRILILVVTDEQKKIP 181

Query: 210 SREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
           S   M+ +   S F               ++QAII++DF    E+  K++ +MHA  +  
Sbjct: 182 SAIGMKRSMETSQFLQYRISHTVPERTNKMQQAIIEKDFKTFAELTMKDSNQMHAVCLDT 241

Query: 269 SPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQ----FF 322
            PP +Y    +   M  +         + + +T DAG N  L    K   T+      FF
Sbjct: 242 YPPCVYMNNISNSIMNLIHSYNDAVNDVKVAYTFDAGTNATLYLLEKDVPTVMGVLNYFF 301

Query: 323 PEITII 328
           P +  +
Sbjct: 302 PPVANV 307


>gi|310823053|ref|YP_003955411.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|309396125|gb|ADO73584.1| Diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 332

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 114/324 (35%), Positives = 174/324 (53%), Gaps = 11/324 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNG 80
           + K++A    NIAL KYWGKRD  L LP  +SLSL+L  +   T +    S AD + +NG
Sbjct: 4   SMKATALAHPNIALVKYWGKRDDALILPHQSSLSLTLSPMSVTTTVEFGAS-ADQVEING 62

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALF 137
              +++ S   +  +  +  +  +        + +  + P  AGLASSA+GFAAL +A  
Sbjct: 63  --HAAKGSERDRVLRVLEAVKAEAGGALGPARMVSRGDFPAAAGLASSAAGFAALAVAAR 120

Query: 138 RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPDLR 195
               +P   ++ S +ARLGSGSACRS   GFCEW  G   +G DSFAV       WP+LR
Sbjct: 121 AAAGLPADPQAASLLARLGSGSACRSIQGGFCEWRRGERDDGADSFAVQRFAEGHWPELR 180

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           + +  +   EK + SR+ M++T   SP++  W +    ++    + I  +D   LG ++E
Sbjct: 181 MVVAILNREEKAVKSRDGMKLTVETSPYYAAWAKDAEAEIPRAVELIQRKDLEGLGALSE 240

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +NA +MHAT  AA PPL Y    T+  +E + + R++  P++FTLDAGPN  LL     E
Sbjct: 241 RNAWRMHATAFAADPPLSYMHPSTLGLIEHLREQRKKGTPVWFTLDAGPNPVLLTDAAHE 300

Query: 316 ---ETIKQFFPEITIIDPLDSPDL 336
              E + +    + ++  +   D 
Sbjct: 301 VAAEALARACGAVDVVRCVPGGDA 324


>gi|71667345|ref|XP_820623.1| diphosphomevalonate decarboxylase [Trypanosoma cruzi strain CL
           Brener]
 gi|70885974|gb|EAN98772.1| diphosphomevalonate decarboxylase, putative [Trypanosoma cruzi]
          Length = 380

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 92/330 (27%), Positives = 152/330 (46%), Gaps = 23/330 (6%)

Query: 21  NEKSSAFLPSNIALCKYWGKR--DSKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADC 75
           N + +   P NIA  KYWGKR    KL LP N+S S++L      T T + + D  + D 
Sbjct: 3   NLQVTVEAPINIAFIKYWGKRAGGEKLILPANDSFSITLSTHPFRTKTSVVLRDDLEEDT 62

Query: 76  IILNGQKISSQSSFFKKTTQFCDLFR-----QFSKVYFLIETSNNIPTKAGLASSASGFA 130
           +I+NG+K   +S+   +     +  R     +       I + NN PT AG+ASSASG+ 
Sbjct: 63  LIINGEKSDVRST--PRIQSVLEYVRSTCPDELKNKRVYIVSENNFPTAAGMASSASGYC 120

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
           AL  AL R+++    + ++S +AR+GSGSACRS   GF  W  G  ++G D  A  F ++
Sbjct: 121 ALAAALVRVFN---STANVSMLARMGSGSACRSTLGGFVIWHKGEKEDGSDCVATQFVDE 177

Query: 191 --WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQIS-TDLAHIKQAIIDQDF 247
             WP++++    +   +K   S   M+ +   SP   +         +  + +AI  +DF
Sbjct: 178 NYWPEMQVLCAVLQGEKKNTSSTAGMQQSLQTSPLMPKRIATTVSERMRTVSEAIKARDF 237

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPN 305
               ++A   +  + A      P + Y  +++   +  V  ++A++    + +T DAG N
Sbjct: 238 YTFAQIAMSESDDLQAICATTQPQIQYATEDSYAMIRLVKTYNAKKGHPTLAYTFDAGAN 297

Query: 306 LKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
             L    K          +     P  S  
Sbjct: 298 CFLFVLEKDLPEAVAMLMQ---HFPTPSER 324


>gi|115377891|ref|ZP_01465077.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
 gi|115365106|gb|EAU64155.1| diphosphomevalonate decarboxylase [Stigmatella aurantiaca DW4/3-1]
          Length = 328

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 114/322 (35%), Positives = 173/322 (53%), Gaps = 11/322 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K++A    NIAL KYWGKRD  L LP  +SLSL+L  +   T +    S AD + +NG  
Sbjct: 2   KATALAHPNIALVKYWGKRDDALILPHQSSLSLTLSPMSVTTTVEFGAS-ADQVEING-- 58

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +++ S   +  +  +  +  +        + +  + P  AGLASSA+GFAAL +A    
Sbjct: 59  HAAKGSERDRVLRVLEAVKAEAGGALGPARMVSRGDFPAAAGLASSAAGFAALAVAARAA 118

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVP--FNNQWPDLRIG 197
             +P   ++ S +ARLGSGSACRS   GFCEW  G   +G DSFAV       WP+LR+ 
Sbjct: 119 AGLPADPQAASLLARLGSGSACRSIQGGFCEWRRGERDDGADSFAVQRFAEGHWPELRMV 178

Query: 198 LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKN 257
           +  +   EK + SR+ M++T   SP++  W +    ++    + I  +D   LG ++E+N
Sbjct: 179 VAILNREEKAVKSRDGMKLTVETSPYYAAWAKDAEAEIPRAVELIQRKDLEGLGALSERN 238

Query: 258 ALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE-- 315
           A +MHAT  AA PPL Y    T+  +E + + R++  P++FTLDAGPN  LL     E  
Sbjct: 239 AWRMHATAFAADPPLSYMHPSTLGLIEHLREQRKKGTPVWFTLDAGPNPVLLTDAAHEVA 298

Query: 316 -ETIKQFFPEITIIDPLDSPDL 336
            E + +    + ++  +   D 
Sbjct: 299 AEALARACGAVDVVRCVPGGDA 320


>gi|199598405|ref|ZP_03211824.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus rhamnosus
           HN001]
 gi|258508494|ref|YP_003171245.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
 gi|199590724|gb|EDY98811.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus rhamnosus
           HN001]
 gi|257148421|emb|CAR87394.1| Diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
 gi|259649804|dbj|BAI41966.1| diphosphomevalonate decarboxylase [Lactobacillus rhamnosus GG]
          Length = 334

 Score =  299 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 107/335 (31%), Positives = 169/335 (50%), Gaps = 14/335 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + +L LP  +S+SL+L    T T +T     + D + LN Q  S
Sbjct: 5   ARAHTNIALIKYWGKANKQLMLPATSSISLTLNDFYTDTAVTFDPELNQDQLTLNHQMQS 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R  +++     + + N++PT AGLASSAS FAAL LA  R   +
Sbjct: 65  PTA-----VSRFLDHVRHLAQIDTRARVTSLNHVPTAAGLASSASAFAALALAASRAAGL 119

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                +LSR+AR GSGSA RS + G   W  G+D     +  +      P LR+ ++ + 
Sbjct: 120 NLTPTALSRLARRGSGSATRSIFGGAVIWHRGSDDQSSFAEPLTIQPTLP-LRMLVVTVS 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SR  M  T   SP++  W Q     ++ +  A+ + D   +G + E ++++MH
Sbjct: 179 DQKKAVSSRTGMANTVATSPYYQAWVQSNEALISPMITALAENDLTTIGALTELSSMRMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 239 AAIMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTAPYVDVLMTAL 298

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
             +    I+     PD           N  E  I+
Sbjct: 299 QPVFGDRILSTRLGPDAQVITKEQF--NDTESAIT 331


>gi|303389554|ref|XP_003073009.1| mevalonate pyrophosphate decarboxylase [Encephalitozoon
           intestinalis ATCC 50506]
 gi|303302153|gb|ADM11649.1| mevalonate pyrophosphate decarboxylase [Encephalitozoon
           intestinalis ATCC 50506]
          Length = 302

 Score =  299 bits (766), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 95/307 (30%), Positives = 147/307 (47%), Gaps = 17/307 (5%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ 86
               NIA+ KYWGK D+  N P N+S+S  L +  T T +   +S  D   LNG+ +S  
Sbjct: 10  RSHPNIAVIKYWGKVDTINNTPSNSSVSFPLTNFQTETTVEYSNS--DRFYLNGEMLS-- 65

Query: 87  SSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
             F KK +Q  ++FR  S       + + NN P   GLASSASGFAAL LAL   Y +  
Sbjct: 66  --FGKKMSQVVEIFRTRSGDRRSICVRSFNNFPHSCGLASSASGFAALALALDDFYGLKT 123

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             E L R+AR+GSGSA RS   G   +         D   V     W +++I  + +   
Sbjct: 124 SEEELCRIARIGSGSAGRSISPGIHLF---------DGVFVEKLPSWREIKILSIVLSKD 174

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            KKIGS E M  TR  S F+ +   ++   +  + + I  +DF     +  + + + H  
Sbjct: 175 PKKIGSTEGMIRTRETSEFYQERLARMKEKVEAMAKCISQKDFDGFAYLTMRESNEFHGM 234

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           ++   PP+ Y + +  Q +E      +  + + +T DAGPN  ++   +  + +K FF  
Sbjct: 235 LMETYPPIRYIKDDGFQVIEMCHRFNRDKVRVAYTFDAGPNPFIITLEQYLKEVKDFFRA 294

Query: 325 ITIIDPL 331
             ++   
Sbjct: 295 YELVPCN 301


>gi|191638487|ref|YP_001987653.1| Diphosphomevalonate decarboxylase [Lactobacillus casei BL23]
 gi|190712789|emb|CAQ66795.1| Diphosphomevalonate decarboxylase [Lactobacillus casei BL23]
 gi|327382522|gb|AEA53998.1| NapT5 [Lactobacillus casei LC2W]
 gi|327385719|gb|AEA57193.1| NapT5 [Lactobacillus casei BD-II]
          Length = 334

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 104/326 (31%), Positives = 164/326 (50%), Gaps = 12/326 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +
Sbjct: 5   ARAHTNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNNDRFMLNGEEQN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +
Sbjct: 65  PVA-----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGL 119

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LSR+AR GSGSA RS + G   W  G D     +  +      P LR+ ++ + 
Sbjct: 120 NLSPTELSRLARRGSGSATRSIFGGAVIWHRGHDDASSFAEPLAIQPSLP-LRMLVVTVS 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MH
Sbjct: 179 AEKKAVSSRKGMANTVATSPYYEAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 239 AAIMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTEPYVDILLTAL 298

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQ 345
             +    I+     PD          
Sbjct: 299 RPVFGDRILSTRLGPDASIITKEQFD 324


>gi|71749102|ref|XP_827890.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70833274|gb|EAN78778.1| hypothetical protein, conserved [Trypanosoma brucei]
          Length = 382

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 149/336 (44%), Gaps = 19/336 (5%)

Query: 24  SSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
           ++   P NIA  KYWGKR+    L LP N+S S++L      + T + + D  + D + L
Sbjct: 6   ATVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL 65

Query: 79  NGQKIS-SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG ++   ++   +                    I + NN PT AG+ASSASG+ A++ A
Sbjct: 66  NGTEVDVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSAA 125

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R +     + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F +   WP+
Sbjct: 126 LIRAFK---STTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPE 182

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGE 252
           +++    +   +K + S + M+ +   SP   +   + +   +    +AI  +DF    E
Sbjct: 183 IQVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAE 242

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +A   +  +        P + Y  +++   +  V  ++A++    + +T DAG N  L  
Sbjct: 243 IAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFV 302

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
             +          E     P      +     L +K
Sbjct: 303 LKEDLPEAVAMLME---HFPTPFEKFFFGDRELLEK 335


>gi|268532738|ref|XP_002631497.1| Hypothetical protein CBG20661 [Caenorhabditis briggsae]
 gi|187022950|emb|CAP37628.1| hypothetical protein CBG_20661 [Caenorhabditis briggsae AF16]
          Length = 372

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 103/343 (30%), Positives = 167/343 (48%), Gaps = 21/343 (6%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADC 75
           N     + +  +P NIAL KYWGKRD +L LPLN+S+SL++  L   T + +I     + 
Sbjct: 4   NGAGVSEVTVRVPMNIALVKYWGKRDEQLILPLNDSISLTVDKLTAETTVRMIQVVGENT 63

Query: 76  IILNGQKISSQSSFF------------KKTTQFCDLFRQFS-KVYFLIETSNNIPTKAGL 122
           + +NG+++   S+              +K  +  +         +F + +  N P  AGL
Sbjct: 64  VEINGRRVELSSNKRYQTVFDEALRLQRKRKEDLNKNENKCITHHFEVISKTNFPVAAGL 123

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSA+GFAA+  A+ +I +        +R+AR+GSGSACRS + G   W  G  ++G D 
Sbjct: 124 ASSAAGFAAIARAIQKILN--LNDTQANRLARIGSGSACRSMFGGLVHWKKGEKEDGSDC 181

Query: 183 FAVPFNNQ-WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQ 240
            AV   ++ WPDL   +L   D  KK+GS E M  TR  S       +  +   +  +K+
Sbjct: 182 VAVKTESENWPDLYCIILVFNDERKKVGSSEGMRRTRETSTLLKHRIEYVVPERIEQVKK 241

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           A   ++F  L  V   ++ + HA  + + PP+ Y  + + + +E V    QQ +   +T 
Sbjct: 242 AYESRNFQDLARVIMADSNQFHAVCLDSIPPIRYLNESSWRLIELVEKFNQQEVKAAYTF 301

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSL 343
           DAGPN  ++        +  F   +     + S DL S ++ L
Sbjct: 302 DAGPNACVIVQKYD---VPAFIRTLLQDIIIPSEDLKSVEEEL 341


>gi|116494976|ref|YP_806710.1| mevalonate pyrophosphate decarboxylase [Lactobacillus casei ATCC
           334]
 gi|227535020|ref|ZP_03965069.1| possible diphosphomevalonate decarboxylase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|301066543|ref|YP_003788566.1| mevalonate pyrophosphate decarboxylase [Lactobacillus casei str.
           Zhang]
 gi|116105126|gb|ABJ70268.1| diphosphomevalonate decarboxylase [Lactobacillus casei ATCC 334]
 gi|227187335|gb|EEI67402.1| possible diphosphomevalonate decarboxylase [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|300438950|gb|ADK18716.1| Mevalonate pyrophosphate decarboxylase [Lactobacillus casei str.
           Zhang]
          Length = 334

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 104/326 (31%), Positives = 164/326 (50%), Gaps = 12/326 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +
Sbjct: 5   ARAHTNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNDDRFMLNGEEQN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +
Sbjct: 65  PVA-----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGL 119

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LSR+AR GSGSA RS + G   W  G D     +  +      P LR+ ++ + 
Sbjct: 120 NLSPTELSRLARRGSGSATRSIFGGAVIWHRGHDDASSFAEPLAIQPSLP-LRMLVVTVS 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MH
Sbjct: 179 AEKKAVSSRKGMANTVATSPYYDAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 239 AAIMAEEPPFTYFLPETLRAWQLVQEQRALGIPAFATMDAGPNVKILTTEPYVDILLTAL 298

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQ 345
             +    I+     PD          
Sbjct: 299 RPVFGDRILSTRLGPDASIITKEQFD 324


>gi|261333547|emb|CBH16542.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 382

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 147/336 (43%), Gaps = 19/336 (5%)

Query: 24  SSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
            +   P NIA  KYWGKR+    L LP N+S S++L      + T + + D  + D   L
Sbjct: 6   VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTFRL 65

Query: 79  NGQKIS-SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG ++   ++   +                    I + NN PT AG+ASSASG+ A++ A
Sbjct: 66  NGTEVDVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSAA 125

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R +     + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F +   WP+
Sbjct: 126 LIRAFK---STTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPE 182

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGE 252
           +++    +   +K + S + M+ +   SP   +   + +   +    +AI  +DF    E
Sbjct: 183 IQVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAE 242

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +A   +  +        P + Y  +++   +  V  ++A++    + +T DAG N  L  
Sbjct: 243 IAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFV 302

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
             +          E     P      +     L +K
Sbjct: 303 LKEDLPEAVAMLME---HFPTPFEKFFFGDRELLEK 335


>gi|228472590|ref|ZP_04057350.1| diphosphomevalonate decarboxylase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228276003|gb|EEK14759.1| diphosphomevalonate decarboxylase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 356

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 98/352 (27%), Positives = 155/352 (44%), Gaps = 30/352 (8%)

Query: 7   HILHRYIGECNPKINEKSSAF--LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
            ++ ++I +   +  E +       SNIAL KYWGKRD +  +P+N S+S +L H  T T
Sbjct: 1   MLVEKFIPKAYSERVEAAKVRHRAYSNIALVKYWGKRDEQ--IPMNPSISFTLSHSYTET 58

Query: 65  HITVIDSDADC------IILNGQKISSQ----SSFFKKTTQFCDLFRQFSKVYFLIETSN 114
            I +                + +   +      +FF +   +    R     YF+I +SN
Sbjct: 59  VIEMAPRTDFTSSFQIDFFFDEEPKDNFLPKIETFFTRIRNYIPFLRD---YYFVIRSSN 115

Query: 115 NIPTKAGLASSASGFAALTLALFRIYS-------IPEKSESLSRVARLGSGSACRSFYRG 167
           + P  AG+ASSAS  AAL + L +I +            E  S +ARLGSGSACRS Y G
Sbjct: 116 SFPHSAGIASSASAMAALAVCLMKIENLFDPEMTEQFFHEKASFLARLGSGSACRSTYSG 175

Query: 168 FCEWICGTD-QNGMDSFAVP---FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
              W   +      D + +P    +  +   +  +L I   +K + S +  ++   H P+
Sbjct: 176 VVLWGEHSAVMGSSDLYGIPMEDVHEVFNTYQDTILLIDKGQKPVSSTKGHQLMIGH-PY 234

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
                 Q    +A +K  +   D     ++ E  AL +HA M+ + P  L  +  TI  +
Sbjct: 235 AEARFLQAREHIAALKSILKKGDLEGFMDLVESEALALHAMMMTSDPYYLLMRPNTIAAI 294

Query: 284 ERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP 334
           E++W  R  +  P+ FTLDAG N+ LL+    +  I  F          D  
Sbjct: 295 EKIWYLRASTQKPLCFTLDAGANIHLLYPKAYKADIIPFIERELKPLCQDQE 346


>gi|149241991|pdb|2HKE|A Chain A, Mevalonate Diphosphate Decarboxylase From Trypanosoma
           Brucei
 gi|149241992|pdb|2HKE|B Chain B, Mevalonate Diphosphate Decarboxylase From Trypanosoma
           Brucei
          Length = 380

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 149/336 (44%), Gaps = 19/336 (5%)

Query: 24  SSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
            +   P NIA  KYWGKR+    L LP N+S S++L      + T + + D  + D + L
Sbjct: 6   VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL 65

Query: 79  NGQKIS-SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG ++   ++   +            +       I + NN PT AG+ASSASG+ A++ A
Sbjct: 66  NGTEVDVGKTPRVQSMLLHLRSTCPEELKNKKVNIVSENNFPTAAGMASSASGYCAMSAA 125

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R +     + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F +   WP+
Sbjct: 126 LIRAFK---STTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPE 182

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGE 252
           +++    +   +K + S + M+ +   SP   +   + +   +    +AI  +DF    E
Sbjct: 183 IQVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAE 242

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +A   +  +        P + Y  +++   +  V  ++A++    + +T DAG N  L  
Sbjct: 243 IAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFV 302

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
             +          E     P      +     L +K
Sbjct: 303 LKEDLPEAVAMLME---HFPTPFEKFFFGDRELLEK 335


>gi|71749002|ref|XP_827840.1| diphosphomevalonate decarboxylase [Trypanosoma brucei TREU927]
 gi|70833224|gb|EAN78728.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei]
          Length = 382

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 148/336 (44%), Gaps = 19/336 (5%)

Query: 24  SSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
            +   P NIA  KYWGKR+    L LP N+S S++L      + T + + D  + D + L
Sbjct: 6   VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL 65

Query: 79  NGQKIS-SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG ++   ++   +                    I + NN PT AG+ASSASG+ A++ A
Sbjct: 66  NGTEVDVGKTPRVQSMLLHLRSTCPEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSAA 125

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R +     + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F +   WP+
Sbjct: 126 LIRAFK---STTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPE 182

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGE 252
           +++    +   +K + S + M+ +   SP   +   + +   +    +AI  +DF    E
Sbjct: 183 IQVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAE 242

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +A   +  +        P + Y  +++   +  V  ++A++    + +T DAG N  L  
Sbjct: 243 IAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFV 302

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
             +          E     P      +     L +K
Sbjct: 303 LKEDLPEAVAMLME---HFPTPFEKFFFGDRELLEK 335


>gi|255535993|ref|YP_003096364.1| Diphosphomevalonate decarboxylase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342189|gb|ACU08302.1| Diphosphomevalonate decarboxylase [Flavobacteriaceae bacterium
           3519-10]
          Length = 359

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 98/341 (28%), Positives = 161/341 (47%), Gaps = 28/341 (8%)

Query: 9   LHRYIGECNPKIN-EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT 67
           +  +    + KI+  K +   PSNIAL KYWGK      +P N S+S +L +  T T I 
Sbjct: 10  MKEFFSTDSYKISDSKVTQSCPSNIALIKYWGKY--AGQIPANPSISYTLNNCKTNTSIE 67

Query: 68  VIDSDADCI--ILNGQKISSQSSFFKKTTQFCDLFRQFSKV----YFLIETSNNIPTKAG 121
            I ++   +   L+G +    + F +K  +F     Q+        ++I T N  P  +G
Sbjct: 68  FIANEKFSVQTFLSGNEE---AKFAEKIEKFFHTIEQYLPWILQGKYIITTQNTFPHSSG 124

Query: 122 LASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           +ASSASGF A+   L  +       +    K +  S +ARLGSGSA RS Y G   W   
Sbjct: 125 IASSASGFGAIAKCLMDLDEQFSAPHGCDFKLKKASFLARLGSGSAGRSLYDGLVVWGKT 184

Query: 175 TD-QNGMDSFAVPF-----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT 228
            +     D FAVP+     ++ +      +L I + EK + S        + +P+  +  
Sbjct: 185 DEVAGSSDLFAVPYPENEVHSVFRSFNDWVLLIHEGEKSVSSTIG-HSLMNTNPYAERRF 243

Query: 229 QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD 288
           QQ   +   +K  +   D     ++ E  AL +HA M+ + P  +  +  T+  + ++W+
Sbjct: 244 QQAHENFTLLKDILKTGDLAAFIKLVEHEALTLHAMMMMSDPAFILMKTGTLNVIHKIWE 303

Query: 289 ARQQ-SIPIYFTLDAGPNLKLLFTHK-IEETIKQFFPEITI 327
            R++  +P++FTLDAG N+ LLF     E+ IK+F     +
Sbjct: 304 FREKTGLPLFFTLDAGANVHLLFPANTDEDNIKEFITRELL 344


>gi|261333631|emb|CBH16626.1| diphosphomevalonate decarboxylase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 382

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 148/336 (44%), Gaps = 19/336 (5%)

Query: 24  SSAFLPSNIALCKYWGKRD--SKLNLPLNNSLSLSLGH--LGTITHITVIDS-DADCIIL 78
            +   P NIA  KYWGKR+    L LP N+S S++L      + T + + D  + D + L
Sbjct: 6   VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL 65

Query: 79  NGQKIS-SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           NG ++   ++   +                    I + NN PT AG+ASSASG+ A++ A
Sbjct: 66  NGTEVDVGKTPRVQSMLLHLRITCPEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSAA 125

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPD 193
           L R +     + ++S +ARLGSGSACRS + GF  W  G   +G D  A  F +   WP+
Sbjct: 126 LIRAFK---STTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPE 182

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAIIDQDFIKLGE 252
           +++    +   +K + S + M+ +   SP   +   + +   +    +AI  +DF    E
Sbjct: 183 IQVMCAILKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAE 242

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPNLKLLF 310
           +A   +  +        P + Y  +++   +  V  ++A++    + +T DAG N  L  
Sbjct: 243 IAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFV 302

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQK 346
             +          E     P      +     L +K
Sbjct: 303 LKEDLPEAVAMLME---HFPTPFEKFFFGDRELLEK 335


>gi|254787175|ref|YP_003074604.1| diphosphomevalonate decarboxylase [Teredinibacter turnerae T7901]
 gi|237684278|gb|ACR11542.1| diphosphomevalonate decarboxylase [Teredinibacter turnerae T7901]
          Length = 335

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 107/313 (34%), Positives = 166/313 (53%), Gaps = 14/313 (4%)

Query: 23  KSSAFLPSNIALCKYWGKR-DSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNG 80
           +++A    NIAL KYWGK  ++  N P  +SLS++L  L T T +T   +   D + LNG
Sbjct: 8   QATAIAHPNIALIKYWGKAENTTANEPAVSSLSITLDELATRTTLTFDTAYKTDRLTLNG 67

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +  +++     + +    + RQ + +     I+TSNN PT AGLASSASGFAAL +A  +
Sbjct: 68  KPDTAK---LPRISSALSVMRQLAGITTPCHIDTSNNFPTGAGLASSASGFAALVVAANQ 124

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF------AVPFNNQWP 192
              +    +  S++AR  SGSA RS + GF +      Q     F       V   + WP
Sbjct: 125 ALDLNLSLQQQSKLARAMSGSAARSLFGGFAKIYLPHAQLEPAPFGANYAEPVAPADHWP 184

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
            L + +  + + EK IGS   ME +R+ SP+++ W      D+ + +  +  +DF KL E
Sbjct: 185 -LEVCVGVVSEEEKAIGSTAGMENSRNTSPYYSAWIAGNDADVINAEALVKARDFDKLAE 243

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           ++E + LKMHA  +A+ P LLYW   T+  M  +   R +  P++FT+DAGP +K +   
Sbjct: 244 LSEFSCLKMHALALASRPALLYWSGATMDAMRAIQRWRAEGTPVFFTVDAGPQIKAICAP 303

Query: 313 KIEETIKQFFPEI 325
              E + Q   E+
Sbjct: 304 GYGELVAQRLSEL 316


>gi|239631424|ref|ZP_04674455.1| diphosphomevalonate decarboxylase [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525889|gb|EEQ64890.1| diphosphomevalonate decarboxylase [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 334

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 104/326 (31%), Positives = 164/326 (50%), Gaps = 12/326 (3%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKIS 84
           A   +NIAL KYWGK + KL LP  +S+SL+L    T T +T   S + D  +LNG++ +
Sbjct: 5   ARAHTNIALIKYWGKANRKLMLPATSSISLTLNDFYTDTAVTFDPSLNDDRFMLNGEEQN 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
             +      ++F D  R   K+  Y  + + N++PT AGLASSAS FAAL  A  R   +
Sbjct: 65  PVA-----VSRFLDRVRHLGKISTYAQVTSLNHVPTAAGLASSASAFAALATAASRAAGL 119

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                 LSR+AR GSGSA RS + G   W  G D     +  +      P LR+ ++ + 
Sbjct: 120 NLSPTELSRLARRGSGSATRSIFGGAVIWHRGHDDTSSFAEPLAIQPSLP-LRMLVVTVS 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K + SR+ M  T   SP++  W     + +  +  A+ + D   +G++ E ++++MH
Sbjct: 179 AEKKAVSSRKGMANTVATSPYYDAWVASNESLIEPMITALAEDDLALIGKLTELSSMRMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A ++A  PP  Y+  ET++  + V + R   IP + T+DAGPN+K+L T    + +    
Sbjct: 239 AAIMAEEPPFTYFLPETLRTWQLVQEQRALGIPAFATMDAGPNVKILTTEPYVDILLTAL 298

Query: 323 PEI---TIIDPLDSPDLWSTKDSLSQ 345
             +    I+     PD          
Sbjct: 299 RPVFGDRILSTRLGPDASIITKEQFD 324


>gi|312088278|ref|XP_003145798.1| diphosphomevalonate decarboxylase [Loa loa]
 gi|307759036|gb|EFO18270.1| diphosphomevalonate decarboxylase [Loa loa]
          Length = 314

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 98/314 (31%), Positives = 144/314 (45%), Gaps = 20/314 (6%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-D 72
            + N    ++     P NIAL KYWGKR+  L LPLN+S+SLS+  L   T I +  S  
Sbjct: 4   SDGNDNFVQEVKVVAPINIALVKYWGKRNEDLMLPLNDSISLSINDLCAKTRIRIGPSIK 63

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAAL 132
            D +++NG  I                +  F +  F + +  + P +AGLASSASGFAA+
Sbjct: 64  KDSVLINGSNI------------CLSKYPGFLRC-FKVVSETSFPIEAGLASSASGFAAI 110

Query: 133 TLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQ 190
              L ++Y        + RVAR+GSGSACRS   G   W  GT ++G D     V   + 
Sbjct: 111 AYGLGQVYH--LNINDVIRVARMGSGSACRSILSGLVHWKAGTAEDGADCICETVFPEDY 168

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKL 250
           WP LR  +L      KK+GS   M+ T   S         +   +  +K A  ++DF K 
Sbjct: 169 WPTLRSLILVTSYDPKKVGSSNGMQSTVKTSKLLQARMDIVPEQITKLKNAFRNRDFEKF 228

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKL 308
            +V   ++ ++HA  +   P L Y    +   M+ +    +  +S  + +T DAGPN  L
Sbjct: 229 AQVIMSDSGQLHALCMDTMPSLRYLNNHSWYFMQLIHALNRHCKSTKVAYTFDAGPNCCL 288

Query: 309 LFTHKIEETIKQFF 322
                    I    
Sbjct: 289 FLESINVPLILAAI 302


>gi|332638892|ref|ZP_08417755.1| diphosphomevalonate decarboxylase [Weissella cibaria KACC 11862]
          Length = 328

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 110/323 (34%), Positives = 170/323 (52%), Gaps = 10/323 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A   +NIAL KYWGK D+ L LP   S+SL+L    T T +    +  AD + L+ + +
Sbjct: 5   TARAHTNIALLKYWGKADTTLMLPTTTSISLTLDEFYTDTTVWFDAALIADDVTLDDEVM 64

Query: 84  SSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           + +   + K T+F DL R+ +    Y  + ++N++PT AGLASSAS FAAL  A  R   
Sbjct: 65  TGKG--YDKVTRFLDLVREMAGETRYAHVHSANHVPTAAGLASSASAFAALAGAASRAAG 122

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      LSR+AR GSGSA RS + GF +W  G D     +  +     WP +++  + I
Sbjct: 123 LALSPAELSRLARRGSGSASRSIFGGFAQWDRGHDDLTSVAKPLVETIDWP-IQLLTVII 181

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D+ KKI SR  M+  +  SPF+  W  + +  +  ++ A+ + D  ++G++AE NAL+M
Sbjct: 182 NDQPKKIDSRGGMQHAKATSPFYDDWVNRSNALVPVMQTAVANHDIDQIGQLAEANALQM 241

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI--- 318
           HAT   A P   Y    + Q +      R+Q I +Y T+DAGPN+KL+      E I   
Sbjct: 242 HATNATAQPAFNYLTDSSWQVINLATTLREQGISVYATMDAGPNVKLISRPADTEVITAA 301

Query: 319 -KQFFPEITIIDPLDSPDLWSTK 340
             +  P + +      P +   +
Sbjct: 302 LAEAIPGVVVRTATPGPSIKIVE 324


>gi|322391508|ref|ZP_08064977.1| diphosphomevalonate decarboxylase [Streptococcus peroris ATCC
           700780]
 gi|321145591|gb|EFX40983.1| diphosphomevalonate decarboxylase [Streptococcus peroris ATCC
           700780]
          Length = 317

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 99/315 (31%), Positives = 164/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            +    +NIA+ KYWGK++ K  +P  +S+SL+L ++ T T ++    D+ AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKNEKEMVPATSSISLTLENMYTETTLSPLPTDAKADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K ++  D +R     +  I+T NN+PT AGL+SS+SG +AL       + 
Sbjct: 66  LQN--EAEHAKMSKIIDRYRPEGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKVCNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +    + L+  A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLNRKELALEAKFASGSSSRSFYGPLAAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL M
Sbjct: 177 EDQKKPISSRDGMKLCVETSTTFEDWVRQSEQDYKDMLSYLKENDFKKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A+P   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HATTKTATPSFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCLEEDLEHLSEL 296

Query: 322 FPEITIIDPLDSPDL 336
             +   +    + DL
Sbjct: 297 LGQRYRLIVSKTKDL 311


>gi|306828924|ref|ZP_07462116.1| diphosphomevalonate decarboxylase [Streptococcus mitis ATCC 6249]
 gi|304429102|gb|EFM32190.1| diphosphomevalonate decarboxylase [Streptococcus mitis ATCC 6249]
          Length = 317

 Score =  295 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 165/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQ 81
            +    +NIA+ KYWGKR  K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKRKEKEMVPATSSISLTLENMYTETTLSPLPAHATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQN--EAEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ E+NAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFTKVGELTEENALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    T + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + 
Sbjct: 237 HATTKTASPAFSYLTDATYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLSEL 296

Query: 322 FPEITIIDPLDSPDL 336
             +   +    + DL
Sbjct: 297 LGQRYRLIVSKTKDL 311


>gi|219114256|ref|XP_002176299.1| MPDC mevalonate diphosphate decarboxylase [Phaeodactylum
           tricornutum CCAP 1055/1]
 gi|217402702|gb|EEC42691.1| MPDC mevalonate diphosphate decarboxylase [Phaeodactylum
           tricornutum CCAP 1055/1]
          Length = 415

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 96/357 (26%), Positives = 152/357 (42%), Gaps = 38/357 (10%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSL--GHLGTITHITVI- 69
           +          ++   P+NIA+ KYWGK D   N P+N+S S++L    L  +T + V  
Sbjct: 1   MTTPATHPIFLATVSAPTNIAVVKYWGKADEHYNTPINSSCSVTLHQDDLRAVTTVAVSK 60

Query: 70  DSDADCIILNGQKISSQSSFFKKTTQFCD-----------------------LFRQFSKV 106
           D   D + LNG ++   ++  ++     D                          ++  +
Sbjct: 61  DFVQDRLWLNGVEVPHAAT-SRRFRACVDGVLALAPDKYHTDDDNNNKTVAIAQHEWPTL 119

Query: 107 YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS-IPEKSESLSRVARLGSGSACRSFY 165
           +  + + N  PT AGLASSA+G+AAL  AL ++           S +AR GSGSACRS Y
Sbjct: 120 HVHVSSYNTFPTAAGLASSAAGYAALVAALVQLTGATETFPGEFSTLARQGSGSACRSLY 179

Query: 166 RGFCEWICGTDQNGM-DSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSP 222
            G   W  GT      DS A    ++  WP LR  +  + D +K   S   M+ +   SP
Sbjct: 180 GGLVAWHAGTADEQWRDSRAEQLADEASWPALRAVIAVVSDAQKDTASTAGMQASVKTSP 239

Query: 223 FFTQWTQQ-ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQ 281
                    +   +  + QA   +DF   G++  +++ + HAT +   PP+ Y    + Q
Sbjct: 240 LLAFRAAHVVPQRMQELTQAWRRRDFPVFGKITMQDSNQFHATCLDTYPPIFYMNDVSRQ 299

Query: 282 GMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKI----EETIKQFFPEITIIDPLD 332
            +  V         I   +TLDAGPN+ L             ++ FFP   + +  D
Sbjct: 300 IIRIVTAYNDYAGEIRAAYTLDAGPNVVLYVLEPHRPVLAALLRHFFPASGLEEQND 356


>gi|194397794|ref|YP_002037062.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae G54]
 gi|194357461|gb|ACF55909.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae G54]
          Length = 317

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 100/317 (31%), Positives = 164/317 (51%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   A P   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTARPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|293364808|ref|ZP_06611525.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|307703057|ref|ZP_07640004.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|291316258|gb|EFE56694.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
 gi|307623450|gb|EFO02440.1| diphosphomevalonate decarboxylase [Streptococcus oralis ATCC 35037]
          Length = 317

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 166/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K ++  + +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQN--EAEHAKISKIINRYRPEGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    +++  + + V  +     L + +L +
Sbjct: 124 LGLDRSQLAQEAKFASGSSSRSFYGPLGAW----NKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFTKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + 
Sbjct: 237 HATTKTASPAFSYLTDASYEAMDFVHQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FGQRYRLIVSKTKDL 311


>gi|116515775|ref|YP_815860.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae D39]
 gi|148994466|ref|ZP_01823667.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP9-BS68]
 gi|148996793|ref|ZP_01824511.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|149006134|ref|ZP_01829863.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|168488079|ref|ZP_02712278.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae SP195]
 gi|168494575|ref|ZP_02718718.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC3059-06]
 gi|168576777|ref|ZP_02722635.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           MLV-016]
 gi|225856119|ref|YP_002737630.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae P1031]
 gi|225858237|ref|YP_002739747.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 70585]
 gi|307067038|ref|YP_003876004.1| mevalonate pyrophosphate decarboxylase [Streptococcus pneumoniae
           AP200]
 gi|307126594|ref|YP_003878625.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 670-6B]
 gi|116076351|gb|ABJ54071.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae D39]
 gi|147757368|gb|EDK64407.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP11-BS70]
 gi|147762490|gb|EDK69451.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP18-BS74]
 gi|147927215|gb|EDK78250.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP9-BS68]
 gi|183572899|gb|EDT93427.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae SP195]
 gi|183575493|gb|EDT96021.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC3059-06]
 gi|183577536|gb|EDT98064.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           MLV-016]
 gi|225722154|gb|ACO18008.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 70585]
 gi|225724934|gb|ACO20786.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae P1031]
 gi|306408575|gb|ADM84002.1| Mevalonate pyrophosphate decarboxylase [Streptococcus pneumoniae
           AP200]
 gi|306483656|gb|ADM90525.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae 670-6B]
 gi|332076822|gb|EGI87284.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA17545]
 gi|332077670|gb|EGI88131.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA41301]
          Length = 317

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|83596054|gb|ABC25412.1| mevalonate diphosphate decarboxylase [uncultured marine bacterium
           Ant39E11]
          Length = 338

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 87/326 (26%), Positives = 147/326 (45%), Gaps = 23/326 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           +   PSNIAL KYWGK   +  LP N S+S +L +  + T +++ +     + LNG    
Sbjct: 4   TWSSPSNIALVKYWGKHGQQ--LPSNPSISFTLSNCRSTTSMSLKEGKGFTVALNG---V 58

Query: 85  SQSSFFKKTTQFCDLFRQ----FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
            + +F  K   + D            +  IE+SN+ P  +G+ASSAS F+A+ L L    
Sbjct: 59  DKPAFAAKIQTWFDRIDDRLPWLKDHHVTIESSNSFPHSSGIASSASAFSAMALCLLDHA 118

Query: 141 SI-------PEKSESLSRVARLGSGSACRSFYRGFCEWI-----CGTDQNGMDSFAVPFN 188
                     +  +  S +ARLGSGSA RS   G   W       G+  N    +    +
Sbjct: 119 RKAGLSTMSSDFIQEASLLARLGSGSASRSVMGGLVVWGVHKGTPGSSDNHAIPYPHEVH 178

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
                 +  +L +   +K + S    E+   H PF     +Q   ++  ++  +   D  
Sbjct: 179 PDMMSYQDLVLLVDVGQKSVSSSAGHELMAKH-PFAATRFEQAHHNMDALQGILKTGDHW 237

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLK 307
              ++ E  AL +H  M+ +SP  L  +  T+  ++R+   RQ+  +P+ FTLDAG N+ 
Sbjct: 238 AFIDLIESEALTLHGLMMNSSPSYLLMKPNTLAIIQRIRQFRQEKQVPVGFTLDAGANVH 297

Query: 308 LLFTHKIEETIKQFFPEITIIDPLDS 333
           +L+   ++ T++ F  +       D 
Sbjct: 298 MLYPESLKSTVESFANDQLKSLCKDG 323


>gi|15902383|ref|NP_357933.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae R6]
 gi|15457897|gb|AAK99143.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae R6]
          Length = 344

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 31  EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 90

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 91  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 148

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 149 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 201

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 202 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 261

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 262 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 321

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 322 EIFGQRYRLIVSKTKDL 338


>gi|225853957|ref|YP_002735469.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae JJA]
 gi|225724271|gb|ACO20124.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae JJA]
          Length = 317

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEYLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|322387266|ref|ZP_08060876.1| diphosphomevalonate decarboxylase [Streptococcus infantis ATCC
           700779]
 gi|321141795|gb|EFX37290.1| diphosphomevalonate decarboxylase [Streptococcus infantis ATCC
           700779]
          Length = 317

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 100/315 (31%), Positives = 163/315 (51%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKAEKEMVPATSSISLTLENMYTETTLSPLPADATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K  +  D +R     +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQN--EAEHAKMRKIIDRYRPEGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L+  A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLNRRELALEAKFASGSSSRSFYGPLAAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F +W +Q   D   +   + + DF K+GE+ EKNAL M
Sbjct: 177 EDQKKPISSRDGMKLCVETSTTFDEWIRQSEQDYKDMLVYLKENDFKKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A+P   Y    + + M+ V   R++    YFT+DAGPN+K+L   K  E + + 
Sbjct: 237 HATTKTATPSFSYLTDASYEAMDFVRQLREKGESCYFTMDAGPNVKVLCLEKDFEHLSEL 296

Query: 322 FPEITIIDPLDSPDL 336
             +   +    + DL
Sbjct: 297 LGQRYRLIVSKTKDL 311


>gi|322377082|ref|ZP_08051574.1| diphosphomevalonate decarboxylase [Streptococcus sp. M334]
 gi|321281795|gb|EFX58803.1| diphosphomevalonate decarboxylase [Streptococcus sp. M334]
          Length = 344

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 31  EPVTVRSYANIAIIKYWGKKQEKEMVPATSSISLTLENMYTETTLSPLPTDATADVFYIN 90

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 91  GQLQN--EAEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 148

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 149 FQLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 201

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D  ++   +   DF K+GE+ EKNAL
Sbjct: 202 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQNMLVYLKGNDFAKVGELTEKNAL 261

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 262 AMHATTKTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLS 321

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 322 EIFGQRYRLIVSKTKDL 338


>gi|307704244|ref|ZP_07641163.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK597]
 gi|307622155|gb|EFO01173.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK597]
          Length = 312

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQN--EAEHAKMSKIIDRYRPDGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FQLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVLCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EMFGQRYRLIVSKTKDL 311


>gi|307711407|ref|ZP_07647823.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK321]
 gi|307616780|gb|EFN95964.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK321]
          Length = 317

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 104/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDAKADAFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQN--EAEHAKMSKIIDRYRPAGEGFIRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFTKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|313206136|ref|YP_004045313.1| ghmp kinase [Riemerella anatipestifer DSM 15868]
 gi|312445452|gb|ADQ81807.1| GHMP kinase [Riemerella anatipestifer DSM 15868]
 gi|315022943|gb|EFT35966.1| diphosphomevalonate decarboxylase [Riemerella anatipestifer RA-YM]
 gi|325336419|gb|ADZ12693.1| diphosphomevalonate decarboxylase [Riemerella anatipestifer RA-GD]
          Length = 352

 Score =  293 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 96/340 (28%), Positives = 161/340 (47%), Gaps = 23/340 (6%)

Query: 8   ILHRYIGECNPKINE-KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI 66
           +L +++G  N ++   + S   PSNIAL KYWGK      +P N S+S +L +  T T+I
Sbjct: 1   MLEQFLGTPNFEVKNIQVSETCPSNIALIKYWGKY--AQQIPANPSISFTLNNAKTTTNI 58

Query: 67  TVIDSDADCI--ILNGQKISSQSSFFKKTTQFCDLFRQF-SKVYFLIETSNNIPTKAGLA 123
               +    +   L G++ +  SS  +K  +  + +  +     + I T N  P  +G+A
Sbjct: 59  VFNANKPFGVKTYLAGKEETQFSSKIEKYFKTIESYLPWILSGSYEIRTENTFPHSSGIA 118

Query: 124 SSASGFAALTLALF--------RIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT 175
           SSASGF A+   L            +   + +  S +ARLGSGSACRS Y G   W    
Sbjct: 119 SSASGFGAIAKCLMKIDEAFSKEATTHDFRLKKASFLARLGSGSACRSLYNGLVVWGETP 178

Query: 176 DQN-GMDSFAVPF-----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ 229
           +     D FAVP+        +      +L I + +K + S        + +P+  +  Q
Sbjct: 179 EVEGSSDLFAVPYTTEEVAEVFRKFNDWVLLIHEGQKSVSSTIG-HGLMNTNPYAERRFQ 237

Query: 230 QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA 289
           +   +   +K+ +   D  K   + E  AL +HA M+ + P  +  +  T++ + ++W+ 
Sbjct: 238 EARENFVPLKEILKSGDLEKFITLVEHEALTLHAMMMMSEPAFILMKTGTLEVINKIWEF 297

Query: 290 RQQ-SIPIYFTLDAGPNLKLLFTHKIE-ETIKQFFPEITI 327
           R+   +P++FTLDAG N+ LLF    E E I  F  +  +
Sbjct: 298 RKSTGLPLFFTLDAGANVHLLFPENQETEKITAFIEKELL 337


>gi|270293343|ref|ZP_06199552.1| diphosphomevalonate decarboxylase [Streptococcus sp. M143]
 gi|270278192|gb|EFA24040.1| diphosphomevalonate decarboxylase [Streptococcus sp. M143]
          Length = 317

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 103/315 (32%), Positives = 166/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQS--EAEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLNRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENDFAKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HATTKTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEEDLEHLSEI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FGQRYRLIVSKTKDL 311


>gi|148983786|ref|ZP_01817105.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP3-BS71]
 gi|168490698|ref|ZP_02714841.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC0288-04]
 gi|225860414|ref|YP_002741923.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|9937408|gb|AAG02456.1|AF290099_2 mevalonate diphosphate decarboxylase [Streptococcus pneumoniae]
 gi|147923933|gb|EDK75045.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP3-BS71]
 gi|183574929|gb|EDT95457.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC0288-04]
 gi|225726850|gb|ACO22701.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|301799492|emb|CBW32038.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           OXC141]
 gi|332203548|gb|EGJ17615.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA47368]
          Length = 317

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 164/317 (51%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|116618481|ref|YP_818852.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116097328|gb|ABJ62479.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 313

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 166/318 (52%), Gaps = 17/318 (5%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISS 85
           A   +NIAL KYWGK++++LNLP  +SLSL+L    T T +    ++ D  ILN Q + +
Sbjct: 3   ATAHTNIALIKYWGKKNTELNLPTTSSLSLTLDKFYTTTSVE--PANHDRFILNDQVVDA 60

Query: 86  QSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
                 +  +F D+ RQ         + + N++PT AGLASSAS FAALT A+     + 
Sbjct: 61  T-----RVHRFLDILRQQLGDFTPLQVISENHVPTSAGLASSASAFAALTGAVTHELGMD 115

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID 203
              E LSR+AR GSGSA RSF+  F  W  G D     SFA   N     + + + ++ D
Sbjct: 116 LPKEELSRLARRGSGSASRSFFGNFAMWHKGIDDAS--SFAESLNAPELPIALVVAEVCD 173

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KKI S E M+     SP + +W  + +     ++ AI+DQD  K+G +AE NAL MHA
Sbjct: 174 APKKITSTEGMKRAI-TSPNYDRWLSKSANQFIDMQHAILDQDIDKIGALAEDNALGMHA 232

Query: 264 TMIAAS-PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK--- 319
             + A+  P  Y+  +T   +  + D R Q I  Y T+DAGPN+K++ T +    I    
Sbjct: 233 LNLTATRSPFTYFTDKTQLILSLIQDMRHQGILAYATIDAGPNVKIITTTQEAPKIVTIL 292

Query: 320 -QFFPEITIIDPLDSPDL 336
               P + +      P +
Sbjct: 293 NHAIPSLKLEIAQSGPGI 310


>gi|148988141|ref|ZP_01819604.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP6-BS73]
 gi|149003484|ref|ZP_01828358.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS69]
 gi|149012126|ref|ZP_01833235.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP19-BS75]
 gi|149018080|ref|ZP_01834539.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP23-BS72]
 gi|169832809|ref|YP_001693894.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182683347|ref|YP_001835094.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae CGSP14]
 gi|221231253|ref|YP_002510405.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae ATCC
           700669]
 gi|237649354|ref|ZP_04523606.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae CCRI
           1974]
 gi|237821528|ref|ZP_04597373.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae CCRI
           1974M2]
 gi|298230946|ref|ZP_06964627.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298254647|ref|ZP_06978233.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298502182|ref|YP_003724122.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303255734|ref|ZP_07341777.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           BS455]
 gi|303259457|ref|ZP_07345434.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP-BS293]
 gi|303262988|ref|ZP_07348922.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS292]
 gi|303263541|ref|ZP_07349464.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS397]
 gi|303267345|ref|ZP_07353204.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS457]
 gi|303269850|ref|ZP_07355595.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS458]
 gi|147758420|gb|EDK65419.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS69]
 gi|147763728|gb|EDK70662.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP19-BS75]
 gi|147926605|gb|EDK77678.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147931644|gb|EDK82622.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP23-BS72]
 gi|168995311|gb|ACA35923.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           Hungary19A-6]
 gi|182628681|gb|ACB89629.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae CGSP14]
 gi|220673713|emb|CAR68209.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae ATCC
           700669]
 gi|298237777|gb|ADI68908.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301801297|emb|CBW33977.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           INV200]
 gi|302597294|gb|EFL64397.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           BS455]
 gi|302635879|gb|EFL66380.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639391|gb|EFL69849.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           SP-BS293]
 gi|302640618|gb|EFL71020.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS458]
 gi|302643116|gb|EFL73404.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS457]
 gi|302647314|gb|EFL77538.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae BS397]
 gi|332202288|gb|EGJ16357.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA41317]
          Length = 317

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 99/303 (32%), Positives = 160/303 (52%), Gaps = 11/303 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFF 322
           + F
Sbjct: 295 EIF 297


>gi|301793630|emb|CBW36013.1| mevalonate diphosphate decarboxylase [Streptococcus pneumoniae
           INV104]
          Length = 317

 Score =  292 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + ++  AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVIADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + ++V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYSVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|323127095|gb|ADX24392.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 314

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 104/316 (32%), Positives = 170/316 (53%), Gaps = 11/316 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQK 82
           +    +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +     +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKEDQSKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYINGCL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +     K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QDDKE--HAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGSA RSF+     W    D++  D + V   +    + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSASRSFFGPVAAW----DKDSGDIYKV---DTDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D +K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MH
Sbjct: 178 DAKKPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F
Sbjct: 238 ATTKTANPSFSYLTDESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARF 297

Query: 323 PEITIIDPLDSPDLWS 338
            +   I    + DL  
Sbjct: 298 EKDYRIIVSKTKDLPD 313


>gi|306825826|ref|ZP_07459165.1| diphosphomevalonate decarboxylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432187|gb|EFM35164.1| diphosphomevalonate decarboxylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 317

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 104/317 (32%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPKDATADAFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  S   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQS--EAEHAKMSKIIDRYRPAGEGFVRIDTHNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FQLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + +F K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLLYLKENNFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    T + M  V   R Q    YFT+DAGPN+K+L   K  + + 
Sbjct: 235 AMHATTKTASPAFSYLTDATYEAMNFVRQLRGQGEACYFTMDAGPNVKVLCQEKDLDHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|262037204|ref|ZP_06010691.1| diphosphomevalonate decarboxylase [Leptotrichia goodfellowii F0264]
 gi|261748803|gb|EEY36155.1| diphosphomevalonate decarboxylase [Leptotrichia goodfellowii F0264]
          Length = 313

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 105/309 (33%), Positives = 176/309 (56%), Gaps = 9/309 (2%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKIS 84
           S    +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T I+ I+S+ D   LNG    
Sbjct: 5   SVRSYANIAIIKYWGKKDAKNMIPATSSISLTLENMYTDTEISFIESETDVFYLNGVLQD 64

Query: 85  SQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
           S+ +  +K ++  DLFR+  +   LI++ NN+PT+AGL+SS+SG +AL  A  +++    
Sbjct: 65  SKQT--EKISKVVDLFRENKEQKVLIKSENNMPTEAGLSSSSSGLSALIKACNKLFRKNM 122

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
               L+R+++ GSGS+ RSF+     W    D++  + + +  +     L + +L + + 
Sbjct: 123 TRTELARISKYGSGSSARSFFGPIGAW----DKDTGEIYEIKTD---LKLAMIMLVLNEE 175

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
           +K I SRE M++    S  F +W +    +   +K+A+ + +F K+GE+ EKNAL MH T
Sbjct: 176 KKIISSREGMKLCGETSTIFDKWIKNSEIEYEEMKKALAENNFEKVGELTEKNALAMHET 235

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
            + A+PP  Y   ++ + ME V   R+     YFT+DAGPN+K+L   K  E +K    +
Sbjct: 236 TLYANPPFSYLTDKSREAMEFVKKLRKSGEKCYFTMDAGPNVKVLCLEKDFEKLKYVLGK 295

Query: 325 ITIIDPLDS 333
              I    +
Sbjct: 296 KYKIIASKT 304


>gi|325954729|ref|YP_004238389.1| diphosphomevalonate decarboxylase [Weeksella virosa DSM 16922]
 gi|323437347|gb|ADX67811.1| diphosphomevalonate decarboxylase [Weeksella virosa DSM 16922]
          Length = 354

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 89/349 (25%), Positives = 157/349 (44%), Gaps = 31/349 (8%)

Query: 10  HRYIGECNPKINEKS---SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI 66
            ++I E    I   +    +  PSNIAL KYWGKR  +  +P N S+S +L +  T T +
Sbjct: 3   QQFISELPANIVFSAGSVKSKSPSNIALIKYWGKR--ENQIPTNASISYTLTNSYTETEL 60

Query: 67  TVIDSDADCI----ILNGQKISSQSSFFKKTTQFCD----LFRQFSKVYFLIETSNNIPT 118
                  +       L+    + Q++F  K  QF +          +  F + T N+ P 
Sbjct: 61  KFEPKSGNDFDVKVFLD---KNLQTNFAPKIIQFFERIEAYMPFLRRFRFEVHTHNSFPH 117

Query: 119 KAGLASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEW 171
            +G+ASSASG +A+   L ++        +  +     S +ARLGSGSACRS Y+G   W
Sbjct: 118 SSGIASSASGMSAMANCLIKMEKLLGSSLNEEQAHRKASFLARLGSGSACRSTYKGLVVW 177

Query: 172 ICGTD-QNGMDSFAV-----PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT 225
                  N  + +A+       ++ +      +L I + EK + S    +      P+  
Sbjct: 178 GENKALPNSSNLYAIKYPNQQIHSVFIHFHDTILLIHEGEKSVSSTVGHQ-LMDRHPYAE 236

Query: 226 QWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER 285
           +   + + +L  +   + + D    G++ E  AL +HA M+ + P  +  + +T+  ++ 
Sbjct: 237 KRFIEANKNLEKLLPILKNGDVFAFGKMVEHEALTLHAMMMTSDPAFMLMKPQTVAAIDS 296

Query: 286 VWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           +W  R++   P++FTLDAG N+ LL+   I + + +F            
Sbjct: 297 IWAYRKKTGNPLFFTLDAGANIHLLYPDDIAKEVHEFIKNELKQFCEKG 345


>gi|315612568|ref|ZP_07887481.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis ATCC
           49296]
 gi|315315549|gb|EFU63588.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis ATCC
           49296]
          Length = 317

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 103/315 (32%), Positives = 165/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPTDATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQS--EAEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLNRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LRLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF  +GE+ EKNAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFANVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + 
Sbjct: 237 HATTKTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FGQRYRLIVSKTKDL 311


>gi|168482616|ref|ZP_02707568.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1873-00]
 gi|168485524|ref|ZP_02710032.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1087-00]
 gi|172043858|gb|EDT51904.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1873-00]
 gi|183571122|gb|EDT91650.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           CDC1087-00]
          Length = 317

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + ++V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYSVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|15900305|ref|NP_344909.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae TIGR4]
 gi|111657160|ref|ZP_01407940.1| hypothetical protein SpneT_02001625 [Streptococcus pneumoniae
           TIGR4]
 gi|14971852|gb|AAK74549.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae TIGR4]
          Length = 317

 Score =  291 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 99/303 (32%), Positives = 159/303 (52%), Gaps = 11/303 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEVE--HAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M  V   R++    YFT+DAGPN+K+    K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLS 294

Query: 320 QFF 322
           + F
Sbjct: 295 EIF 297


>gi|222152927|ref|YP_002562104.1| mevalonate diphosphate decarboxylase [Streptococcus uberis 0140J]
 gi|222113740|emb|CAR41735.1| mevalonate diphosphate decarboxylase [Streptococcus uberis 0140J]
          Length = 314

 Score =  291 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 100/318 (31%), Positives = 162/318 (50%), Gaps = 11/318 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIIL 78
            +  +    +NIA+ KYWGK + +  +P  +S+SL+L ++ T T +  +D     D   +
Sbjct: 3   PKTVTVKSYANIAIIKYWGKENQEKMIPSTSSISLTLENMYTETSLKRLDHGAQKDLFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +           +K +   D FR     +  + T NN+PT AGL+SS+SG +AL  A   
Sbjct: 63  DDHLQDQAE--HQKISAIIDQFRTDKNQFVEVRTRNNMPTAAGLSSSSSGLSALVKACNL 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
            +      + L++ A+  SGSA RSF+     W    D++  D + V  +     L + +
Sbjct: 121 FFDCRLNQKELAQKAKFASGSASRSFFGPLSAW----DKDSGDIYQVETD---LKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + D  K I SRE M++ R  S  F QW QQ   D   +   + + DF K+G++ EKNA
Sbjct: 174 LVVNDARKPISSREGMKLCRETSTTFDQWIQQSEQDYQEMLLYLKNNDFEKVGQLTEKNA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MHAT   A P   Y  +++ Q M++V   R++    YFT+DAGPN+K+L   K  +++
Sbjct: 234 LAMHATTRTAKPSFSYLTEDSYQAMDKVKALREEGFQCYFTMDAGPNVKVLCLEKDLDSL 293

Query: 319 KQFFPEITIIDPLDSPDL 336
            + F E   I    + ++
Sbjct: 294 SKRFAEDYSIIVSKTKEI 311


>gi|195978204|ref|YP_002123448.1| diphosphomevalonate decarboxylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195974909|gb|ACG62435.1| diphosphomevalonate decarboxylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 314

 Score =  291 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 106/321 (33%), Positives = 165/321 (51%), Gaps = 11/321 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIIL 78
           +   +    +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ +   +  D   +
Sbjct: 3   SNTVTVTSYANIAIVKYWGKKDEVKMIPSTSSISLTLEGMYTTTSLSFLPPSAKGDQFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           NG    ++     K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +
Sbjct: 63  NGVLQDAKE--HAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
           ++      E L++ A+  SGSA RSF+     W    D++    + V  +     L + +
Sbjct: 121 LFQAKLSQEELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVKTD---LKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + D  K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NA
Sbjct: 174 LVLNDARKPISSREGMKRCSTTSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MHAT   ASP   Y  + + Q M RV + RQ+  P YFT+DAGPN+K+L   +  E +
Sbjct: 234 LAMHATTKTASPSFSYLTEASYQAMLRVKELRQKGYPCYFTMDAGPNVKVLCLEEDLERL 293

Query: 319 KQFFPEITIIDPLDSPDLWST 339
            + F +   I    + +L   
Sbjct: 294 SRLFEKEYRIIASKTKELPDV 314


>gi|225870468|ref|YP_002746415.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           equi 4047]
 gi|225699872|emb|CAW93759.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           equi 4047]
          Length = 314

 Score =  291 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 105/321 (32%), Positives = 162/321 (50%), Gaps = 11/321 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIIL 78
           +   +    +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ + +    D   +
Sbjct: 3   SNTVTVTSYANIAIVKYWGKKDEAKMIPSTSSISLTLEGMYTTTSLSFLPASAKGDQFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           NG    ++     K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +
Sbjct: 63  NGVLQDAKE--HAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
           ++      E L++ A+  SGSA RSF+     W    D++    + V  +     L + +
Sbjct: 121 LFQAKLSQEELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVKTD---LKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + D  K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NA
Sbjct: 174 LVLNDARKPISSREGMKRCSATSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MHAT   ASP   Y  + + Q M RV + RQ+    YFT+DAGPN+K+L   +  E +
Sbjct: 234 LAMHATTKTASPSFSYLTEASYQAMLRVKELRQEGYSCYFTMDAGPNVKVLCLEEDLERL 293

Query: 319 KQFFPEITIIDPLDSPDLWST 339
              F     I    + +L   
Sbjct: 294 SHLFEREYRIIASKTKELPDV 314


>gi|322374889|ref|ZP_08049403.1| diphosphomevalonate decarboxylase [Streptococcus sp. C300]
 gi|321280389|gb|EFX57428.1| diphosphomevalonate decarboxylase [Streptococcus sp. C300]
          Length = 317

 Score =  291 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 166/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQ 81
            +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPAHATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K ++  + +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQN--EAEHAKMSKIINRYRPEGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLNRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + DF K+GE+ EKNAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFGDWVRQSEKDYQDMLVYLKENDFAKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + + 
Sbjct: 237 HATTKTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLSEI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FGQRYRLIVSKTKDL 311


>gi|225868463|ref|YP_002744411.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701739|emb|CAW99107.1| mevalonate diphosphate decarboxylase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 314

 Score =  291 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 106/321 (33%), Positives = 165/321 (51%), Gaps = 11/321 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIIL 78
           +   +    +NIA+ KYWGK+D    +P  +S+SL+L  + T T ++ + +    D   +
Sbjct: 3   SNTVTVTSYANIAIVKYWGKKDEAKMIPSTSSISLTLEGMYTTTSLSFLPASAKGDQFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           NG    ++     K T   D FRQ  + +  +E SN++PT AGL+SS+SG +AL  A  +
Sbjct: 63  NGVLQDAKE--HAKITAILDQFRQKDQTFVKVEASNSMPTAAGLSSSSSGLSALVKACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
           ++      E L++ A+  SGSA RSF+     W    D++    + V  +     L + +
Sbjct: 121 LFQAKLSQEELAQKAKFASGSASRSFFGPVAAW----DKDTGSIYKVKTD---LKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + D  K I SRE M+     S  F QW  Q  +D   + +A+ D DF  +G + E NA
Sbjct: 174 LVLNDARKPISSREGMKRCSTTSTSFDQWLAQSESDYQAMLRALSDNDFETVGWLTEANA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MHAT   ASP   Y  + + Q M RV + RQ+  P YFT+DAGPN+K+L   +  E +
Sbjct: 234 LAMHATTKTASPSFSYLTEASYQAMLRVKELRQKGYPCYFTMDAGPNVKVLCLEEDLERL 293

Query: 319 KQFFPEITIIDPLDSPDLWST 339
            + F +   I    + +L   
Sbjct: 294 SRLFEKEYRIIASKTKELPDV 314


>gi|326469867|gb|EGD93876.1| diphosphomevalonate decarboxylase [Trichophyton tonsurans CBS
           112818]
          Length = 380

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 102/363 (28%), Positives = 159/363 (43%), Gaps = 46/363 (12%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH--LGTITHITVI- 69
           +   N +   ++S+  P NIA+ KYWGKRD+ LNLP N+SLS++L    L   T  +   
Sbjct: 1   MAAANDQRVYRASSTAPVNIAVIKYWGKRDATLNLPTNSSLSVTLSQSSLRAYTTASCSA 60

Query: 70  ---DSDADCIILNGQKISSQS------------SFFKKTTQFCDLFRQFSKVYFLIETSN 114
               +D D + LN +  S Q             S  +          + S     I + N
Sbjct: 61  KYPPADGDSLTLNNKPHSIQGSPRTLACLADLRSLRQLIESSDPSLPKLSTYPLRIVSEN 120

Query: 115 NIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICG 174
           N PT AGLASSA+GFAAL  A+  +Y +P+ +  LS++AR GSGSACRS   G+      
Sbjct: 121 NFPTAAGLASSAAGFAALVRAVADLYQLPQSASELSKIARKGSGSACRSLMGGYPLARDA 180

Query: 175 TDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-ST 233
           +  +G                          K++ S E M++T   S  F    Q I   
Sbjct: 181 SSYSGGQW--------------------CHRKEVPSSECMQLTVATSTLFPSRAQSIVPE 220

Query: 234 DLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDA-RQQ 292
            +  I+++I +++F    E+  +++   HAT +   PP  Y    +   +  V D  R  
Sbjct: 221 RMTAIEKSIQERNFETFAEITMRDSNGFHATNLDTWPPTFYLNDTSRAAIRAVHDLNRAA 280

Query: 293 SIPIY-FTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIEL 351
              +  +T DAGPN  + +  K  + +   F  I       + + W + +     NS+E 
Sbjct: 281 GRSVCAYTFDAGPNAVIYYLEKDADCVLGAFKSIL----TSATEGWESANIK-NTNSLEQ 335

Query: 352 GIS 354
            I 
Sbjct: 336 SID 338


>gi|331266992|ref|YP_004326622.1| diphosphomevalonate decarboxylase [Streptococcus oralis Uo5]
 gi|326683664|emb|CBZ01282.1| diphosphomevalonate decarboxylase [Streptococcus oralis Uo5]
          Length = 317

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 166/315 (52%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQ 81
            +    +NIA+ KYWGKR  K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ
Sbjct: 6   VTVRSYANIAIIKYWGKRKEKEMVPATSSISLTLENMYTETTLSPLQAHATADAFYINGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +   +   K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQN--EAEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNSYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L +
Sbjct: 124 LGLDRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K I SR+ M++    S  F  W +Q   D   +   + + +F K+GE+ EKNAL M
Sbjct: 177 EDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENNFAKVGELTEKNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   ASP   Y    T + M+ V   R+Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HATTKTASPAFSYLTDATYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEEDLEHLSEI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FGQRYRLIVSKTKDL 311


>gi|323342435|ref|ZP_08082667.1| diphosphomevalonate decarboxylase [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463547|gb|EFY08741.1| diphosphomevalonate decarboxylase [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 321

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 112/314 (35%), Positives = 173/314 (55%), Gaps = 13/314 (4%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +    +NIAL KYWGK+D++L +P N+SLSL+L    T T +    +   D  IL+G  +
Sbjct: 9   TVRAHTNIALIKYWGKKDNELKIPHNSSLSLTLDQFYTETSVDYDSALTEDVFILDGVLV 68

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +     +   + +  R+   +  +  I ++N +P  AGLASSAS FAAL  A     +
Sbjct: 69  EGKEK--DRVVWYMNALRECYDIPSFARIHSTNAVPKAAGLASSASAFAALAKAATLHLN 126

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN-NQWPDLRIGLLK 200
                E +SR ARLGSGSA RS Y GF  W  GT    +DSFA P   N WP+ R+ +  
Sbjct: 127 --LSDEEVSRCARLGSGSASRSIYGGFVRWNRGTGD--LDSFAQPIAMNPWPEFRMIVCI 182

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           + D+EK   S +AM  T   S ++  W +Q   D+  ++QA+ D D   +G +A+ NAL+
Sbjct: 183 LNDQEKPFLSSQAMNTTVESSVYYPAWVEQTEKDIVLLEQALKDHDIWTVGAIAQGNALR 242

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHA+++A +  + Y++ +T++ M +V    Q+SIP +FT+DAGPN+K++ T    + I  
Sbjct: 243 MHASLMAVN--MWYFEPQTVEIMNKVRTL-QKSIPAFFTMDAGPNVKIMTTSDHVDAILN 299

Query: 321 FFPEITIIDPLDSP 334
               I  +      
Sbjct: 300 ELEGINTVVCAPGV 313


>gi|289168578|ref|YP_003446847.1| mevalonate pyrophosphate decarboxylase [Streptococcus mitis B6]
 gi|288908145|emb|CBJ22986.1| mevalonate pyrophosphate decarboxylase [Streptococcus mitis B6]
          Length = 317

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 163/317 (51%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  +       K ++  D +R     +  I+T N++PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQNEAEHV--KMSKIIDRYRPDGDGFVRIDTQNSMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V        L + +L
Sbjct: 122 FKLGLNRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETG---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   +   DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKANDFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|315225772|ref|ZP_07867560.1| diphosphomevalonate decarboxylase [Parascardovia denticolens DSM
           10105]
 gi|315119904|gb|EFT83036.1| diphosphomevalonate decarboxylase [Parascardovia denticolens DSM
           10105]
          Length = 358

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 116/323 (35%), Positives = 166/323 (51%), Gaps = 24/323 (7%)

Query: 34  LCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKT 93
           L KYWGKRD KL LP++ SLSL+L  L T T +          +L+GQ+   ++   K+ 
Sbjct: 19  LIKYWGKRDEKLILPISPSLSLTLDSLYTDTALMPSSDGRWHFVLDGQEQGGEA--LKRV 76

Query: 94  TQFCDLFR----------QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS-- 141
             F  +F             +     I + N++PT AGLASS+S FAAL  AL   +   
Sbjct: 77  VDFARIFPVSATAPIPSTPAAATPLTIISHNHVPTAAGLASSSSAFAALAWALRDYFGLA 136

Query: 142 ------IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
                      ++LS  AR GSGSA RS + GF EW  G  ++G DSFA P ++   DL 
Sbjct: 137 GPGRDGRSLSDQALSACARQGSGSATRSIFGGFVEWTYGQREDGADSFARPIDDGEWDLG 196

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + +   +KKI SR  M+ T   S F+  W Q    DL  + + I ++D   +G+  E
Sbjct: 197 LIAVALSTGKKKISSRAGMKHTAETSAFYPLWRQASERDLQRVLEGIANRDVDLIGQAME 256

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
            NA+K HATM +A PPL Y    + + +E VW  RQ+ +  YFT+DAGPN+K+L      
Sbjct: 257 ANAMKFHATMFSADPPLTYLTARSWEVIEFVWAMRQEGVSAYFTMDAGPNVKILCRKSQM 316

Query: 316 ETI----KQFFPEITIIDPLDSP 334
           E I    ++ FP+  +      P
Sbjct: 317 EEISRRLRERFPQAALFQSTSGP 339


>gi|307192094|gb|EFN75436.1| Diphosphomevalonate decarboxylase [Harpegnathos saltator]
          Length = 411

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 94/295 (31%), Positives = 137/295 (46%), Gaps = 14/295 (4%)

Query: 39  GKRDSKLNLPLNNSLSLSLG--HLGTITHITVID-SDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD  L LP+N+S+S +L    L   T + +      DCI LN +K   ++   +    
Sbjct: 44  GKRDESLILPVNDSISATLDTEQLHAKTTVMISQHFKEDCIWLNERKEDIKNPRLQNCLN 103

Query: 96  FCDLFRQFSK----VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSR 151
                 Q S         I + NN PT AGLASSA+G+A LT AL ++Y +      +S 
Sbjct: 104 EIRSRSQLSGHMNDWKIHICSKNNFPTAAGLASSAAGYACLTAALTKLYKVE---GDISL 160

Query: 152 VARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIG 209
           +AR GSGSACRS   GF  W  G D+ GMDS A      + WP++RI L+ +   +KK+ 
Sbjct: 161 IARSGSGSACRSIMGGFVRWHMGMDKYGMDSLAKQIVPASHWPEMRILLIVVNSEQKKVS 220

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           S   M+ +   S F       +      ++ AII ++F    E+  K++ +MHA      
Sbjct: 221 STIGMKRSMETSEFMQHRIANVPEKADKMQCAIIQKNFKTFAELTMKDSNQMHAVCQDTY 280

Query: 270 PPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           PP +Y    +   +  +         I + +T DAGPN  L    K    I    
Sbjct: 281 PPCVYMNDVSHSIVNFIHSYNDAMNDIKVAYTYDAGPNATLYLMEKDVPGIIGVL 335


>gi|322411585|gb|EFY02493.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 314

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 105/316 (33%), Positives = 170/316 (53%), Gaps = 11/316 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQK 82
           +    +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +     +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKEDQTKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYINGCL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +     K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QDDKE--HAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGSA RSF+     W    D+N  D + V   +    + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSASRSFFGPVAAW----DKNSGDIYKV---DTDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D +K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MH
Sbjct: 178 DAKKPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F
Sbjct: 238 ATTKTANPSFSYLADESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARF 297

Query: 323 PEITIIDPLDSPDLWS 338
            +   I    + DL  
Sbjct: 298 EKDYRIVVSKTKDLPD 313


>gi|251782245|ref|YP_002996547.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242390874|dbj|BAH81333.1| diphosphomevalonate decarboxylase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
          Length = 314

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 103/316 (32%), Positives = 169/316 (53%), Gaps = 11/316 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQK 82
           +    +NIA+ KYWGK D    +P  +S+SL+L ++ T T ++ +     +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKEDQSKMIPSTSSISLTLENMFTTTSVSFLPDTASSDQFYINGCL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +     K +   D FR+ ++ +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QDDKE--HAKISAIIDQFRKPNQPFVKVETQNNMPTAAGLSSSSSGLSALVKACDQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGSA RSF+     W    D++  D + V   +    + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSASRSFFGPVAAW----DKDSGDIYKV---DTDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D +K I SR+ M++ R  S  F +W ++ + D  ++   +   DF K+G++AE NAL MH
Sbjct: 178 DAKKPISSRDGMKLCRETSTTFDEWIEKSAVDYQNMLTYLKANDFEKVGQLAESNALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
            T   A+P   Y   E+ Q ME V   RQ+    YFT+DAGPN+K+L   K  ET+   F
Sbjct: 238 TTTKTANPSFSYLTDESYQAMEAVKQLRQEGFSCYFTMDAGPNVKVLCLEKDLETLAARF 297

Query: 323 PEITIIDPLDSPDLWS 338
            +   I    + DL  
Sbjct: 298 EKDYRIIVSKTKDLPD 313


>gi|227431888|ref|ZP_03913911.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|227352355|gb|EEJ42558.1| diphosphomevalonate decarboxylase [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 313

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 168/318 (52%), Gaps = 17/318 (5%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISS 85
           A + +NIAL KYWGK++++LNLP  +SLSL+L    T T +    ++ DC ILN Q + +
Sbjct: 3   ATVHTNIALIKYWGKKNTELNLPTTSSLSLTLDKFYTTTSVE--PANHDCFILNDQVVDA 60

Query: 86  QSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP 143
                 +  +F D+ RQ         + + N++PT AGLASSAS FAALT A+     + 
Sbjct: 61  T-----RVHRFLDILRQQLGDFTPLQVISENHVPTSAGLASSASAFAALTGAVTHELGMD 115

Query: 144 EKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIID 203
              E LSR+AR GSGSA RSF+  F  W  G D     SFA   N     + + + ++ D
Sbjct: 116 LPKEELSRLARRGSGSASRSFFGNFAMWHKGIDDAS--SFAESLNAPELPIALVVAEVCD 173

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             KKI S E M+     SP + +W  + +     ++ AI+DQD  K+G +AE NAL MHA
Sbjct: 174 APKKITSTEGMKRAI-TSPNYDRWLSKSANQFIDMQHAILDQDIDKIGALAEDNALGMHA 232

Query: 264 TMIAAS-PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK--- 319
             + A+  P  Y+  +T   +  + D R Q I  Y T+DAGPN+K++ T +    I    
Sbjct: 233 LNLTATRSPFTYFTDKTQLILSLIQDMRHQGILAYATIDAGPNVKIITTTQEAPKIVTML 292

Query: 320 -QFFPEITIIDPLDSPDL 336
               P + +      P +
Sbjct: 293 NHAIPSLKLEIAQSGPGI 310


>gi|307710529|ref|ZP_07646965.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK564]
 gi|307618682|gb|EFN97822.1| diphosphomevalonate decarboxylase [Streptococcus mitis SK564]
          Length = 317

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 160/301 (53%), Gaps = 11/301 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T ++    D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSSLPTDATADAFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            Q  +   +   K ++  D +R     +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  DQLQN--EAEHAKMSKIIDRYRPAGGGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FQLGLTRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W +Q   D   +   + + DF+K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLVYLKENDFVKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREQGEACYFTMDAGPNVKVLCQEKDLEHLS 294

Query: 320 Q 320
           +
Sbjct: 295 E 295


>gi|332363140|gb|EGJ40925.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK49]
          Length = 315

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIIKYWGKKDAERMIPSTSSISLTLENMYTETQLSPLPDTATEDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|324994264|gb|EGC26178.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK678]
 gi|325697895|gb|EGD39779.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK160]
          Length = 315

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 102/317 (32%), Positives = 170/317 (53%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILN 79
           +  S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++
Sbjct: 4   KSVSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATEDEFYID 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +    +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L
Sbjct: 122 FQTGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL
Sbjct: 175 VLHDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFTKVGQLTEENAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + + 
Sbjct: 235 RMHATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLV 294

Query: 320 QFFPEITIIDPLDSPDL 336
             F +   +    + DL
Sbjct: 295 AIFEKDYRLIVSKTKDL 311


>gi|312865317|ref|ZP_07725545.1| diphosphomevalonate decarboxylase [Streptococcus downei F0415]
 gi|311099428|gb|EFQ57644.1| diphosphomevalonate decarboxylase [Streptococcus downei F0415]
          Length = 314

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 166/305 (54%), Gaps = 11/305 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILN 79
           +  S    +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++ +  +   D   ++
Sbjct: 4   KSVSVKSYANIAIVKYWGKADAKKMIPATSSISLTLENMYTKTDLSFLPEEARGDEFYID 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   S Q     K T   D FR+  + +  IETSNN+PT AGL+SS+SG +AL  A  ++
Sbjct: 64  GVLQSPQEHV--KMTTIIDFFRKEGQPFVKIETSNNMPTAAGLSSSSSGLSALVKACNQL 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +      + L++ A+  SGS+ RSF+     W    D++  + + V  +    DL + +L
Sbjct: 122 FDFGLNQKELTQYAKFASGSSARSFFGPLSAW----DKDSGEIYQVKTD---LDLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D+ K I SRE M+     S  F  W +Q   D   +   +   DF K+G++AE+NAL
Sbjct: 175 VLNDQPKTISSREGMKRCAETSSDFQDWVEQSVFDYKAMLGYLAANDFAKVGQLAEENAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHAT  +A PP  Y  +E+ Q M+ V    +Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 RMHATTRSAHPPFSYLTEESYQAMDFVRSLHEQGYDCYFTMDAGPNVKVLCQTKDLEKLA 294

Query: 320 QFFPE 324
           Q   +
Sbjct: 295 QILGQ 299


>gi|327459082|gb|EGF05430.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1057]
          Length = 315

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 168/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSLAE--HAKISRIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M  V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMNAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|322386747|ref|ZP_08060371.1| diphosphomevalonate decarboxylase [Streptococcus cristatus ATCC
           51100]
 gi|321269029|gb|EFX51965.1| diphosphomevalonate decarboxylase [Streptococcus cristatus ATCC
           51100]
          Length = 315

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 102/318 (32%), Positives = 166/318 (52%), Gaps = 11/318 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++    ++  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKADAERMIPSTSSISLTLENMYTQTQLSPLSAEAAGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S +     K ++  D FR     +  I+TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPEE--HAKVSRIIDRFRTEPSDWVRIDTSNNMPTAAGLSSSSSGLSALVKACDAYFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
               +E L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TNYNTEELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR  M++    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRLGMQLCSETSKDFQAWIDQSAQDYQDMLAYLKDNDFEKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A+PP  Y  +E+   M+ V   R Q    YFT+DAGPN+K+L   +  E +   
Sbjct: 237 HATTETATPPFTYLTEESYAAMDFVRQLRDQGRRCYFTMDAGPNVKVLCLEENLEDLVPL 296

Query: 322 FPEITIIDPLDSPDLWST 339
           F +   +    + +L   
Sbjct: 297 FADQYRLIVSKTKELPDG 314


>gi|54024177|ref|YP_118419.1| putative diphosphomevalonate decarboxylase [Nocardia farcinica IFM
           10152]
 gi|54015685|dbj|BAD57055.1| putative diphosphomevalonate decarboxylase [Nocardia farcinica IFM
           10152]
          Length = 346

 Score =  289 bits (739), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 114/291 (39%), Positives = 163/291 (56%), Gaps = 7/291 (2%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSS 88
             NIAL KYWGKRD    LP+  SLSL++    T T + +ID  AD + L+G+  S    
Sbjct: 24  HPNIALIKYWGKRDETAVLPVTASLSLTVNIFPTTTAVALIDGPADIVTLDGKPASG--P 81

Query: 89  FFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKS 146
              +  +F DL R  +      ++ + N+ PT AGLASSASGFAAL  A   ++ +   +
Sbjct: 82  ALARVVRFLDLVRARAGRADRVMVISVNSGPTGAGLASSASGFAALAAAAATVFGLDRDA 141

Query: 147 ESLSRVARLGSGSACRSFYRGFCEWICGT---DQNGMDSFAVPFNNQWPDLRIGLLKIID 203
            SLSR+AR GSGSACRS + GF  W  G    +   + S+A P  +   D  + +  +  
Sbjct: 142 RSLSRLARRGSGSACRSIFGGFAVWHAGEGLGEAGDLGSYAEPVEDGGLDPALVVAVVDA 201

Query: 204 REKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHA 263
             K + SREAM  TR  SP +  W    +TDL  ++ A+   D  ++GE+AE+NAL MHA
Sbjct: 202 AAKAVSSREAMRRTRATSPLYGAWAASSATDLTRMRAALARGDLAEVGEIAERNALGMHA 261

Query: 264 TMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKI 314
           TM+AA P + Y    ++  ++RV   R + +P Y T+DAGPN+K+L     
Sbjct: 262 TMLAARPAIRYLSPHSLAVLDRVLALRAEGVPAYATMDAGPNVKILCARAD 312


>gi|324992168|gb|EGC24090.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK405]
 gi|327459484|gb|EGF05830.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1]
 gi|327472892|gb|EGF18319.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK408]
 gi|327490683|gb|EGF22464.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1058]
          Length = 315

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 103/315 (32%), Positives = 168/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTKTQLSPLPDTATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              ++E L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTEELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWITQSALDYQAMLGYLRDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y   E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTDESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|332364384|gb|EGJ42158.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK355]
          Length = 315

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 104/315 (33%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              ++E L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTEELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   I    + DL
Sbjct: 297 FEKDYRIIVSKTKDL 311


>gi|19074299|ref|NP_585805.1| MEVALONATE PYROPHOSPHATE DECARBOXYLASE [Encephalitozoon cuniculi
           GB-M1]
 gi|19068941|emb|CAD25409.1| MEVALONATE PYROPHOSPHATE DECARBOXYLASE [Encephalitozoon cuniculi
           GB-M1]
          Length = 303

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 85/304 (27%), Positives = 136/304 (44%), Gaps = 12/304 (3%)

Query: 28  LPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQS 87
              NIA+ KYWGK D+  N+P + S+S  L +  T T +     + D   LNG+ +    
Sbjct: 11  SHPNIAVIKYWGKADTINNMPSSRSISFPLTNFLTETVVEHS-LEEDRFYLNGKMLPIGE 69

Query: 88  SFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
              +    F    +        I + +N P   GLASSASG AAL LAL   Y +    E
Sbjct: 70  KMGRAVEIF--RKKSGDDRPVCIRSFSNFPHSCGLASSASGLAALVLALNDFYGLDMPEE 127

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            L   AR+GSGSA RS   G   +         D  +V     W ++RI  + +    KK
Sbjct: 128 ELCIAARIGSGSAGRSISTGIHLF---------DGMSVERLPSWKEVRILSIILSGDCKK 178

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
            GS E M  T+  S F+ +   +I   +  + Q I  +DF     +  + + ++HA ++ 
Sbjct: 179 TGSTEGMIRTKETSNFYQERLARIERKIKAMVQYISQKDFDGFAHLTMRESNELHAILME 238

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITI 327
             PP+ Y + +  + +E   +  +    + +T DAGPN  L+   +    ++ FF    +
Sbjct: 239 TYPPIRYIRDDGFKVIEMCHEFNRDRTRVAYTFDAGPNPFLITLEQHLHAVEDFFKAYEL 298

Query: 328 IDPL 331
           +   
Sbjct: 299 VPCN 302


>gi|294786239|ref|ZP_06751493.1| diphosphomevalonate decarboxylase [Parascardovia denticolens F0305]
 gi|294485072|gb|EFG32706.1| diphosphomevalonate decarboxylase [Parascardovia denticolens F0305]
          Length = 340

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 115/322 (35%), Positives = 165/322 (51%), Gaps = 24/322 (7%)

Query: 35  CKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTT 94
            KYWGKRD KL LP++ SLSL+L  L T T +          +L+GQ+   ++   K+  
Sbjct: 2   IKYWGKRDEKLILPISPSLSLTLDSLYTDTALMPSSDGRWHFVLDGQEQGGEA--LKRVV 59

Query: 95  QFCDLFR----------QFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS--- 141
            F  +F             +     I + N++PT AGLASS+S FAAL  AL   +    
Sbjct: 60  DFARIFPVSATAPIPSTPAAATPLTIISHNHVPTAAGLASSSSAFAALAWALRDYFGLAG 119

Query: 142 -----IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRI 196
                     ++LS  AR GSGSA RS + GF EW  G  ++G DSFA P ++   DL +
Sbjct: 120 PGRDGRSLSDQALSACARQGSGSATRSIFGGFVEWTYGQREDGADSFARPIDDGEWDLGL 179

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
             + +   +KKI SR  M+ T   S F+  W Q    DL  + + I ++D   +G+  E 
Sbjct: 180 IAVALSTGKKKISSRAGMKHTAETSAFYPLWRQASERDLQRVLEGIANRDVDLIGQAMEA 239

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NA+K HATM +A PPL Y    + + +E VW  RQ+ +  YFT+DAGPN+K+L      E
Sbjct: 240 NAMKFHATMFSADPPLTYLTARSWEVIEFVWAMRQEGVSAYFTMDAGPNVKILCRKSQME 299

Query: 317 TI----KQFFPEITIIDPLDSP 334
            I    ++ FP+  +      P
Sbjct: 300 EISRRLRERFPQAALFQSTSGP 321


>gi|327468608|gb|EGF14087.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK330]
          Length = 315

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 170/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGVIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF+K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWITQSALDYQAMLGYLRDNDFVKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|159898136|ref|YP_001544383.1| diphosphomevalonate decarboxylase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159891175|gb|ABX04255.1| diphosphomevalonate decarboxylase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 334

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 99/335 (29%), Positives = 164/335 (48%), Gaps = 14/335 (4%)

Query: 18  PKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCI 76
            +++  ++A   +NIA  KYWG+ DS+L LP N S+S++L    T T +  +  +  D +
Sbjct: 2   KQLSHAATAVACANIAFIKYWGQHDSQLTLPTNGSISMNLDGCLTETTVQCLPEAVDDSV 61

Query: 77  IL---NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAA 131
            L    G+++ ++   F++  Q  +  RQ + V     + + NN P+ AG+ASSA+ FAA
Sbjct: 62  WLALSGGEEVQAKGRQFERVIQQIERLRQLAGVTERVEVRSRNNFPSDAGIASSAAAFAA 121

Query: 132 LTLALFRIYSIPEKSESLSRVARL-GSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ 190
           LT A    + +      LSR+ RL GSGSACRS   GF EW       G  +  +     
Sbjct: 122 LTRAAASAFRLELDEAELSRLTRLSGSGSACRSIPAGFVEWYNDGTHAGSYAAQIAPPEH 181

Query: 191 WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKL 250
           W +L   +  I    K + S          SP+F+   + I   LA ++Q I+++D  +L
Sbjct: 182 W-NLVDIVAVISTEAKHVASTSG-HSVATTSPYFSVRLEGIEQRLADVRQGILERDIERL 239

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQSIPIYFTLDAGPNLKLL 309
           G  +E +A+ MH   + A P  +YW   T+  M+ V   R Q ++  Y+T+DAGPN+ ++
Sbjct: 240 GRASEADAMSMHVIAMTAQPSTMYWLPGTLAVMQAVQRWRAQDNLQSYWTIDAGPNVHVI 299

Query: 310 FTHKIEETIKQFFPEITII----DPLDSPDLWSTK 340
              K    ++    E+  +         P+     
Sbjct: 300 CEAKDAPEVEARLCELDAVQWTIVNGAGPEARLVG 334


>gi|325693780|gb|EGD35699.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK150]
          Length = 315

 Score =  287 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSTLDYQAMLGYLQDNDFTKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|157150129|ref|YP_001449559.1| diphosphomevalonate decarboxylase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157074923|gb|ABV09606.1| diphosphomevalonate decarboxylase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 315

 Score =  287 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 103/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              ++E L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTEELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLAAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|262281876|ref|ZP_06059645.1| diphosphomevalonate decarboxylase [Streptococcus sp. 2_1_36FAA]
 gi|262262330|gb|EEY81027.1| diphosphomevalonate decarboxylase [Streptococcus sp. 2_1_36FAA]
          Length = 315

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HTKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTKELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYKAMLSYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ + M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYKAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|325688647|gb|EGD30664.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK72]
          Length = 315

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 103/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAKKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLLL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|324990338|gb|EGC22276.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK353]
          Length = 315

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 170/317 (53%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILN 79
           +  S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + +    D   ++
Sbjct: 4   KSVSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATGDEFYID 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           GQ  S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GQLQSLAEHV--KISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +    +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L
Sbjct: 122 FQTGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL
Sbjct: 175 VLHDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFSKVGQLTEENAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           +MHAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + + 
Sbjct: 235 RMHATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLV 294

Query: 320 QFFPEITIIDPLDSPDL 336
             F +   +    + DL
Sbjct: 295 AIFEKDYRLIVSKTKDL 311


>gi|315222755|ref|ZP_07864643.1| diphosphomevalonate decarboxylase [Streptococcus anginosus F0211]
 gi|315188168|gb|EFU21895.1| diphosphomevalonate decarboxylase [Streptococcus anginosus F0211]
          Length = 314

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 100/319 (31%), Positives = 165/319 (51%), Gaps = 11/319 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILN 79
           +       +NIA+ KYWGK+D+   +P  +S+SL+L ++ T T ++ +   + +D   +N
Sbjct: 4   KSVKVRSYANIAIIKYWGKKDTVKIIPATSSISLTLENMYTETTLSSLPVSAQSDEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G          KK +   D FR     +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQDQAE--HKKMSNIIDRFRPQGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +   ++  ++ A+L SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FELHLSTKEQAQKAKLASGSSSRSFYGPIAAW----DKDSGEIYPVKTD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SRE M+     S  F+ W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLYDQKKPISSREGMKRCAETSTTFSDWVRQSEEDYKAMLTYLSNNDFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   A+P   Y  +++ + M+ +   R Q    YFT+DAGPN+K+L   +  E + 
Sbjct: 235 AMHATTQTATPVFSYLTEKSYEAMDFIKQLRSQGERCYFTMDAGPNVKVLCLEEDLEHLV 294

Query: 320 QFFPEITIIDPLDSPDLWS 338
             F E   +    + +L  
Sbjct: 295 PIFAEKYRLIVSKTKELPD 313


>gi|325689461|gb|EGD31466.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK115]
          Length = 315

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 169/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFSKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|198421777|ref|XP_002126591.1| PREDICTED: similar to Mevalonate (diphospho) decarboxylase [Ciona
           intestinalis]
          Length = 382

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 102/348 (29%), Positives = 158/348 (45%), Gaps = 28/348 (8%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILN 79
           K +   P NIA+ KYWGK     NLPLN+S S++L    L T T +T   S   D + +N
Sbjct: 12  KITCCAPINIAIIKYWGKLCEVENLPLNSSFSITLNYHDLCTTTTVTTAPSYVKDQVYVN 71

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKV-----------------YFLIETSNNIPTKAGL 122
                   +   +     +  R+ ++                     +++ NN PTKAGL
Sbjct: 72  DLWQDINEN--PRLKVCFEEMRRLARKQAISENAAAKELMSCSKKIHVQSVNNFPTKAGL 129

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
           ASSASG+AALT AL ++  +      LS VAR GSGSACRS   GF EW+   +     +
Sbjct: 130 ASSASGYAALTFALGQLLGVK---GDLSGVARRGSGSACRSMCGGFVEWLKSEESKNSTA 186

Query: 183 FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQA 241
                   WP+LR+ +L +  ++K  GS   M+ +   S       + I    +  +KQA
Sbjct: 187 KQFVDETHWPELRVFILVVSSKQKSFGSTVGMQRSVETSALLKHRIENIVPHRIKVLKQA 246

Query: 242 IIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFT 299
           ++++DF    E+  K + ++HA  +   PPL Y    + + M  V  ++ R  S  + +T
Sbjct: 247 VLEKDFCLFAEICMKESNQLHAICMDTFPPLRYLNNVSEKIMNFVYSYNERCGSTRVAYT 306

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKN 347
            DAGPN  L       E +     ++       +   + T +  S  N
Sbjct: 307 FDAGPNAFLFTLAPFAEDLANQIYQVFPPSKDCTDTFFKTTEEFSFPN 354


>gi|311115036|ref|YP_003986257.1| putative diphosphomevalonate decarboxylase [Gardnerella vaginalis
           ATCC 14019]
 gi|310946530|gb|ADP39234.1| possible diphosphomevalonate decarboxylase [Gardnerella vaginalis
           ATCC 14019]
          Length = 379

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 153/299 (51%), Gaps = 8/299 (2%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISS---QS 87
           IAL KYWGKRD  L LP  +SLSL+L    T T +   D  +AD I LNG   +    QS
Sbjct: 38  IALIKYWGKRDETLILPYTSSLSLTLDGFSTTTKVRFDDCLEADSICLNGVNFTGDLLQS 97

Query: 88  SFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           S   +  +  D+ R+ + +     + + N +PT AGLASSASGFAAL  A      +   
Sbjct: 98  SERARIVKMLDIVRKIAGIKSKAQVVSVNTVPTAAGLASSASGFAALASAASYAAGLNLS 157

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
             +LS +AR GSGSACRS Y G   W  GT      +  +    +   L +  + +   +
Sbjct: 158 PRNLSILARKGSGSACRSIYGGLVLWNAGTSDETSYAEPIETPEE-LQLAMVTVILNSSK 216

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KKI SREAM  T   SP +  W +    DL     AI + D   LGEV+E+NAL MH  M
Sbjct: 217 KKISSREAMRRTVETSPIYADWIKNCKKDLNTALSAIKNCDIQALGEVSERNALGMHDAM 276

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
            AA+  + Y   ET   +  V   R +   P++ T+DAGPN+K+L + +    +K    
Sbjct: 277 RAAAESVNYLTDETHVVLNVVRKMRDESGFPVWATMDAGPNVKVLTSAEQVLRVKNELS 335


>gi|308493647|ref|XP_003109013.1| hypothetical protein CRE_11683 [Caenorhabditis remanei]
 gi|308247570|gb|EFO91522.1| hypothetical protein CRE_11683 [Caenorhabditis remanei]
          Length = 382

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 105/346 (30%), Positives = 167/346 (48%), Gaps = 22/346 (6%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS- 71
           + + N     + +  +P NIAL KYWGKRD KL LPLN+S+SL++  L   T I +I   
Sbjct: 1   MSQ-NESGISEVTVEVPMNIALVKYWGKRDEKLILPLNDSISLTVDKLTARTTIRMIQGV 59

Query: 72  DADCIILNGQKISSQSSF-----FKKTTQFCDLFRQFSK--------VYFLIETSNNIPT 118
               + +N +K+   S+      F +  +     ++ S          +F + ++ N P 
Sbjct: 60  GKHTVEINDEKVELSSNKRYQTVFDEALRLQRKRKEDSNGNENRSVSHHFEVISTTNFPV 119

Query: 119 KAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQN 178
            AGLASSA+GFAA+ LA+ ++ +        +R+AR+GSGSACRS   G   W  G   +
Sbjct: 120 AAGLASSAAGFAAIALAIQQLLN--LDDIQANRLARIGSGSACRSMSGGLVHWKKGEKDD 177

Query: 179 GMDSFAVP-FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLA 236
           G D  AV   ++ W DL   +L   D  KK+GS E M  TR  S       +  +   + 
Sbjct: 178 GSDCVAVKTKDDNWTDLYCVILVFNDGRKKVGSSEGMRWTRETSTLLKHRIEKVVPERID 237

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPI 296
            IK+A   ++F  L  V   ++ + HA  +   PP+ Y  + + Q +E V    Q  I  
Sbjct: 238 LIKKAYATRNFEDLARVIMADSNQFHAVCLDTIPPIRYLNESSWQLIETVEKFNQPEIKA 297

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTKDS 342
            +T DAGPN  ++   K    + +F   +     +++ DL +  + 
Sbjct: 298 AYTFDAGPNACVIVQKKD---VSKFINALIRDIQINTDDLETLPEE 340


>gi|319940310|ref|ZP_08014661.1| diphosphomevalonate decarboxylase [Streptococcus anginosus
           1_2_62CV]
 gi|319810497|gb|EFW06836.1| diphosphomevalonate decarboxylase [Streptococcus anginosus
           1_2_62CV]
          Length = 314

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 99/319 (31%), Positives = 163/319 (51%), Gaps = 11/319 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILN 79
           +       +NIA+ KYWGK+D+   +P  +S+SL+L ++ T T ++ +   + +D   +N
Sbjct: 4   KSVKVRSYANIAIIKYWGKKDTVKIIPATSSISLTLENMYTETTLSSLPVSAQSDEFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G          KK +   D FR     +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQDQAE--HKKMSNIVDRFRPQGAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +   ++   + A+L SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FELHLSTKEQVQKAKLASGSSSRSFYGPIAAW----DKDSGEIYPVKTD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SRE M+     S  F+ W +Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLYDQKKPISSREGMKRCAETSTIFSDWVRQSEEDYKAMLTYLSNNDFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   A+P   Y  +++ + M+ +   R Q    YFT+DAGPN+K+L   +  E + 
Sbjct: 235 AMHATTQTATPAFSYLTEKSYEAMDFIKQLRSQGERCYFTMDAGPNVKVLCLEEDLEHLV 294

Query: 320 QFFPEITIIDPLDSPDLWS 338
             F     +    + +L  
Sbjct: 295 PIFAAKYRLIVSKTKELPD 313


>gi|307708221|ref|ZP_07644688.1| diphosphomevalonate decarboxylase [Streptococcus mitis NCTC 12261]
 gi|307615667|gb|EFN94873.1| diphosphomevalonate decarboxylase [Streptococcus mitis NCTC 12261]
          Length = 317

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 104/317 (32%), Positives = 163/317 (51%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           E  +    +NIA+ KYWGK+  K  +P  +S+SL+L ++ T T +     D+ AD   +N
Sbjct: 4   EPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETALLPLPTDATADVFYIN 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   S       K ++  D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GLLQSEAEHV--KMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAY 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           + +      L++ A+  SGS+ RSFY     W    D++  + + V  +     L + +L
Sbjct: 122 FKLGLTRSQLAQEAKFASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D++K I SR+ M++    S  F  W  Q   D   +   + + DF K+GE+ EKNAL
Sbjct: 175 VLEDKKKPISSRDGMKLCVETSTTFDDWVCQSEKDYQDMLLYLKENDFAKVGELTEKNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHAT   ASP   Y    + + M+ V   R+Q    YFT+DAGPN+K+L   K  E + 
Sbjct: 235 AMHATTKTASPAFSYLTDASYEAMDFVRQLREQGESCYFTMDAGPNVKVLCQEKDLEHLS 294

Query: 320 QFFPEITIIDPLDSPDL 336
           + F +   +    + DL
Sbjct: 295 EIFGQRYRLIVSKTKDL 311


>gi|332522362|ref|ZP_08398614.1| diphosphomevalonate decarboxylase [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313626|gb|EGJ26611.1| diphosphomevalonate decarboxylase [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 314

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 101/318 (31%), Positives = 162/318 (50%), Gaps = 11/318 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIIL 78
           ++  +    +NIA+ KYWGK D K  +P  +S+SL+L ++ T T +  +    D D   +
Sbjct: 3   SKTVTVKSYANIAIIKYWGKEDQKKMIPSTSSISLTLENMYTETQLQGLPKGADKDLFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           + Q  S +    +K +   + FR    ++  + + NN+PT AGL+SS+SG +AL  A  +
Sbjct: 63  DDQLQSQEE--HEKISAIINQFRTPKDLFVQVRSRNNMPTAAGLSSSSSGLSALVKACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
            +        L++ A+  SGSA RSF+     W    D+N  D + V  +     L + +
Sbjct: 121 FFETGLTQSQLAQKAKFASGSASRSFFGPLSAW----DKNSGDIYKVKTD---LKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + D  K I SR+ M++ R  S  F QW ++   D   + Q +   DF K+G + E+NA
Sbjct: 174 LILNDERKSISSRDGMKLCRQTSTTFDQWIRKSEVDYQEMLQYLESNDFEKVGLLTEENA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MH T   +SP   Y  + + Q M +V D R +    YFT+DAGPN+K+L   K  E +
Sbjct: 234 LAMHETTRTSSPSFSYLTEASYQAMNKVRDMRSKGYQCYFTMDAGPNVKVLCLEKDLEEL 293

Query: 319 KQFFPEITIIDPLDSPDL 336
              F +   I    + D+
Sbjct: 294 AHLFEQDYKIIVSKTKDI 311


>gi|328945444|gb|EGG39596.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1087]
          Length = 315

 Score =  284 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 167/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHIT--VIDSDADCIILNGQ 81
            S    +NIA+ KYWGK+D+K  +P  +S+SL+L ++ T T ++  +  +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAKKMIPSTSSISLTLENMYTETQLSPLLATATEDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D+     + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKESGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+   M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYHAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|116491121|ref|YP_810665.1| diphosphomevalonate decarboxylase [Oenococcus oeni PSU-1]
 gi|116091846|gb|ABJ57000.1| diphosphomevalonate decarboxylase [Oenococcus oeni PSU-1]
          Length = 314

 Score =  284 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 156/308 (50%), Gaps = 10/308 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQK 82
           +     +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+
Sbjct: 2   AKVRAYTNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           I        K ++  +  R          + + N++PT AGLASSAS FAALT A  + +
Sbjct: 62  IEG-----PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAANQAF 116

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   +  LS++AR+GSGSA RS + GF  W  G +++   + ++     + D+R+  + 
Sbjct: 117 GLELDNRELSKIARIGSGSASRSIFGGFSIWHKGQNKDDSFAESILDPVDF-DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M+     SP +  W ++    +  + +AI D D  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQ-LAQTSPNYDSWLKKNDRQIDEMLKAISDHDLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPEITII 328
              E   I
Sbjct: 295 VLKEYGEI 302


>gi|183983206|ref|YP_001851497.1| diphosphomevalonate decarboxylase [Mycobacterium marinum M]
 gi|183176532|gb|ACC41642.1| diphosphomevalonate decarboxylase [Mycobacterium marinum M]
          Length = 336

 Score =  284 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 114/319 (35%), Positives = 162/319 (50%), Gaps = 16/319 (5%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCIILNGQKIS 84
             NIAL KYWGKRD +  LP+ +SLS++L    T T + V  +      D +++ G+   
Sbjct: 11  HPNIALIKYWGKRDEEFMLPMTSSLSMTLDIFPTTTTVEVGPTGGGVGPDIVMMAGKPAP 70

Query: 85  SQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
              +F  + T+F D    R  S+   +++T N  PT AGLASSASGFAAL  A    Y +
Sbjct: 71  --EAFSTRVTEFLDLLRVRVKSRAPAIVDTHNAGPTGAGLASSASGFAALAAAACAAYGL 128

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTD---QNGMDSFAVPFNNQWPDLRIGLL 199
              +  LSR+AR GSGSA RS + GF  W  G          S+A P +    DL + ++
Sbjct: 129 DTDARELSRLARRGSGSASRSVFGGFSVWHAGAAIGADGDAQSYAEPIDVA-LDLALVVV 187

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +    K+I SR AM  T   SP +  W      DL  ++ A+   D    G +AE NA+
Sbjct: 188 VVEAGAKQISSRAAMSQTVKTSPLYRAWADASGDDLHAMQAALAAGDLHGAGAIAEANAM 247

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MHATM+AA P + Y    ++Q ++RV   R   I  Y T+DAGPN+K+L +      I 
Sbjct: 248 GMHATMLAARPAVRYINAASLQVIDRVVAMRGDGIAAYLTMDAGPNVKVLCSRDDAALIA 307

Query: 320 QFFPEI----TIIDPLDSP 334
               E+    T++     P
Sbjct: 308 ASLKELSQVQTVVVAHPGP 326


>gi|308235868|ref|ZP_07666605.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis ATCC
           14018]
          Length = 379

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 112/299 (37%), Positives = 153/299 (51%), Gaps = 8/299 (2%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQKISS---QS 87
           IAL KYWGKRD  L LP  +SLSL+L    T T +   D  +AD I LNG   +    QS
Sbjct: 38  IALIKYWGKRDETLILPYTSSLSLTLDGFSTTTKVRFDDCLEADSICLNGVNFTGDLLQS 97

Query: 88  SFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEK 145
           S   +  +  D+ R+ + +     + + N +PT AGLASSASGFAAL  A      +   
Sbjct: 98  SERARIVKMLDIVRKIAGIKSKAQVVSVNTVPTAAGLASSASGFAALASAASYAAGLNLS 157

Query: 146 SESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDRE 205
             +LS +AR GSGSACRS Y G   W  GT      +  +    +   L +  + +   +
Sbjct: 158 PRNLSILARKGSGSACRSIYGGLVLWNAGTSDETSYAEPIETPEE-LQLAMVTVILNSSK 216

Query: 206 KKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATM 265
           KKI SREAM  T   SP +  W +    DL     AI + D   LGEV+E+NAL MH  M
Sbjct: 217 KKISSREAMRRTVETSPIYADWIKNCKKDLNTALSAIKNCDIQALGEVSERNALGMHDAM 276

Query: 266 IAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFP 323
            AA+  + Y   ET   +  V   R +   P++ T+DAGPN+K+L + +    +K    
Sbjct: 277 RAAAESVNYLTDETHVVLNVVRKMRDESGFPVWSTMDAGPNVKVLTSAEQVLRVKNELS 335


>gi|118586911|ref|ZP_01544344.1| diphosphomevalonate decarboxylase [Oenococcus oeni ATCC BAA-1163]
 gi|118432638|gb|EAV39371.1| diphosphomevalonate decarboxylase [Oenococcus oeni ATCC BAA-1163]
          Length = 314

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 98/308 (31%), Positives = 156/308 (50%), Gaps = 10/308 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQK 82
           +     +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+
Sbjct: 2   AKVRAYTNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           I        K ++  +  R          + + N++PT AGLASSAS FAALT A  + +
Sbjct: 62  IEG-----PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAASQAF 116

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   +  LS++AR+GSGSA RS + GF  W  G +++   + ++     + D+R+  + 
Sbjct: 117 GLELDNRELSKIARIGSGSASRSIFGGFSIWHKGQNKDDSFAESILDPVDF-DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M+     SP +  W ++    +  + +AI D D  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQ-LAQTSPNYDSWLKKNDRQIDEMLKAISDHDLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPEITII 328
              E   I
Sbjct: 295 VLKEYGEI 302


>gi|329116900|ref|ZP_08245617.1| diphosphomevalonate decarboxylase [Streptococcus parauberis NCFD
           2020]
 gi|326907305|gb|EGE54219.1| diphosphomevalonate decarboxylase [Streptococcus parauberis NCFD
           2020]
          Length = 311

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 102/318 (32%), Positives = 168/318 (52%), Gaps = 11/318 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIIL 78
            +  +    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++ +   + AD   +
Sbjct: 3   TKTVNVKSYANIAIIKYWGKDDAQKMIPTTSSISLTLENMYTETSLSFLPVEAQADQFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           +GQ  +       K T   D FRQ ++ Y  ++T NN+PT AGL+SS+SG +AL  A   
Sbjct: 63  DGQLQNQAE--HAKVTAIIDQFRQENQPYVKVDTENNMPTAAGLSSSSSGLSALVKACNE 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
           ++      + L+  A+  SGSA RSF+     W    D+   + + V  +     L + +
Sbjct: 121 LFETDLSQKELALKAKFASGSASRSFFGPLAAW----DRESGEIYPVETD---LKLGMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L I D  K + SRE M++ R  S  F +W  + + D   +   +   DF K+G++ EKNA
Sbjct: 174 LVINDARKPVSSREGMKLCRETSTTFDKWRTESAQDYKDMLAYLKANDFEKVGQLTEKNA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MHAT  +++P   Y  + + + M++V + RQ     YFT+DAGPN+K+L   K  E +
Sbjct: 234 LAMHATTKSSTPSFSYLIEGSYKAMDKVKELRQAGFQCYFTMDAGPNVKVLCLEKDLEQL 293

Query: 319 KQFFPEITIIDPLDSPDL 336
              F +   I    + +L
Sbjct: 294 ASIFEKDFDIIVSKTKEL 311


>gi|125717208|ref|YP_001034341.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK36]
 gi|125497125|gb|ABN43791.1| Diphosphomevalonate decarboxylase, putative [Streptococcus
           sanguinis SK36]
          Length = 315

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 168/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++ Q
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDTATGDEFYIDSQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYKAMLSYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|332358634|gb|EGJ36458.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1056]
          Length = 315

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 168/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + +    D   ++ Q
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATGDEFYIDSQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D DF K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLQDNDFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R+Q    YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLREQGERCYFTMDAGPNVKVLCLEEDLDHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|170590582|ref|XP_001900051.1| diphosphomevalonate decarboxylase family protein [Brugia malayi]
 gi|158592683|gb|EDP31281.1| diphosphomevalonate decarboxylase family protein [Brugia malayi]
          Length = 430

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 95/338 (28%), Positives = 141/338 (41%), Gaps = 46/338 (13%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ---- 81
             P NIAL KYWGKR+  L LPLN+S+SLS+  +   T + +  S   D + +NG     
Sbjct: 17  IAPINIALVKYWGKRNEDLMLPLNDSISLSINDMCAKTRVRIGASVKKDSVSINGSNVCL 76

Query: 82  -KISSQSSFFKKTTQFCDLFRQFSKV-----------YFLIETSNNIPTKAGLASSASGF 129
            K       FK+  +        S+             F + +  N P +AGLASSA+GF
Sbjct: 77  SKHPGFLRCFKEVRRLIRKRSIISETAGKSEKHDYFSKFEVVSETNFPIEAGLASSAAGF 136

Query: 130 AALTLALFRIYSIPEKSESLSRVARLG-----------------------SGSACRSFYR 166
           AA+   L +IY        + RVAR+G                       SGSACRS   
Sbjct: 137 AAIAYGLGQIYQ--LNISDIIRVARMGKHAVAIVILKCSQNELRLDNYSGSGSACRSILS 194

Query: 167 GFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF 224
           G   W  GT ++G D     V   + WP LR  +L      KK+ S   M+ T   S   
Sbjct: 195 GLVHWKAGTAEDGTDCICETVFPEDYWPTLRSLILVTSHGTKKVSSSNGMQSTVKTSKLL 254

Query: 225 TQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
                 +   +  ++ A  D++F +L +V   ++ ++HA  +   P L Y    +   M+
Sbjct: 255 QARMDIVPEQITKLRNAFRDRNFEQLAKVIMSDSGQLHALCMDTMPSLRYLNDNSWYLMQ 314

Query: 285 RVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
            +    +  +   + +T DAGPN  L         I  
Sbjct: 315 LIHALNRHCKDTKVAYTFDAGPNCCLFLESVNVPLILA 352


>gi|332310345|gb|EGJ23440.1| Diphosphomevalonate decarboxylase [Listeria monocytogenes str.
           Scott A]
          Length = 300

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 114/303 (37%), Positives = 168/303 (55%), Gaps = 11/303 (3%)

Query: 46  NLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
            LP N+SLS ++    T T +    +   D  ILN +  +       K  +F D  R+  
Sbjct: 2   ILPANSSLSFTVDKFYTKTTVEWDGNLAQDTFILNNEHKTD-----AKVARFIDKMREEF 56

Query: 105 KV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACR 162
            +     I + N++PT AGLASSAS FAAL LA        +  E +SR+AR GSGSA R
Sbjct: 57  GISAKAKITSENHVPTAAGLASSASAFAALALAGSSAAGRKDTKEYISRLARFGSGSASR 116

Query: 163 SFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGLLKIIDREKKIGSREAMEITRHHS 221
           S +  F  W  G   +G DSFAVPF N+  D + + +  + D+EKK+ SR+ M +T   S
Sbjct: 117 SVFGDFVIWEKGELADGSDSFAVPFTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETS 176

Query: 222 PFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQ 281
           PFF +W     TDL  +KQAI+D+DFIK+GE+ E+N +KMHAT + A PP  Y+Q ++++
Sbjct: 177 PFFEKWVSAAETDLEEMKQAILDEDFIKVGEITERNGMKMHATTLGAEPPFTYFQPKSLE 236

Query: 282 GMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI--TIIDPLDSPDLWST 339
            M+ V + R+  IP YFT+DAGPN+K++   + E  +      +   ++      +    
Sbjct: 237 IMDAVRELRENGIPAYFTMDAGPNVKVICERENENIVADKLSGLAKNVLICHAGKEASVV 296

Query: 340 KDS 342
            D 
Sbjct: 297 SDE 299


>gi|323353484|ref|ZP_08088017.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis VMC66]
 gi|322121430|gb|EFX93193.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis VMC66]
          Length = 315

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 102/315 (32%), Positives = 167/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ +   +  D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPDSATGDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNSYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              ++E L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTEELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R Q    YFT+DAGPN+K+L   +    +   
Sbjct: 237 HATTEKAYPPFSYLTEESYQAMDAVRKLRDQGERCYFTMDAGPNVKVLCLEEDLAHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|262341122|ref|YP_003283977.1| diphosphomevalonate decarboxylase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272459|gb|ACY40367.1| diphosphomevalonate decarboxylase [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 353

 Score =  282 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 101/344 (29%), Positives = 165/344 (47%), Gaps = 25/344 (7%)

Query: 15  ECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDAD 74
           + + + N   +    SNIAL KYWGK  +K+ +PLN+S+S SLG + T+T +   +    
Sbjct: 12  KYSIEPNGVITKKSHSNIALIKYWGKHKNKIQIPLNSSISYSLGRVYTVTRLIYQEKKKR 71

Query: 75  ----CIILNGQKISSQSSFFKKTTQFCD----LFRQFSKVYFLIETSNNIPTKAGLASSA 126
                I L+G++   ++SF  K  +F               F+IET N  P  +G+ASSA
Sbjct: 72  NLSIKIFLSGKE---KTSFLPKILEFFHRISFYCSYLRDFNFIIETYNTFPHSSGIASSA 128

Query: 127 SGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNG 179
           S  +AL L +  I              +  S +ARLGSGSACRS Y G   W       G
Sbjct: 129 SSMSALALCIMEIEKKLVFSLKKDFFLKKASFLARLGSGSACRSIYPGLVVWGSHKSIKG 188

Query: 180 M-DSFAVPF----NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD 234
             D +A+P+    +  +  +   +L I ++ KKI S +   +  +  P+     Q  + +
Sbjct: 189 SNDLYAIPYPYKVHPIFKKMVNTILIIDEKPKKILSSKG-HLLMNKHPYARVRFQCANQN 247

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR-QQS 293
           +  +   +   DF + GE+ E  AL +HA ++ + P  L+ +  T+  +  VWD R Q  
Sbjct: 248 MDRLISILKIGDFQEFGELIEHEALTLHAMIMTSRPYFLWMKPNTLNVLHTVWDFRIQSK 307

Query: 294 IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
             IYFTLDAG N+ LL+  + +++I ++             + +
Sbjct: 308 KNIYFTLDAGANVHLLYPIQEKKSILKWIYSDLFFYCKKIIESF 351


>gi|299783377|gb|ADJ41375.1| Mevalonate diphosphate decarboxylase [Lactobacillus fermentum CECT
           5716]
          Length = 289

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 101/277 (36%), Positives = 155/277 (55%), Gaps = 6/277 (2%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
            ++A   +NIAL KYWGKRD+ L LP  +SLSL+L    T T +    + + D   L+G+
Sbjct: 2   TTTARAHTNIALVKYWGKRDAALMLPQTDSLSLTLDEFYTTTTVNFNQALNEDQFYLDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            +S+  +  +K  +F DL RQ S    Y  I + NN+P  AGLASSAS FAAL  A  + 
Sbjct: 62  LVSANKA--QKVVKFMDLVRQLSGRTEYAQITSVNNVPMAAGLASSASAFAALAGAAAKD 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +    + LSR+AR GSGSA RS Y G  EW  G D     +  V     + D+ +  +
Sbjct: 120 AGLDLSLKDLSRLARRGSGSATRSVYGGLVEWHRGVDDATSFAEPVQEVPDF-DIAMLAI 178

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +   +KK+ SR  M++    SP++  W + +  D+  IK+AI ++D   +G +A++NAL
Sbjct: 179 LVDTSQKKVSSRGGMQLVVETSPYYPAWREVVKRDMVAIKEAIANRDLPTIGHIAQENAL 238

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPI 296
           +MHA  +AA P   Y+  +TI  M+ +   R++ + +
Sbjct: 239 RMHALNLAADPGFTYFDGQTILAMQTIDRLREEGLKL 275


>gi|332364784|gb|EGJ42553.1| diphosphomevalonate decarboxylase [Streptococcus sanguinis SK1059]
          Length = 315

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 101/315 (32%), Positives = 167/315 (53%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            S    +NIA+ KYWGK+D++  +P  +S+SL+L ++ T T ++ + +    D   ++GQ
Sbjct: 6   VSVKSYANIAIVKYWGKKDAEKMIPSTSSISLTLENMYTETQLSPLPATATEDEFYIDGQ 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             S       K ++  D FR     +  ++TSNN+PT AGL+SS+SG +AL  A    + 
Sbjct: 66  LQSPAE--HAKISKIIDRFRSPEDGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNAYFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
              +++ L+++A+  SGS+ RSF+     W    D++    + V  +     L + +L +
Sbjct: 124 TGYQTQELAQLAKFASGSSARSFFGPLAAW----DKDSGAIYPVKTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SR+ ME+    S  F  W  Q + D   +   + D +F K+G++ E+NAL+M
Sbjct: 177 HDEKKPISSRDGMELCAKTSTIFPDWIAQSALDYQAMLGYLRDNNFAKVGQLTEENALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           HAT   A PP  Y  +E+ Q M+ V   R Q    YFT+DAGPN+K+L   +    +   
Sbjct: 237 HATTEKAYPPCSYLTEESYQAMDAVRKLRDQGERCYFTMDAGPNVKVLCLEEDLAHLVAI 296

Query: 322 FPEITIIDPLDSPDL 336
           F +   +    + DL
Sbjct: 297 FEKDYRLIVSKTKDL 311


>gi|332022473|gb|EGI62780.1| Diphosphomevalonate decarboxylase [Acromyrmex echinatior]
          Length = 420

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 97/306 (31%), Positives = 144/306 (47%), Gaps = 19/306 (6%)

Query: 39  GKRDSKLNLPLNNSLSLSLG--HLGTITHITVI-DSDADCIILNGQKISSQSSFFKKTTQ 95
           GKR+  L LP N+S+S +L    L   T + +  D   D I LNG++    ++  +   +
Sbjct: 54  GKRNESLILPTNDSISATLDTAQLHAKTTVMLSSDFKEDRIWLNGKEEDINNTRLQNCLK 113

Query: 96  FCDLFRQFSKV----YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSR 151
                 Q S         I + NN PT AGLASSA+G+A LT AL ++Y I      +S 
Sbjct: 114 EIRKRSQLSGYTNDWKIRICSKNNFPTAAGLASSAAGYACLTAALAKLYKIE---GDISI 170

Query: 152 VARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIG 209
           +AR GSGSACRS   GF  W  G+D+NG DS A      + W ++RI +L + D +KK+ 
Sbjct: 171 IARSGSGSACRSVMGGFVRWYMGSDKNGTDSLAKQIVPASHWSEMRILVLVVSDEQKKVP 230

Query: 210 SREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAA 268
           S   M+ +   S         +       ++QAI+++DF    E+  K++ + HA  +  
Sbjct: 231 SAIGMKRSIETSQLLQHRIMHVVPERANKMQQAIVEKDFKNFAELTMKDSNQFHAVCLDT 290

Query: 269 SPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIK----QFF 322
            PP +Y    +   M  V         + + +T DAGPN  L    K    +      FF
Sbjct: 291 YPPCIYMNNISNNIMNLVHSYNDAVNDVKVAYTYDAGPNATLYLLEKDVSAVIGVLDHFF 350

Query: 323 PEITII 328
           P    I
Sbjct: 351 PPENAI 356


>gi|290890629|ref|ZP_06553700.1| hypothetical protein AWRIB429_1090 [Oenococcus oeni AWRIB429]
 gi|290479757|gb|EFD88410.1| hypothetical protein AWRIB429_1090 [Oenococcus oeni AWRIB429]
          Length = 314

 Score =  281 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 97/308 (31%), Positives = 156/308 (50%), Gaps = 10/308 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQK 82
           +     +NIAL KYWGK D   NLP ++S+ L+L    T T + +   S  D   LNGQ+
Sbjct: 2   AKVRAYTNIALIKYWGKSDLNWNLPTSSSIGLTLDRFYTDTSVEIDQFSKKDFFQLNGQQ 61

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           I        K ++  +  R          + + N++PT AGLASSAS FAALT A  + +
Sbjct: 62  IEG-----PKISKIINFIRNSCGNKNFVKVISENHVPTSAGLASSASAFAALTKAASQAF 116

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   +  LS++AR+GSGSA RS + GF  W  G +++   + ++     + D+R+  + 
Sbjct: 117 GLELDNRELSKIARIGSGSASRSIFGGFSIWHKGQNKDDSFAESILDPVDF-DIRVIDIL 175

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
              R KKI S + M+     SP +  W ++    +  + +AI D +  K+G +AE N+  
Sbjct: 176 ADKRVKKISSSQGMQ-LAQTSPNYDSWLKKNDRQIDEMLKAISDHNLEKIGLIAETNSAS 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH     A  P  Y+ + T + +  V    ++ I  + T+DAGPN+K++   + +E I  
Sbjct: 235 MHELNRTAKVPFDYFTENTREIIAEVDQLYKKGILAFATVDAGPNVKVITNSEYQEKIIN 294

Query: 321 FFPEITII 328
              E   I
Sbjct: 295 VLKEYGEI 302


>gi|118618817|ref|YP_907149.1| diphosphomevalonate decarboxylase [Mycobacterium ulcerans Agy99]
 gi|118570927|gb|ABL05678.1| diphosphomevalonate decarboxylase [Mycobacterium ulcerans Agy99]
          Length = 336

 Score =  281 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 113/329 (34%), Positives = 162/329 (49%), Gaps = 16/329 (4%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA----DCI 76
              +SA    NIAL KYWGKRD +   P+ +SLS++L    T T + V  +      D +
Sbjct: 3   TAAASAVAHPNIALIKYWGKRDEEFMPPMTSSLSMTLDIFPTTTTVEVGPTGGGVGPDIV 62

Query: 77  ILNGQKISSQSSFFKKTTQFCD--LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
           ++ G+      +F  + T+F D    R  S+   +++T N  PT AGLASSASGFAAL  
Sbjct: 63  MMAGKPAP--EAFSTRVTEFLDLLRVRVKSRAPAIVDTHNAGPTGAGLASSASGFAALAA 120

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD---QNGMDSFAVPFNNQW 191
           A    Y +      LSR+AR GSGSA RS + GF  W  G          S+A P +   
Sbjct: 121 AACAAYGLDTDVRELSRLARRGSGSASRSVFGGFSVWHAGAAIGADGDAQSYAEPIDVA- 179

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLG 251
            DL + ++ +    K+I SR AM  T   SP +  W      D   ++ A+   D    G
Sbjct: 180 LDLALVVVVVEAGAKQISSRAAMSQTVKTSPLYRAWADASGDDPHAMQAALAAGDLHGAG 239

Query: 252 EVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFT 311
            +AE NA+ MH TM+AA P + Y    ++Q ++RV   R   I  Y T+DAGPN+K+L +
Sbjct: 240 AIAEANAMGMHVTMLAARPAVRYISAASLQVIDRVVAMRGNGIAAYLTMDAGPNVKVLCS 299

Query: 312 HKIEETIKQFFPEI----TIIDPLDSPDL 336
                 I     E+    T++     P +
Sbjct: 300 RDDAALIAASLKELSQVQTVVVAHPGPRV 328


>gi|313890546|ref|ZP_07824174.1| diphosphomevalonate decarboxylase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313121063|gb|EFR44174.1| diphosphomevalonate decarboxylase [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 314

 Score =  281 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 94/318 (29%), Positives = 156/318 (49%), Gaps = 11/318 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIIL 78
           ++  +    +NIA+ KYWGK D K  +P  +S+SL+L ++ T T +  +    D D   +
Sbjct: 3   SKTVTVKSYANIAIIKYWGKEDQKKMIPSTSSISLTLENMYTETQVQALPEGVDRDLFYI 62

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFR 138
           + Q  S +    +K +   + FR    +Y  + + NN+PT AGL+SS+SG +AL  A  +
Sbjct: 63  DDQLQSQEE--HEKISAIINQFRTPKNLYVQVRSRNNMPTAAGLSSSSSGLSALVKACNQ 120

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGL 198
            +        L++ A+  SGSA RSF+     W   +         +        L + +
Sbjct: 121 FFETGLTQSQLAQKAKFASGSASRSFFGPLSAWDKSSGH-------IYKVTTDLKLAMIM 173

Query: 199 LKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNA 258
           L + +  K I SR+ M + R  S  F QW ++   D   +   +   DF K+G + E+NA
Sbjct: 174 LILNEERKPISSRDGMRLCRQTSTTFDQWIKKSEVDYQEMLHYLETNDFEKVGLLTEENA 233

Query: 259 LKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI 318
           L MH T   ++P   Y  + + Q M++V D R +    YFT+DAGPN+K+L   K  E +
Sbjct: 234 LAMHETTRTSTPSFSYLTEASYQAMDKVRDMRSKGYQCYFTMDAGPNVKVLCLEKDLEKL 293

Query: 319 KQFFPEITIIDPLDSPDL 336
              F +   +    + D+
Sbjct: 294 AHLFAQDYKVIVSKTKDI 311


>gi|324513471|gb|ADY45535.1| Diphosphomevalonate decarboxylase [Ascaris suum]
          Length = 400

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 91/330 (27%), Positives = 149/330 (45%), Gaps = 23/330 (6%)

Query: 14  GECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-D 72
              N    ++ +   P NIA+ KYWGKRD  L LPLN+S+S+++  L   T + V    +
Sbjct: 10  SPSNFIATKEVTVIAPINIAIIKYWGKRDEDLVLPLNDSISVNINELYAKTRVRVGPQIE 69

Query: 73  ADCIILNGQKISSQS-SFFKKTTQFCDLF------------RQFSKV--YFLIETSNNIP 117
            D + +NG+ +     + F++                    ++       F + ++ N P
Sbjct: 70  KDTVSINGKVVDLSKLNRFRRCFAEIRRMYRKRTMEDSEDNKKNFGCFDKFEVVSTTNFP 129

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFAA+  A+ R+Y+     + + R+ARLGSGS+CRS   GF  W  GT  
Sbjct: 130 TDAGLASSAAGFAAIAFAMGRLYN--LSKDEIERIARLGSGSSCRSLLGGFVHWKAGTCA 187

Query: 178 NGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTD 234
           +G D     V     W  LR  +L   +  K +GS + M  +   S   +    + +   
Sbjct: 188 DGSDCCCEVVAPTEHWSTLRAMILVTSNNSKDVGSTDGMRKSTQTSELLSHRVKEVVPKR 247

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
           ++ + +AI  ++F     +    + ++HA  +   PPL Y  K +   +  +        
Sbjct: 248 VSRLLEAIKSRNFEDFATITMAESNQLHAICMDTMPPLRYMNKNSWHLLRIMEALNTSIG 307

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           S  + +T DAGPN  L F       +    
Sbjct: 308 SKCVAYTFDAGPNCCLFFERDSMLRVLTAL 337


>gi|170016979|ref|YP_001727898.1| diphosphomevalonate decarboxylase [Leuconostoc citreum KM20]
 gi|169803836|gb|ACA82454.1| Diphosphomevalonate decarboxylase [Leuconostoc citreum KM20]
          Length = 316

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 114/302 (37%), Positives = 167/302 (55%), Gaps = 12/302 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
           S+A   +NIAL KYWGK++++LNLP  +S+SL+L    T T +T  +S AD + +NG   
Sbjct: 3   STATAHTNIALIKYWGKKNTRLNLPTTSSISLTLDQFYTKTTVT-PNSQADQLFING--- 58

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
              ++   +   F +  RQ+   +    + ++N++PT AGLASSAS FAALT A  R  +
Sbjct: 59  --NATDATRVHNFLNNLRQYLGDFEPLTVTSNNHVPTSAGLASSASAFAALTAATARELN 116

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                 +LSR+AR GSGSA RSFY  F  W  G   +   SFA   N     + + + ++
Sbjct: 117 FNLPLTTLSRLARRGSGSASRSFYGHFAIWHEG--IDDTSSFAESLNAPAMPIALVVAEV 174

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D  KK+GS E M      SP +  W ++ +  L  +KQAI   D  K+G +AEKNAL M
Sbjct: 175 SDAAKKVGSTEGMRRAV-TSPDYQDWLRESAKQLVDMKQAIQHSDIEKIGAIAEKNALSM 233

Query: 262 HATMIAASP-PLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           HA  + A   P  Y+  +T + +  V D R Q I  + TLDAGPN+K++ T    + ++ 
Sbjct: 234 HALNLTARQKPFTYFTCDTQRILSIVSDLRHQGILAFATLDAGPNVKIITTLDSAKLVEA 293

Query: 321 FF 322
             
Sbjct: 294 AL 295


>gi|15672387|ref|NP_266561.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723279|gb|AAK04503.1|AE006277_3 diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326405981|gb|ADZ63052.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           CV56]
          Length = 318

 Score =  279 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 111/316 (35%), Positives = 173/316 (54%), Gaps = 14/316 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
            +A   +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN +  
Sbjct: 5   VTARAHTNIALIKYWGKADIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSEVA 64

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            S      + +QF ++ R         +I++ N++PT AGLASSAS FAALT A+F +  
Sbjct: 65  DSS-----RVSQFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSASSFAALTAAMFGLLD 119

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    +SR+AR GSGSA RS +  F  W  G D     SFA  F N+   L + + +I
Sbjct: 120 LEKDDSEMSRIARRGSGSASRSIFGNFSVWNKGEDHQS--SFAESFYNEDIGLSMIVAEI 177

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              +KK+ S + M+     +P ++ W ++ +  L  +KQAI++ D  K+G VA+ NAL M
Sbjct: 178 SAEKKKMSSTKGMQ-LAQTAPTYSAWVEKSAIQLEEMKQAILNADIEKVGLVAQDNALGM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----T 317
           H     ++ P  Y+  ET   ++ V  A Q  +  + T+DAGPN+K++  H  E+     
Sbjct: 237 HEQNRLSNQPFDYFTHETRHVIDFVNQAYQSGLLAFVTIDAGPNVKIITDHATEKVLLAK 296

Query: 318 IKQFFPEITIIDPLDS 333
           ++  FPE+T       
Sbjct: 297 LQAEFPELTFDIARAG 312


>gi|281490947|ref|YP_003352927.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           KF147]
 gi|281374705|gb|ADA64225.1| Diphosphomevalonate decarboxylase [Lactococcus lactis subsp. lactis
           KF147]
          Length = 318

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 110/316 (34%), Positives = 174/316 (55%), Gaps = 14/316 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
            +A   +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN +  
Sbjct: 5   VTARAHTNIALIKYWGKADIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSEVA 64

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +S      + +QF ++ R         +I++ N++PT AGLASSAS FAALT A+F +  
Sbjct: 65  NSS-----RVSQFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSASSFAALTAAMFGLLD 119

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    +SR+AR GSGSA RS +  F  W  G D     SFA  F N+   L + + +I
Sbjct: 120 LEKDDSEMSRIARRGSGSASRSIFGNFSVWNKGEDHQS--SFAESFYNEDIGLSMIVAEI 177

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              +KK+ S + M+     +P ++ W ++ +  L  +KQAI++ D  K+G +A+ NAL M
Sbjct: 178 SAEKKKMSSTKGMQ-LAQTAPTYSAWVEKSAIQLEEMKQAILNADIEKVGLIAQDNALGM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----T 317
           H     ++ P  Y+  ET   ++ V  A Q  +  + T+DAGPN+K++  H  E+     
Sbjct: 237 HEQNRLSNQPFDYFTHETRHVIDFVNQAYQSGLLAFVTIDAGPNVKIITDHATEKILLAK 296

Query: 318 IKQFFPEITIIDPLDS 333
           ++  FPE+T       
Sbjct: 297 LQAEFPELTFDIARAG 312


>gi|261749367|ref|YP_003257052.1| mevalonate diphosphate decarboxylase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497459|gb|ACX83909.1| mevalonate diphosphate decarboxylase [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 353

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 94/334 (28%), Positives = 154/334 (46%), Gaps = 25/334 (7%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV----IDSDADCIILNG 80
           +   PSNIAL KYWGK+ +K+ +P N+S+S SL  + T T +          +  I  +G
Sbjct: 22  TKKSPSNIALIKYWGKQKNKIQIPSNSSISYSLEKVYTETRLIYHLREKKKRSIKIFFSG 81

Query: 81  QKISSQSSFFKKTTQFCD----LFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           ++    +SF  K  +F               F+IET N  P  +G+ASSAS  +AL L +
Sbjct: 82  KE---NTSFLPKILEFFHRISLYCSYLRDFNFVIETKNTFPHSSGIASSASSMSALALCI 138

Query: 137 FRIYSI-------PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD-----SFA 184
             I                 S +AR GSGSACRS Y G   W       G +      + 
Sbjct: 139 MEIEKKLVSSLEEDFFLRKASFLARFGSGSACRSIYPGLVVWGGHKSIKGSNNLYAIPYP 198

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
              +  +  +   +L I +  KKI S +  +    H+P+  +  +  + ++  +   +  
Sbjct: 199 YKIHPIFTKMGDTILVIDEYPKKILSSKGHQ-LMIHNPYAKERFKCANKNMDRLISILKM 257

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP-IYFTLDAG 303
            D  + GE+ E  AL +HA ++ + P  L+ +  T+  + +VWD R+QS   IYFTLDAG
Sbjct: 258 GDLQEFGELIEHEALTLHAMIMTSHPYFLWMKPNTLHVLYKVWDFRKQSKKNIYFTLDAG 317

Query: 304 PNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLW 337
            N+ LL+  +   +I+++             + +
Sbjct: 318 ANVHLLYPIQEIVSIRKWIYSDLFSYCKKIIESF 351


>gi|326692553|ref|ZP_08229558.1| diphosphomevalonate decarboxylase [Leuconostoc argentinum KCTC
           3773]
          Length = 317

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 112/321 (34%), Positives = 164/321 (51%), Gaps = 16/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
            ++A   +NIAL KYWGK+DS LNLP  +S+SL+L    T T ++   S AD +++NGQ 
Sbjct: 2   TTTATAHTNIALIKYWGKKDSILNLPTTSSISLTLNEFYTRTTVSQNAS-ADELLINGQP 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
             S     ++  +F D+ R          + + N++PT AGLASSAS FAALT A+ R  
Sbjct: 61  FDS-----QRIHRFLDMLRDTLGDFAPLTVASENHVPTGAGLASSASAFAALTGAVTREL 115

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   + +LSR+AR GSGSA RSFY  F  W  G D     SFA   +     + + + +
Sbjct: 116 GLDLDNMTLSRLARRGSGSASRSFYGHFAIWHEGHDDAS--SFAESLHAPDMPIALVVAE 173

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +    KK+GS E M      SP +  W +  +  L  ++ AI   D  K+G +AE NAL 
Sbjct: 174 VSTAMKKVGSTEGMRR-AATSPDYATWVKNSAAQLRDMQAAIQASDIEKIGTIAEANALA 232

Query: 261 MHATMIAAS-PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI- 318
           MH     A   P  Y+  +T   +  V D R+Q +  + TLDAGPN+K++ T      I 
Sbjct: 233 MHDLNRTARLEPFTYFTNDTTDILTLVADMRRQGLLAFATLDAGPNVKIITTQAHAPLIV 292

Query: 319 ---KQFFPEITIIDPLDSPDL 336
              +   P + +        +
Sbjct: 293 SQLQAAMPNLHLEIATSGAGI 313


>gi|114664087|ref|XP_001135959.1| PREDICTED: diphosphomevalonate decarboxylase isoform 2 [Pan
           troglodytes]
 gi|114664089|ref|XP_001136051.1| PREDICTED: diphosphomevalonate decarboxylase isoform 3 [Pan
           troglodytes]
          Length = 379

 Score =  277 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 90/332 (27%), Positives = 140/332 (42%), Gaps = 28/332 (8%)

Query: 39  GKRDSKLNLPLNNSLSLSL--GHLGTITHITVI-DSDADCIILNGQKISSQSSFFKKTTQ 95
           GKRD +L LP+N+SLS++L    L T T   +  D   D I LNG++        +   +
Sbjct: 4   GKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLR 63

Query: 96  FCDLF-------------RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
                                      + + NN PT AGLASSA+G+A L   L R+Y +
Sbjct: 64  EIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLARVYGV 123

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLK 200
                 LS VAR GSGSACRS Y GF EW  G   +G DS A  V   + WP+LR+ +L 
Sbjct: 124 E---SDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILV 180

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
           +    +       +              +  +   +A + + I ++DF    ++  K++ 
Sbjct: 181 VSGVGRVEQQPCGLSAPWETPCALQFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSN 240

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEET 317
           + HAT +   PP+ Y    + + +  V           + +T DAGPN  +       +T
Sbjct: 241 QFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLD---DT 297

Query: 318 IKQFFPEITIIDPLDSP-DLWSTKDSLSQKNS 348
           + +F   +    P  S  D +     +     
Sbjct: 298 VAEFVAAVRHGFPPGSNGDTFLKGLQVRPAPL 329


>gi|146304339|ref|YP_001191655.1| diphosphomevalonate decarboxylase [Metallosphaera sedula DSM 5348]
 gi|145702589|gb|ABP95731.1| diphosphomevalonate decarboxylase [Metallosphaera sedula DSM 5348]
          Length = 323

 Score =  274 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 96/323 (29%), Positives = 153/323 (47%), Gaps = 38/323 (11%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLN--------------LPLNNSLSLSLGHLGTITHITV 68
           ++ A  PSNIA+ KYWGKRD +LN                               + +  
Sbjct: 4   EAEAVAPSNIAIVKYWGKRDRELNLPLNSSLSISLDSLW--------------VRSRVIF 49

Query: 69  IDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK--VYFLIETSNNIPTKAGLASS 125
            +S D D +I+NG+++S      +   +    FR      ++  +E++ N P+ AGLASS
Sbjct: 50  DESLDKDEVIINGKRLSENE-VREYAGRVLRRFRDLYGKELFARVESTTNFPSSAGLASS 108

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G AALT A      +   +  LS++AR+GSGSACRS + GF +W  G  ++G DSF  
Sbjct: 109 AAGIAALTYASNAALGLGLSNRELSKIARVGSGSACRSMFGGFVKWNRGELESGDDSFCE 168

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                + WPDL   +    + +KK+ SR  ME T   S       Q I      +  AI 
Sbjct: 169 EIFPPDHWPDLVDIIPIFGEEKKKVSSRTGMENTATSSALMRCRLQFIEETFNEVIDAIR 228

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAG 303
            ++  K  ++  +++  MHA ++ + PP+ Y  +++ + ME V +         +T DAG
Sbjct: 229 TKNAGKFFQLTMRHSNSMHAVILDSWPPMNYLNEKSFRVMEWVVEF----GKAAYTFDAG 284

Query: 304 PNLKLLFTHKIEETIKQFFPEIT 326
           PN  +    K  + + +F  EI 
Sbjct: 285 PNPHIFVLEKDVDEVLKFLNEIG 307


>gi|86475801|dbj|BAE78978.1| mevalonate diphosphate decarboxylase [Streptomyces sp. KO-3988]
          Length = 309

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 157/301 (52%), Gaps = 14/301 (4%)

Query: 46  NLPLNNSLSLSLGHLGTITHIT-VIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
            LP  +SLS++L  L T T +    ++  D + L+G+    ++   ++   F DL R+ +
Sbjct: 1   MLPRVDSLSMTLDVLPTTTRVRRAPEAGQDEVTLDGRPAEGEA--LRRVVAFLDLVRERA 58

Query: 105 KV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACR 162
            +    +++T+N + T AGLASSASGFAAL +A    Y +   + +LSR+AR GSGSA R
Sbjct: 59  GLADRAVVDTANTVATGAGLASSASGFAALAVAAAAAYGLDLDATALSRLARRGSGSASR 118

Query: 163 SFYRGFCEWICGTD-----QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEIT 217
           S + GF  W  G       +  + S+A P      D  + +  +    K + SR AM  T
Sbjct: 119 SIFGGFAVWHAGLHSGAAAEADLSSYAEPVPVGDLDPALVVAVVDAGPKAVSSRAAMRRT 178

Query: 218 RHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQK 277
              SP +  W      DL  ++ A++  D   +GE+AE+NAL MHATM+AA P + Y   
Sbjct: 179 VDTSPLYEPWAVSSGDDLVDMRAALLAGDIEAVGEIAERNALGMHATMLAARPAVRYLAP 238

Query: 278 ETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF----PEITIIDPLDS 333
            T+  ++ V   R+  +P Y T+DAGPN+K+L      E + +      P+ T++     
Sbjct: 239 ATLTVLDSVLGLRRDGVPAYATMDAGPNVKVLCRSADAERVAKTLRVAVPDGTVLVARPG 298

Query: 334 P 334
           P
Sbjct: 299 P 299


>gi|226487404|emb|CAX74572.1| putative Diphosphomevalonate decarboxylase [Schistosoma japonicum]
 gi|226487406|emb|CAX74573.1| putative Diphosphomevalonate decarboxylase [Schistosoma japonicum]
          Length = 391

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 96/348 (27%), Positives = 149/348 (42%), Gaps = 22/348 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLG--TITHI-TVIDSDADCIILN 79
           + +   P NIAL KYWGK D     PL +S+SL+L      + T + T          LN
Sbjct: 4   QVTC--PVNIALLKYWGKVDELNIFPLTSSISLTLNQSHVGSRTTVFTKNGLKQSQFKLN 61

Query: 80  GQKISSQSSFFK--KTTQFCDLF--RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           G+               Q       +  +  +  +ET NN PT AGLASSASG AA   A
Sbjct: 62  GRVTQFPPRLLDVLIIAQLRSRLHGKHIASPFICVETENNFPTAAGLASSASGTAAFAFA 121

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSF--AVPFNNQWPD 193
           L ++YS+     S SR     S   CRS   GF  W          SF   +  ++ WP+
Sbjct: 122 LGKMYSLDGDYTSFSRRGSGSS---CRSLSGGFVLWSSNRGDYLHPSFVQQLFPSSHWPE 178

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQ-WTQQISTDLAHIKQAIIDQDFIKLGE 252
           L++ +  + +  K IGS +AM    + S  F                 A+ ++DF  L E
Sbjct: 179 LKVLICVVNEHSKHIGSTDAMLNCVNTSDLFRSGRVLSAKIHEKQAISALRERDFSALAE 238

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKLLF 310
           V  + + ++HA  +   PP ++    +   M+ V    +  +   + +T DAGPN  LL 
Sbjct: 239 VTMRESNQLHAVCLDTWPPCVFLNHLSYSIMDFVHRINKYFKKSVVAYTFDAGPNAFLLT 298

Query: 311 THKIEETIKQFFPE-----ITIIDPLDSPDLWSTKDSLSQKNSIELGI 353
                E I ++  E     + + D +++ D ++ +   S K    +GI
Sbjct: 299 ESHNIENILKYLVECFGRTVGVGDSMNTTDKFTVQCRDSNKYLKVIGI 346


>gi|162447658|ref|YP_001620790.1| diphosphomevalonate decarboxylase [Acholeplasma laidlawii PG-8A]
 gi|161985765|gb|ABX81414.1| diphosphomevalonate decarboxylase [Acholeplasma laidlawii PG-8A]
          Length = 315

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 106/308 (34%), Positives = 164/308 (53%), Gaps = 10/308 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQKI 83
           +A    NIAL KYWGK+D + NLPL +S+SL+L    T T +T   +  AD ++++ + I
Sbjct: 4   TAIANVNIALIKYWGKKDIEWNLPLTSSISLTLDAFYTKTTVTYDPTLTADILLIDDEII 63

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYF--LIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
           +       + T++ D  R+   + F   I + N +P KAGLASS+S FAAL  A  + Y 
Sbjct: 64  TGGEYL--RVTKYMDKLRKLYSIPFYAKITSYNFVPKKAGLASSSSAFAALAYAATKAYG 121

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           +   S+ LS +ARLGSGSA RS Y G   W  G   + M S+A        DL + +  I
Sbjct: 122 LNLDSKELSSLARLGSGSASRSIYGGLVLWHEG--HDHMSSYAEHLT-HMDDLAVIVCLI 178

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            +  KK+ S +AM     +      W       L  +K+AII+ DF K+G +AE +A  M
Sbjct: 179 DETPKKVNSTDAMNRLNEYPDLKELWILSTQDALNDMKEAIIENDFDKMGSIAESHASLM 238

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H  +      + Y   ++ + M+     R + IP+Y+T+DAG N+K+L   +  ETIK  
Sbjct: 239 HYIIQET--GVSYLTDQSFKVMDLTEKIRNEGIPVYYTMDAGANVKILTKKEYVETIKAR 296

Query: 322 FPEITIID 329
           + +++ + 
Sbjct: 297 YEKLSKVI 304


>gi|317495993|ref|ZP_07954355.1| diphosphomevalonate decarboxylase [Gemella moribillum M424]
 gi|316913897|gb|EFV35381.1| diphosphomevalonate decarboxylase [Gemella moribillum M424]
          Length = 303

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 154/295 (52%), Gaps = 11/295 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGK+     LP N ++SL L +L + T I    +D D   +N +K S +    
Sbjct: 10  NIALVKYWGKKSKDPVLPFNPNISLRLDNLLSKTKIEPSLTDEDEFYINDEKQSQEE--V 67

Query: 91  KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
           +K T+F   F    +    I + N +PT AGL+SS+SG  AL LA  + + + + +E L 
Sbjct: 68  EKITKFIAKFTPIEREKICIRSYNTVPTAAGLSSSSSGTMALVLACNKYFKLNKTTEELV 127

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGS 210
            +++ GSGS+CRSFY     W+       +            D  + +L + +  KKI S
Sbjct: 128 EISKEGSGSSCRSFY-RLAAWLEDGSVEELSC--------DLDFGMMVLVVNEDRKKISS 178

Query: 211 REAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP 270
           R AME     S  F  W ++   D   +K A+ + DF K+G + E NAL MHAT   ++P
Sbjct: 179 RIAMERCVQTSTTFDAWVEKAKEDFVDMKIALKNADFEKIGAITEANALAMHATTTTSTP 238

Query: 271 PLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              +   E+ + ME V   +++    YFT+DAGPN+K+L+  + +E I +   ++
Sbjct: 239 SFTFLTDESYRAMEIVKTLQEKGYRCYFTMDAGPNVKVLYLKEDQEKIYEEISKL 293


>gi|108762661|ref|YP_633173.1| diphosphomevalonate decarboxylase [Myxococcus xanthus DK 1622]
 gi|108466541|gb|ABF91726.1| diphosphomevalonate decarboxylase [Myxococcus xanthus DK 1622]
          Length = 332

 Score =  272 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 114/336 (33%), Positives = 174/336 (51%), Gaps = 31/336 (9%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGH----------LGTITHITV 68
            +  K++A    NIAL KYWGKRD  L LP          H          L   T +  
Sbjct: 2   SLPMKATALAHPNIALVKYWGKRDDALILP----------HQSSLSLTLSPLSVTTTVEF 51

Query: 69  IDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV---YFLIETSNNIPTKAGLASS 125
             + +D + LNG   +++ S   +  +  +L R  +K       + +  + P  AGLASS
Sbjct: 52  -GAASDQVELNG--HTAKGSERDRVLRLLELVRAQAKADLGPAKVVSRGDFPMAAGLASS 108

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+GFAAL +A      +P +  + S +AR+GSGSACRS   GFCEW  G   +G DSFAV
Sbjct: 109 AAGFAALAVAGRAAAGLPSEPRAASILARMGSGSACRSVQGGFCEWQRGERPDGEDSFAV 168

Query: 186 P--FNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAII 243
                  WPD+R+ +  +   EK++ SR+ M++T   SP++  W +    ++  +++ I 
Sbjct: 169 QRFDAAHWPDVRMVVAILDRGEKEVKSRDGMKLTVDTSPYYPAWVKDAEVEVVQVREHIA 228

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAG 303
            +D   LGE+ E+NA +MHAT  AA+PPL Y    T+  +  + + R++ IP++FTLDAG
Sbjct: 229 RRDLQALGELCERNAWRMHATSFAANPPLSYMSPGTLALILHLKEQRKKGIPVWFTLDAG 288

Query: 304 PNLKLLFTHKIE---ETIKQFFPEITIIDPLDSPDL 336
           PN  LL     E   E + +    + +I  +   D 
Sbjct: 289 PNPVLLTDAAHEVAAEALARACGALDVIRCVPGGDA 324


>gi|329769190|ref|ZP_08260610.1| diphosphomevalonate decarboxylase [Gemella sanguinis M325]
 gi|328839409|gb|EGF88987.1| diphosphomevalonate decarboxylase [Gemella sanguinis M325]
          Length = 303

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 153/295 (51%), Gaps = 11/295 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGK+     LP N ++SL L +L + T I    S+ D   +N +K   +    
Sbjct: 10  NIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKSLSNEDEFYINDEKQGPEE--V 67

Query: 91  KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
            K  +F   F   ++    I++ N +PT AGL+SS+SG  AL LA    + + + ++ + 
Sbjct: 68  NKMIKFISKFTPVAREKICIKSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKSTQEMV 127

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGS 210
            +A+ GSGS+CRSFY     W+       +            D  + +L + +  KKI S
Sbjct: 128 EIAKEGSGSSCRSFY-KLAAWLEDGSVEELSCK--------LDFGMMVLVVNEDRKKISS 178

Query: 211 REAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP 270
           R AME     S  F  W ++   D   +K+A+ + DF K+GE+ E NAL MH T   +SP
Sbjct: 179 RVAMEQCVQTSTTFASWVEKAKKDFVLMKEALKEADFEKIGEITESNALAMHETTTTSSP 238

Query: 271 PLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              +  +E+ + M+ V   R Q    YFT+DAGPN+K+L+  + +E + +   ++
Sbjct: 239 SFTFLTEESHRAMDIVKQLRSQGYKCYFTMDAGPNVKVLYLKEDQEKLHEEISKL 293


>gi|171778296|ref|ZP_02919502.1| hypothetical protein STRINF_00344 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282996|gb|EDT48420.1| hypothetical protein STRINF_00344 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 311

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 99/315 (31%), Positives = 161/315 (51%), Gaps = 11/315 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +   +  D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAAKMIPATSSISLTLENMFTTTSVSFLPDSASHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     Y  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDDKE--HAKISAIIDQYRGQRSEYVKVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 TGLTRAELAQKAKFASGSSSRSFFGPLAAW----DKDSGEVYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   + + DF ++GE+ E+NAL M
Sbjct: 177 SDSKKSISSREGMKRCVETSTTFADWVKQSEQDYKDMLGYLKNNDFERVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  +E+ + ME V   R +    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTEESYKAMEFVKQLRSEGEKCYFTMDAGPNVKVLCLEEDLERLTKR 296

Query: 322 FPEITIIDPLDSPDL 336
           F E   +    + +L
Sbjct: 297 FEENYRVIVSRTKEL 311


>gi|125623293|ref|YP_001031776.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124492101|emb|CAL97030.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300070044|gb|ADJ59444.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 318

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 107/316 (33%), Positives = 169/316 (53%), Gaps = 14/316 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
            +A   +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN    
Sbjct: 5   VTARAHTNIALIKYWGKTDIALNIPTTSSLSMTLEPFYTTTSVEFTDNESDSLILNSAME 64

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            S      + ++F ++ R         +I++ N++PT AGLASSAS FAALT A+F +  
Sbjct: 65  DSS-----RVSKFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSASSFAALTAAMFGLLD 119

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    +SR+AR GSGSA RS +  F  W  G +     SFA  F N+   L + + +I
Sbjct: 120 LEKDDSEMSRIARRGSGSASRSIFGNFAVWNKGENHQS--SFAESFYNKDIGLSMIVAEI 177

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              +KK+ S + M+     +P +  W ++ +  LA +KQAI+  D  K+G +A+ NAL M
Sbjct: 178 SSEKKKMSSTKGMQ-LAQTAPTYGAWVEKSAIQLAEMKQAILQADIEKVGLIAQDNALGM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----T 317
           H        P  Y+  ET + ++   +  +  +  + T+DAGPN+K++  H  E+     
Sbjct: 237 HEQNRLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNVKIITDHATEKILLTK 296

Query: 318 IKQFFPEITIIDPLDS 333
           +K  FPE+T       
Sbjct: 297 LKAEFPELTFDIARAG 312


>gi|116511265|ref|YP_808481.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116106919|gb|ABJ72059.1| diphosphomevalonate decarboxylase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 318

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 107/316 (33%), Positives = 169/316 (53%), Gaps = 14/316 (4%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKI 83
            +A   +NIAL KYWGK D  LN+P  +SLS++L    T T +   D+++D +ILN    
Sbjct: 5   VTARAHTNIALIKYWGKTDIALNIPATSSLSMTLEPFYTTTSVEFTDNESDSLILNSAME 64

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
            S      + ++F ++ R         +I++ N++PT AGLASSAS FAALT A+F +  
Sbjct: 65  DSS-----RVSKFLEMMRGQYGNFPKVMIQSENHVPTAAGLASSASSFAALTAAMFGLLD 119

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    +SR+AR GSGSA RS +  F  W  G +     SFA  F N+   L + + +I
Sbjct: 120 LEKDDSEMSRIARRGSGSASRSIFGNFAVWNKGENHQS--SFAESFYNKDIGLSMIVAEI 177

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
              +KK+ S + M+     +P +  W ++ +  LA +KQAI+  D  K+G +A+ NAL M
Sbjct: 178 SSEKKKMSSTKGMQ-LAQTAPTYGAWVEKSAIQLAEMKQAILQADIEKVGLIAQDNALGM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE----T 317
           H        P  Y+  ET + ++   +  +  +  + T+DAGPN+K++  H  E+     
Sbjct: 237 HEQNRLCLEPFDYFTSETQRVVDFTKECYKAGLLAFVTIDAGPNVKIITDHATEKILLTK 296

Query: 318 IKQFFPEITIIDPLDS 333
           +K  FPE+T       
Sbjct: 297 LKAEFPELTFDIARAG 312


>gi|123474438|ref|XP_001320402.1| diphosphomevalonate decarboxylase family protein [Trichomonas
           vaginalis G3]
 gi|121903206|gb|EAY08179.1| diphosphomevalonate decarboxylase family protein [Trichomonas
           vaginalis G3]
          Length = 341

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 80/326 (24%), Positives = 139/326 (42%), Gaps = 16/326 (4%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD 72
           +   NP     +      NIAL KYWGK +     P++ SLS++L    T T       D
Sbjct: 1   MSTSNPTHTSHAVCTSHPNIALVKYWGKENIPEITPIHGSLSVTLNFGVTTTKAEYSSDD 60

Query: 73  ADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPT--------KAGLAS 124
            D   LN ++    S    +     D F    K++F I + N+ PT            A 
Sbjct: 61  VDHFYLNNKEAEITS----RLKTAIDFFNDNGKLHFNITSVNSFPTAAGLASSAAGAAAF 116

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
             +  + +      I    +K   L+ +AR  SGS CRS + GF EW+ GT  +   +  
Sbjct: 117 VGALASLVGKTNNPITYWMQKGVDLTALARKVSGSGCRSIHGGFVEWVPGT-PSESVAKQ 175

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT-QQISTDLAHIKQAII 243
           +   +QW D  +  + +  ++K + S + M+ T    P+      + +   ++  K+ I 
Sbjct: 176 IADQHQWEDFVVFSVIVSSKKKDVLSTKGMQSTVETVPWIHWRAQEVVPKRISDAKKFIN 235

Query: 244 DQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLD 301
           ++DF  L E+  + + ++HA  +A  PP+ Y   E+ + +  +             ++ D
Sbjct: 236 EKDFASLAEIIMRESNELHANCLATFPPIKYLNDESFKVVSAIHQLNDDHKINIAAYSFD 295

Query: 302 AGPNLKLLFTHKIEETIKQFFPEITI 327
           AGPN  +  T + E+ +     EI I
Sbjct: 296 AGPNPFVFTTKEHEKAVLDKLHEIGI 321


>gi|320546918|ref|ZP_08041220.1| diphosphomevalonate decarboxylase [Streptococcus equinus ATCC 9812]
 gi|320448436|gb|EFW89177.1| diphosphomevalonate decarboxylase [Streptococcus equinus ATCC 9812]
          Length = 316

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 97/317 (30%), Positives = 160/317 (50%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +   +  D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAAKMIPATSSISLTLENMFTTTSVSFLPDTATHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDEKE--HAKISAIIDQYRGQRTEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 TGLTQAELAQKAKFASGSSSRSFFGPLAAW----DKDTGEVYQVETD---LKLGMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   + + DF ++GE+ E+NAL M
Sbjct: 177 SDSKKPISSREGMKRCVETSTTFENWVKQSEQDYKDMLGYLKNNDFERVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  +E+ + M+ V   R +    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTEESYKAMDFVKQLRAEGEKCYFTMDAGPNVKVLCLEEDLERLTKR 296

Query: 322 FPEITIIDPLDSPDLWS 338
           F E        + +L  
Sbjct: 297 FEENYRAIVSRTKELPD 313


>gi|301166760|emb|CBW26337.1| mevalonate diphosphate decarboxylase [Bacteriovorax marinus SJ]
          Length = 362

 Score =  270 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 89/350 (25%), Positives = 156/350 (44%), Gaps = 28/350 (8%)

Query: 9   LHRYIGECNPK----INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTIT 64
           ++ YI   +         + S   PSNIAL KYWGK   +  LP N S+S +L    T  
Sbjct: 1   MNTYIRNYSKNELIEDTGRISWTSPSNIALIKYWGKYGHQ--LPCNTSISFTLNESKTTM 58

Query: 65  HITVI--DSDADCIILNGQKISSQSSFFK-KTTQFCDLFRQFSK----VYFLIETSNNIP 117
             +    D+ +D I+L+    + ++  F+ K   F +  R+       +   IE++N+ P
Sbjct: 59  DFSWSSKDTPSDEIVLDFYFENKKNQLFEDKIRAFLEKNRELFPMLKFLNLEIESTNSFP 118

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEK--------SESLSRVARLGSGSACRSFYRGFC 169
             AG+ASSAS  +AL L L  I +             +  + VARL SGSA RS +    
Sbjct: 119 HSAGIASSASSMSALALGLCSIENQAFDLDICEADLIQKATYVARLASGSASRSVFPEVA 178

Query: 170 EWICGT--DQNGMDSFAVPF---NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFF 224
            W   T       D  A P    +  +   R  ++ +   EK + SR          P+ 
Sbjct: 179 SWGENTLTSIKSSDELAAPVEGVHEVFKTYRDSIVIVDGGEKAVSSRAG-HALMEAHPYR 237

Query: 225 TQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
            +  ++ +  +  +   +   D     ++ E  AL++H  M+ ++P  +  +  T+  +E
Sbjct: 238 EERFKRANELVETLYNILKSGDTKSFCDLVETEALELHGLMMNSNPSFILMKPNTLAVIE 297

Query: 285 RVWDARQQ-SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           ++ + R++  + + FTLDAGPN+ +L+   IEE +++F          + 
Sbjct: 298 KIREFRKESGLDLCFTLDAGPNVHILYPQSIEEEVQKFLSSEIKPLAQNG 347


>gi|306831548|ref|ZP_07464706.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|304426333|gb|EFM29447.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
          Length = 316

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 100/310 (32%), Positives = 154/310 (49%), Gaps = 11/310 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDEKE--HAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  D + V  +     L + +L +
Sbjct: 124 TGLNQSELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL M
Sbjct: 177 SDSKKPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTDETYAAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEENLERLTKR 296

Query: 322 FPEITIIDPL 331
           F E   +   
Sbjct: 297 FEENYRVIAS 306


>gi|325978456|ref|YP_004288172.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325178384|emb|CBZ48428.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 316

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 99/310 (31%), Positives = 154/310 (49%), Gaps = 11/310 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDEKE--HAKISAIIDQYRGGRSEFVRVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  D + V  +     L + +L +
Sbjct: 124 TGLNQSELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL M
Sbjct: 177 SDSKKPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y   +T   M+ V   R Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTDKTYAAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEEDLERLTKR 296

Query: 322 FPEITIIDPL 331
           F E   +   
Sbjct: 297 FEENYRVIAS 306


>gi|316966922|gb|EFV51437.1| diphosphomevalonate decarboxylase [Trichinella spiralis]
          Length = 366

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/314 (29%), Positives = 151/314 (48%), Gaps = 12/314 (3%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCI 76
           +           P N+AL KYWGKRD +  LPLN+SLS+++  L   T +T+ D   D +
Sbjct: 2   SLPHGHSVHVRAPVNLALVKYWGKRDEREMLPLNDSLSMNINELFVDTRVTISDGSNDRV 61

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTL 134
           +LNG++I      F +  +  D  R+   +   F++++ +  P  AGLASS++GFAA+  
Sbjct: 62  VLNGKEIVGVQ--FSRFKRCFDEARRIGGIKQCFVVQSESLFPVSAGLASSSAGFAAIAF 119

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEW---ICGTDQNGMDSFAVPFNNQW 191
           A+ ++ +      ++S VARLGSGSACR  Y GF  W   +  ++        V     W
Sbjct: 120 AIGKMLNWDVD--TMSHVARLGSGSACRGVYPGFVHWMAELAQSNDTRNKCEVVALPEHW 177

Query: 192 PDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAIIDQDFIKL 250
           P+L + +L   D  K+  S + M  +   S       +      +  +++AI  +DF KL
Sbjct: 178 PELTVIVLIGSDEAKRWSSTDGMRRSVATSKLLKYRAECCVPERIEKVRRAIQARDFAKL 237

Query: 251 GEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTLDAGPNLKL 308
                +++ ++HA  +   PPLLY  + + Q M  V           + ++ DAG N  L
Sbjct: 238 AVEVMRDSCQLHAICLDTYPPLLYLTEFSRQVMLMVHHYNDVCGRPKVAYSFDAGSNCFL 297

Query: 309 LFTHKIEETIKQFF 322
           L      E +  + 
Sbjct: 298 LCLESEVEHLLAYV 311


>gi|297621344|ref|YP_003709481.1| putative diphosphomevalonate decarboxylase [Waddlia chondrophila
           WSU 86-1044]
 gi|297376645|gb|ADI38475.1| putative diphosphomevalonate decarboxylase [Waddlia chondrophila
           WSU 86-1044]
          Length = 311

 Score =  269 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 160/298 (53%), Gaps = 16/298 (5%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQ 86
             PS +AL KYWGK ++ LNLP  +SL++SL  L T T +++   + D I +NG++    
Sbjct: 8   TSPS-LALIKYWGKSNTALNLPATSSLAVSLDTLRTKTTVSIS--EDDRIFINGKQAPI- 63

Query: 87  SSFFKKTTQFCDLFRQ--FSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPE 144
               ++   F + FR+   S   F   +S N P  AGLASS+SGFAAL L   R+ +   
Sbjct: 64  ----ERFRSFFENFRKTTGSDQRFSAYSSTNFPVAAGLASSSSGFAALALGCARLINPEI 119

Query: 145 KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDR 204
             E++S +AR GS SA RS + GF       + +       P N  WP+LR+ +  + + 
Sbjct: 120 PLETISSLARFGSASAARSLFGGFTILKKDAESS------EPLNIDWPELRVIIGIVTNS 173

Query: 205 EKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHAT 264
            K+I SREAME  R  SPF+  W ++     +    A+  ++   LG +  ++ L M +T
Sbjct: 174 SKEISSREAMECARETSPFYDSWLKKADEFFSQSVPAVQKRELNTLGPLIRQSYLSMFST 233

Query: 265 MIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           M+ ++P  LYW+ E++  +    + RQ+ I I+ T+DAGP +K++      ++  Q  
Sbjct: 234 MLTSTPSTLYWKPESVALLHSCEELRQEGISIWETMDAGPQVKMVCLEHDLDSALQRL 291


>gi|288905466|ref|YP_003430688.1| diphosphomevalonate decarboxylase [Streptococcus gallolyticus
           UCN34]
 gi|288732192|emb|CBI13757.1| putative diphosphomevalonate decarboxylase [Streptococcus
           gallolyticus UCN34]
          Length = 316

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 100/310 (32%), Positives = 154/310 (49%), Gaps = 11/310 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAVKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDEKE--HAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  D + V  +     L + +L +
Sbjct: 124 TGLNQSELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL M
Sbjct: 177 SDSKKPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLKANDFEKVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTDETYAAMDFVKSLRTQGEKCYFTMDAGPNVKVLCLEEDLECLTKR 296

Query: 322 FPEITIIDPL 331
           F E   +   
Sbjct: 297 FEENYRVIAS 306


>gi|332664945|ref|YP_004447733.1| diphosphomevalonate decarboxylase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332333759|gb|AEE50860.1| diphosphomevalonate decarboxylase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 379

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 93/334 (27%), Positives = 149/334 (44%), Gaps = 32/334 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDAD------CIILN 79
              PSNIA+ KYWGK   +  LP N S+S +L    T T  + +  +             
Sbjct: 38  WQSPSNIAIVKYWGKHGQQ--LPRNPSISFTLQAAYTETEFSYVPRETTGEEISLDFFFE 95

Query: 80  GQKISSQSSFFKKTTQFC------DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALT 133
           GQ   +Q++F +K  +F       ++    ++ +  I ++N+ P  AG+ASSAS  +AL 
Sbjct: 96  GQ---AQAAFAQKIVKFLSALAAEEILPFLTQFHLTIHSANSFPHSAGIASSASSMSALA 152

Query: 134 LALFRIY--------SIPEKSESLSRVARLGSGSACRSFYRGFCEWIC-----GTDQNGM 180
           L L  +            E     S +ARLGSGSACRS Y     W       G+     
Sbjct: 153 LCLCSMEQELFGTLTDPVEFYRKASFLARLGSGSACRSLYPVMGSWGKIEKQAGSSDLWG 212

Query: 181 DSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
              A   +  +      +L +   EK + SR   +     +P+     QQ + +L  +  
Sbjct: 213 SPCADWVHPVFHTFHDDILIVSKGEKSVSSRAGHQ-LMEGNPYANARYQQATNNLDQLVD 271

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFT 299
            +   D    G++AE  AL +HA M+++ PP L  +  ++  +E++   R  +  P+YFT
Sbjct: 272 ILKSGDVHAFGQIAELEALTLHALMMSSQPPYLLMKPNSLAMIEKIRQYRLDTQQPLYFT 331

Query: 300 LDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDS 333
           LDAGPNL LL+  +I   +  F     +    + 
Sbjct: 332 LDAGPNLHLLYPAEIAGHVAPFIQAELLPLCEEG 365


>gi|139473958|ref|YP_001128674.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes str.
           Manfredo]
 gi|134272205|emb|CAM30451.1| mevalonate diphosphate decarboxylase [Streptococcus pyogenes str.
           Manfredo]
          Length = 314

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QNDEE--HTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACNQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|306833699|ref|ZP_07466826.1| diphosphomevalonate decarboxylase [Streptococcus bovis ATCC 700338]
 gi|304424469|gb|EFM27608.1| diphosphomevalonate decarboxylase [Streptococcus bovis ATCC 700338]
          Length = 316

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 100/310 (32%), Positives = 154/310 (49%), Gaps = 11/310 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQ 81
            +    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++ +      D   +NG 
Sbjct: 6   VTVKSYANIAIIKYWGKADAIKMIPATSSISLTLENMFTTTTVSFLPQSVGHDEFYINGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               +     K +   D +R     +  +ETSNN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQDEKE--HAKISAIIDQYRGGRSEFVKVETSNNMPTAAGLSSSSSGLSALVKACNELFE 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
                  L++ A+  SGS+ RSF+     W    D++  D + V  +     L + +L +
Sbjct: 124 TGLNQSELAQKAKFASGSSSRSFFGPIAAW----DKDSGDIYPVQTD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D +K I SRE M+     S  F  W +Q   D   +   +   DF K+GE+ E+NAL M
Sbjct: 177 SDSKKPISSREGMKRCAETSTTFADWVKQSEQDYKDMLAYLEANDFEKVGELTERNALAM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y   ET   M+ V   R Q    YFT+DAGPN+K+L   +  E + + 
Sbjct: 237 HDTNTHANPPFNYLTNETYTAMDFVKSLRAQGEKCYFTMDAGPNVKVLCLEEDLERLTKR 296

Query: 322 FPEITIIDPL 331
           F E   +   
Sbjct: 297 FEENYRVIAS 306


>gi|300173495|ref|YP_003772661.1| diphosphomevalonate decarboxylase [Leuconostoc gasicomitatum LMG
           18811]
 gi|299887874|emb|CBL91842.1| diphosphomevalonate decarboxylase [Leuconostoc gasicomitatum LMG
           18811]
          Length = 316

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 160/305 (52%), Gaps = 12/305 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
            ++    +NIAL KYWGK+D  LNLP  +SLSL+L    T T +T  ++ +D +ILN   
Sbjct: 2   STTVTAHTNIALIKYWGKKDPILNLPTTSSLSLTLEQFYTQTTVT-PNTHSDQLILNNLS 60

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY--FLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           + +      +T  F ++ R+    +    + ++N++PT AGLASSAS FAALT A+    
Sbjct: 61  VDTT-----RTHHFLNVLREQLGNFSPLTVTSTNHVPTSAGLASSASAFAALTGAVTHEL 115

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +   +ESLSR+AR GSGSA RS Y  F  W  G D     SFA   +     + + + +
Sbjct: 116 GLEMSNESLSRLARRGSGSASRSLYGHFAVWHEGMDDLS--SFAESLHAPDMPIALVVAE 173

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           +    KK+ S E M      SP +  W  Q       ++ AI+ +D  K+G +AE NAL 
Sbjct: 174 VSSDVKKVSSSEGMRRAM-TSPNYGDWLNQSKNQFVDMQAAIMTRDIEKIGSIAEDNALS 232

Query: 261 MHATMIAA-SPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
           MHA  + A      Y+  ET Q ++ + D R Q +  + T+DAGPN+K++ T      + 
Sbjct: 233 MHALNLTARQQAFTYFTSETQQILKIIQDIRHQGLLAFATIDAGPNVKIITTLTTAPHVV 292

Query: 320 QFFPE 324
               +
Sbjct: 293 AALHD 297


>gi|329768011|ref|ZP_08259522.1| diphosphomevalonate decarboxylase [Gemella haemolysans M341]
 gi|328838496|gb|EGF88104.1| diphosphomevalonate decarboxylase [Gemella haemolysans M341]
          Length = 303

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 96/295 (32%), Positives = 154/295 (52%), Gaps = 11/295 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGK+     LP N ++SL L +L + T I   D++ D   +N +K S +    
Sbjct: 10  NIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKNDNNVDEFYINDEKQSQEE--V 67

Query: 91  KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
            K  +F   F    +    I + N +PT AGL+SS+SG  AL LA    + + + ++ L 
Sbjct: 68  DKMIKFISKFTPTEREAITIRSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKTTKELV 127

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGS 210
            +A+ GSGS+CRSFY     W+       ++           D  + +L + +  KKI S
Sbjct: 128 EIAKEGSGSSCRSFY-KLAAWLEDGSVEELECS--------LDFGMMVLVVNEDRKKISS 178

Query: 211 REAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP 270
           R AME     S  F  W ++   D   +K+A+ + DF K+GE+ E NAL MH T   ++P
Sbjct: 179 RVAMERCVQTSTTFDAWVEKAKNDFVLMKEALKEADFEKIGEITESNALAMHGTTSTSTP 238

Query: 271 PLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              +  +E+   M+ V + R +    YFT+DAGPN+K+L+  + ++ + +   ++
Sbjct: 239 SFSFLTEESHMAMDIVKELRSKGHRCYFTMDAGPNVKVLYLREDQDKLYEEISKL 293


>gi|50914046|ref|YP_060018.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10394]
 gi|50903120|gb|AAT86835.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10394]
          Length = 314

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 102/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QNDEE--HTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|332075233|gb|EGI85703.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA17570]
          Length = 298

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 94/301 (31%), Positives = 154/301 (51%), Gaps = 11/301 (3%)

Query: 38  WGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQSSFFKKTTQ 95
            GK   K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ  +       K ++
Sbjct: 1   MGKEKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE--HAKMSK 58

Query: 96  FCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL 155
             D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +      L++ A+ 
Sbjct: 59  IIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKF 118

Query: 156 GSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAME 215
            SGS+ RSFY     W    D++  + + V  +     L + +L + D++K I SR+ M+
Sbjct: 119 ASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVLEDKKKPISSRDGMK 171

Query: 216 ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW 275
           +    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   ASP   Y 
Sbjct: 172 LCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATTKTASPAFSYL 231

Query: 276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
              + + M+ V   R++    YFT+DAGPN+K+    K  E + + F +   +    + D
Sbjct: 232 TDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQRYRLIVSKTKD 291

Query: 336 L 336
           L
Sbjct: 292 L 292


>gi|19745945|ref|NP_607081.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes
           MGAS8232]
 gi|19748103|gb|AAL97580.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes
           MGAS8232]
          Length = 314

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 166/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVISYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++  
Sbjct: 67  QNDEE--HTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|309805049|ref|ZP_07699105.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           09V1-c]
 gi|308165640|gb|EFO67867.1| diphosphomevalonate decarboxylase [Lactobacillus iners LactinV
           09V1-c]
          Length = 290

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 151/289 (52%), Gaps = 11/289 (3%)

Query: 60  LGTITHITVI-DSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNI 116
             T T  T   D   D +I+NG+ ++ Q+S+  +   +    +       +F I+T N++
Sbjct: 4   FYTETEFTHNVDLANDMVIMNGKAVNDQASY--RIINYVKKLQDIYGFNDHFCIKTENHV 61

Query: 117 PTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTD 176
           PT AGLASSASGFAAL  +    Y++    + LSR+AR+GSGSA RS + GF EW  G D
Sbjct: 62  PTAAGLASSASGFAALATSFAASYNLNLNRQELSRIARIGSGSATRSIFGGFVEWQKGYD 121

Query: 177 QNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLA 236
                +F +  + Q  DL +  +++    K+I S   M+     SPF+  W  +   +++
Sbjct: 122 DQTSFAFPINEHPQ-MDLTMLAIELDVSPKEISSTCGMK-IAQTSPFYQTWLNRNKQEIS 179

Query: 237 HIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPI 296
            ++ AI + +F +LGE++E +A +MH+  + A P   Y+Q  TI  M  V + R+  I  
Sbjct: 180 EMESAIKNNNFTRLGELSELSANEMHSLNLTAMPSFSYFQPTTITIMNLVRNLRKNGIEC 239

Query: 297 YFTLDAGPNLKLLFTHKIEETIKQFFPE----ITIIDPLDSPDLWSTKD 341
           Y+T+DAGPN+K+L   K  E I +        + II     P +     
Sbjct: 240 YYTIDAGPNVKILCQDKNVEDICKAIHNTLDSVKIIKSKFGPGVQIINC 288


>gi|56808906|ref|ZP_00366615.1| COG3407: Mevalonate pyrophosphate decarboxylase [Streptococcus
           pyogenes M49 591]
 gi|209559230|ref|YP_002285702.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes NZ131]
 gi|209540431|gb|ACI61007.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes NZ131]
          Length = 314

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 166/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++  
Sbjct: 67  QNDEE--HTKISTIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|15674902|ref|NP_269076.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes M1
           GAS]
 gi|71910496|ref|YP_282046.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS5005]
 gi|13622042|gb|AAK33797.1| mevalonate pyrophosphate decarboxylase [Streptococcus pyogenes M1
           GAS]
 gi|71853278|gb|AAZ51301.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS5005]
          Length = 314

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 166/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGIL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++  
Sbjct: 67  QNDEE--HTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|71903328|ref|YP_280131.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS6180]
 gi|94990250|ref|YP_598350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10270]
 gi|9937401|gb|AAG02451.1|AF290097_2 mevalonate diphosphate decarboxylase [Streptococcus pyogenes]
 gi|71802423|gb|AAX71776.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS6180]
 gi|94543758|gb|ABF33806.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10270]
          Length = 314

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 102/317 (32%), Positives = 166/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  +++  
Sbjct: 67  QNDEE--HTKISTIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|94988369|ref|YP_596470.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS9429]
 gi|94992251|ref|YP_600350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS2096]
 gi|94994171|ref|YP_602269.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10750]
 gi|306827526|ref|ZP_07460809.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes ATCC
           10782]
 gi|94541877|gb|ABF31926.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS9429]
 gi|94545759|gb|ABF35806.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes MGAS2096]
 gi|94547679|gb|ABF37725.1| Diphosphomevalonate decarboxylase [Streptococcus pyogenes
           MGAS10750]
 gi|304430324|gb|EFM33350.1| diphosphomevalonate decarboxylase [Streptococcus pyogenes ATCC
           10782]
          Length = 314

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 25  SAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID--SDADCIILNGQK 82
           +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T I+ +   + +D   +NG  
Sbjct: 7   TVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSISFLPDTATSDQFYINGVL 66

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
            + +     K +   D FRQ  + +  +ET NN+PT AGL+SS+SG +AL  A  ++++ 
Sbjct: 67  QNDEE--HTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFNT 124

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               ++L++ A+  SGS+ RSF+     W         DS A+        + + +L + 
Sbjct: 125 QLDQKALAQKAKFASGSSSRSFFGPVAAWDK-------DSGAIYKVETDLKMAMIMLVLN 177

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             +K I SRE M++ R  S  F +W +Q + D  H+   +   +F K+G++ E NAL MH
Sbjct: 178 AAKKPISSREGMKLCRDTSTTFDEWVEQSAIDYQHMLTYLKTNNFEKVGQLTEANALAMH 237

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K    + +  
Sbjct: 238 ATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLAQLAERL 297

Query: 323 PEITIIDPLDSPDLWST 339
            +   I    + DL   
Sbjct: 298 GKNYRIIVSKTKDLPDV 314


>gi|332204404|gb|EGJ18469.1| diphosphomevalonate decarboxylase [Streptococcus pneumoniae
           GA47901]
          Length = 298

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 94/301 (31%), Positives = 153/301 (50%), Gaps = 11/301 (3%)

Query: 38  WGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS--DADCIILNGQKISSQSSFFKKTTQ 95
            GK   K  +P  +S+SL+L ++ T T ++ + +   AD   +NGQ  +       K ++
Sbjct: 1   MGKEKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEFYINGQLQNEVE--HAKMSK 58

Query: 96  FCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARL 155
             D +R   + +  I+T NN+PT AGL+SS+SG +AL  A    + +      L++ A+ 
Sbjct: 59  IIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKF 118

Query: 156 GSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAME 215
            SGS+ RSFY     W    D++  + + V  +     L + +L + D++K I SR+ M+
Sbjct: 119 ASGSSSRSFYGPLGAW----DKDSGEIYPVETD---LKLAMIMLVLEDKKKPISSRDGMK 171

Query: 216 ITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYW 275
           +    S  F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   ASP   Y 
Sbjct: 172 LCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATTKTASPAFSYL 231

Query: 276 QKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPD 335
              + + M  V   R++    YFT+DAGPN+K+    K  E + + F +   +    + D
Sbjct: 232 TDASYEAMAFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQRYRLIVSKTKD 291

Query: 336 L 336
           L
Sbjct: 292 L 292


>gi|329947849|ref|ZP_08294781.1| diphosphomevalonate decarboxylase [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328523473|gb|EGF50571.1| diphosphomevalonate decarboxylase [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 344

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 107/312 (34%), Positives = 157/312 (50%), Gaps = 10/312 (3%)

Query: 21  NEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC--IIL 78
              ++A   +NIAL KYWGK D  L +P  +SLSL+L    T T ++      D   + +
Sbjct: 12  TASATASANTNIALIKYWGKADESLMIPTTSSLSLTLDDTWTTTTVSFDGGTGDTDAVSI 71

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLAL 136
           NG   +   +   + + F DL R+ S +     + + + +P  AGLASSA+GFAAL  A 
Sbjct: 72  NG--SAPSGTALTRVSGFLDLVRERSGITQRANVTSISTVPLAAGLASSAAGFAALAAAA 129

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN----NQWP 192
            R   +     +LSR+AR GSGSA RS + G   W  G D     +  V           
Sbjct: 130 SRAAGMDLDGRALSRLARRGSGSAARSVFGGLVLWNAGDDDATSYAEPVQDAIGHTASDL 189

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL + ++ +    K I S  AM  T   SP +  W +    DL    +A+   D  +LG+
Sbjct: 190 DLAMVVVVLSGGRKTISSTRAMRRTMTASPLYPAWVEASRQDLRDALEAVRCGDLARLGK 249

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTH 312
           VAE NAL MHA+M+AA P ++YW   TI+ +  + + RQ  +P + T+DAGPN+K+L   
Sbjct: 250 VAEANALGMHASMMAARPAIMYWLPRTIEVLHVIGEMRQDGLPAWATIDAGPNVKVLTRG 309

Query: 313 KIEETIKQFFPE 324
              E +     E
Sbjct: 310 GSAERVAAALRE 321


>gi|319745283|gb|EFV97601.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae ATCC
           13813]
          Length = 314

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 101/317 (31%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           +  S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T    D+  D   ++
Sbjct: 4   KSISVKSYANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYIS 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   +       K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQNDHE--HDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +        L++ A+  SGS+ RSF+     W    D++  D + V   +   DL + +L
Sbjct: 122 FGTNLSQSQLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKV---HTDLDLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D+ K I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL
Sbjct: 175 VLNDKRKPISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MH+T   A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L   +  + + 
Sbjct: 235 AMHSTTKTATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVLCLRQDLDALA 294

Query: 320 QFFPEITIIDPLDSPDL 336
               +   I    + +L
Sbjct: 295 TILEQDYRIIVSTTKEL 311


>gi|241888607|ref|ZP_04775914.1| diphosphomevalonate decarboxylase [Gemella haemolysans ATCC 10379]
 gi|241864630|gb|EER69005.1| diphosphomevalonate decarboxylase [Gemella haemolysans ATCC 10379]
          Length = 303

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 95/295 (32%), Positives = 154/295 (52%), Gaps = 11/295 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFF 90
           NIAL KYWGK+     LP N ++SL L +L + T I   +++ D   +N +K S +    
Sbjct: 10  NIALVKYWGKKSKDPVLPYNPNISLRLDNLLSKTKIEKNNNNIDEFYINDEKQSQEE--V 67

Query: 91  KKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLS 150
            K  +F   F   ++    I + N +PT AGL+SS+SG  AL LA    + + + ++ L 
Sbjct: 68  DKMIKFISKFTPTNREAITIRSYNTVPTAAGLSSSSSGTMALVLACNEYFKLNKTTKELV 127

Query: 151 RVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGS 210
            +A+ GSGS+CRSFY     W+       +            D  + +L + +  KKI S
Sbjct: 128 EIAKEGSGSSCRSFY-KLAAWLEDGSVEELQCS--------LDFGMMVLVVNEDRKKISS 178

Query: 211 REAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASP 270
           R AME     S  F  W ++   D   +K+A+ D +F K+GE+ E NAL MH T   ++P
Sbjct: 179 RVAMERCVQTSTTFDAWVEKAKGDFVLMKEALKDANFEKIGEITESNALAMHGTTSTSTP 238

Query: 271 PLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              +  +E+   M+ V + R +    YFT+DAGPN+K+L+  + ++ + +   ++
Sbjct: 239 SFSFLTEESHMAMDIVKELRSKGYKCYFTMDAGPNVKVLYLREDQDKLYEEISKL 293


>gi|22537472|ref|NP_688323.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae
           2603V/R]
 gi|77409167|ref|ZP_00785879.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae COH1]
 gi|22534350|gb|AAN00196.1|AE014252_19 diphosphomevalonate decarboxylase [Streptococcus agalactiae
           2603V/R]
 gi|77172213|gb|EAO75370.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae COH1]
          Length = 314

 Score =  261 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           +  S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T    D+  D   ++
Sbjct: 4   KSISVKSYANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYIS 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   +       K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQNDHE--HDKMSAILDRFRQNRSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +        L++ A+  SGS+ RSF+     W    D++  D + V  N    DL + +L
Sbjct: 122 FGTNLSQSQLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTN---LDLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D+ K I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL
Sbjct: 175 VLNDKRKPISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MH+T   A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L   +  E + 
Sbjct: 235 AMHSTTKTATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVLCLRQDLEALA 294

Query: 320 QFFPEITIIDPLDSPDL 336
               +   I    + +L
Sbjct: 295 AILEKDYRIIVSTTKEL 311


>gi|76798602|ref|ZP_00780830.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 18RS21]
 gi|76586036|gb|EAO62566.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 18RS21]
          Length = 314

 Score =  261 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           +  S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T    D+  D   ++
Sbjct: 4   KSISVKSYANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTALGKDAKKDEFYIS 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   +       K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQNDHE--HDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +        L++ A+  SGS+ RSF+     W    D++  D + V  N    DL + +L
Sbjct: 122 FGTNLSQSQLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKVHTN---LDLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D+ K I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL
Sbjct: 175 VLNDKRKPISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MH+T   A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L   +  E + 
Sbjct: 235 AMHSTTKTATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVLCLRQDLEALA 294

Query: 320 QFFPEITIIDPLDSPDL 336
               +   I    + +L
Sbjct: 295 AILEKDYRIIVSTTKEL 311


>gi|25011437|ref|NP_735832.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae NEM316]
 gi|76787545|ref|YP_329966.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae A909]
 gi|77406855|ref|ZP_00783883.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae H36B]
 gi|77411154|ref|ZP_00787506.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae CJB111]
 gi|77414083|ref|ZP_00790252.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 515]
 gi|24412975|emb|CAD47054.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562602|gb|ABA45186.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae A909]
 gi|77159881|gb|EAO71023.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae 515]
 gi|77162772|gb|EAO73731.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae CJB111]
 gi|77174528|gb|EAO77369.1| diphosphomevalonate decarboxylase [Streptococcus agalactiae H36B]
          Length = 314

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 102/317 (32%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILN 79
           +  S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T +T    D+  D   ++
Sbjct: 4   KSISVKSYANIAIIKYWGKADAEKMIPATSSISLTLENMYTETRLTTLGKDAKKDEFYIS 63

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           G   +       K +   D FRQ    +  IET+NN+PT AGL+SS+SG +AL  A    
Sbjct: 64  GVLQNDHE--HDKMSAILDRFRQNKSGFVKIETTNNMPTAAGLSSSSSGLSALVKACNDF 121

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +        L++ A+  SGS+ RSF+     W    D++  D + V   +   DL + +L
Sbjct: 122 FGTNLSQSQLAQEAKFASGSSSRSFFGPVAAW----DKDSGDIYKV---HTDLDLAMIML 174

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            + D+ K I SRE M+I    S  F +W +Q   D   +   + + DF K+G++ E+NAL
Sbjct: 175 VLNDKRKPISSREGMKICTETSTTFNEWVRQSEQDYQDMLVYLKNNDFQKVGQLTERNAL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            MH+T   A+P   Y  +ET + M+ V   R++    Y+T+DAGPN+K+L   +  E + 
Sbjct: 235 AMHSTTKTATPAFSYLTEETYKAMDVVKKLREKGHECYYTMDAGPNVKVLCLRQDLEALA 294

Query: 320 QFFPEITIIDPLDSPDL 336
               +   I    + +L
Sbjct: 295 AILEKDYRIIVSTTKEL 311


>gi|228478303|ref|ZP_04062911.1| diphosphomevalonate decarboxylase [Streptococcus salivarius SK126]
 gi|228249982|gb|EEK09252.1| diphosphomevalonate decarboxylase [Streptococcus salivarius SK126]
          Length = 314

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/317 (30%), Positives = 169/317 (53%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++    D+  D + ++ +
Sbjct: 6   VSVKSYANIAIVKYWGKADAERMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  DLFR  S  +  IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDLFRNNSNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L   +  + + + 
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVLCLEEDLDRLAEH 296

Query: 322 FPEITIIDPLDSPDLWS 338
           F +   +    + +L  
Sbjct: 297 FRKDYQVIVSRTKELPD 313


>gi|312863780|ref|ZP_07724018.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis
           F0396]
 gi|322517210|ref|ZP_08070092.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis ATCC
           49124]
 gi|311101316|gb|EFQ59521.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis
           F0396]
 gi|322124197|gb|EFX95721.1| diphosphomevalonate decarboxylase [Streptococcus vestibularis ATCC
           49124]
          Length = 314

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 94/317 (29%), Positives = 167/317 (52%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D++  +P  +S+SL+L ++ T T ++    D+  D + ++ +
Sbjct: 6   VSVKSYANIAIVKYWGKADAERMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  DLFR     +  IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDLFRTNPNQHVKIETCNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLSAW----DKDSGEVYQVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSEQDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  + + + M++V   R      YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HQTTSTANPPFSYLTEASYRAMDKVKALRASGEQCYFTMDAGPNVKVLCLEEDLDRLSDH 296

Query: 322 FPEITIIDPLDSPDLWS 338
           F +   +    + +L  
Sbjct: 297 FRKDYQVIVSRTKELPD 313


>gi|118372050|ref|XP_001019222.1| diphosphomevalonate decarboxylase family protein [Tetrahymena
           thermophila]
 gi|89300989|gb|EAR98977.1| diphosphomevalonate decarboxylase family protein [Tetrahymena
           thermophila SB210]
          Length = 432

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 98/381 (25%), Positives = 157/381 (41%), Gaps = 61/381 (16%)

Query: 13  IGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVID 70
           I      +  K++     NIAL KYWGK D +  LPLN+S  ++L    L T T IT+ +
Sbjct: 2   ITVKGDILKVKTTYETSPNIALVKYWGKFDEEYILPLNSSTGITLSTEDLQTRTTITLTN 61

Query: 71  SDAD-CIILNGQKISSQSSFFKKTTQFCD------------------------------L 99
              D   +LNGQ     S   KK  +F +                              L
Sbjct: 62  KYKDIKFLLNGQPHPV-SGRLKKILKFFEDKALAALGEELVPLQEGESQDTKRKTLKEFL 120

Query: 100 FRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE-SLSRVARLGSG 158
               S++   I++ N+ PT +GLASSASG AAL++ LF +Y + E+ E   S +ARLGSG
Sbjct: 121 NGDLSQLKLKIKSVNSFPTASGLASSASGLAALSVCLFDVYHMKEEYEFQRSVIARLGSG 180

Query: 159 SACRSFYRGFCEW----------------------ICGTDQNGMDSFAVPFNNQ--WPDL 194
           SA RS Y G  EW                          +Q      A   +N+  + DL
Sbjct: 181 SASRSIYGGLVEWTGVPHQYLQKKFESKNNEIQLSEQEYEQLSKLCIAKQTHNETFFEDL 240

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIIDQDFIKLGEV 253
            + ++      K++ S   M  +   S              +A +K+AI ++++ +L  +
Sbjct: 241 DVFVVAYSFESKEVPSTSGMLQSTQTSELLKYRALNTAHVHIAGVKKAIEEKNYNELARL 300

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQ-SIPIYFTLDAGPNLKLLFTH 312
              ++ + HA  +  +PP+ Y    +   +  +          + +T DAGP+  LL   
Sbjct: 301 VRLDSNQFHAVCLDTTPPIFYLNDFSKNMINFIHQLDSALEYHVAYTFDAGPHAVLLVHK 360

Query: 313 KIEETIKQFFPEITIIDPLDS 333
                + +   E   I+ + S
Sbjct: 361 NHTTQVLRAIYEAFSINDMSS 381


>gi|322372484|ref|ZP_08047020.1| diphosphomevalonate decarboxylase [Streptococcus sp. C150]
 gi|321277526|gb|EFX54595.1| diphosphomevalonate decarboxylase [Streptococcus sp. C150]
          Length = 314

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 95/317 (29%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++    D+  D + ++ +
Sbjct: 6   VSVKSYANIAIVKYWGKADTKRMIPSTSSISLTLENMYTETKLSFLPEDATGDVMYIDDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  D FR     +  IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDFFRTNPNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYQVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIKQSVLDYKDMLAYLKTNDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y    + Q M++V   R      YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HQTTSTANPPFSYLTDASYQAMDKVKALRASGEQCYFTMDAGPNVKVLCLEEDLDRLADH 296

Query: 322 FPEITIIDPLDSPDLWS 338
           F +   +    + +L  
Sbjct: 297 FRKDYQVIVSRTKELPD 313


>gi|297242909|ref|ZP_06926847.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis AMD]
 gi|296889120|gb|EFH27854.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis AMD]
          Length = 365

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 115/313 (36%), Positives = 162/313 (51%), Gaps = 6/313 (1%)

Query: 9   LHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV 68
           +   I          + A   +NIAL KYWGKRD KL LP  +SLSL+L  L T T ++ 
Sbjct: 6   IQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVSF 65

Query: 69  IDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASS 125
            ++ + D   L+ +KIS  +  F++     DL R+ + +     + + N +PT AGLASS
Sbjct: 66  ANNLEQDTFTLDNEKISPSAKTFRRVVAMLDLVREIAGISTKASVISHNIVPTAAGLASS 125

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASGFAAL  A      +      LSR+AR GSGSACRS + G   W  G D     +  +
Sbjct: 126 ASGFAALASAASYAAGLNLTPRELSRLARRGSGSACRSIFGGLSIWHAGCDDETSYAEPI 185

Query: 186 ---PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAI 242
                  +  +L + ++ + D +K I SREAM  T   SP + QW +Q   DL   K AI
Sbjct: 186 ENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQSKDDLEIAKNAI 245

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA 302
              D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R+    ++ T+DA
Sbjct: 246 QRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMRKDGWLVWSTMDA 305

Query: 303 GPNLKLLFTHKIE 315
           GPN+K+L +    
Sbjct: 306 GPNVKVLTSGDDA 318


>gi|256088146|ref|XP_002580219.1| diphosphomevalonate decarboxylase [Schistosoma mansoni]
 gi|238665734|emb|CAZ36458.1| diphosphomevalonate decarboxylase [Schistosoma mansoni]
          Length = 387

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 99/348 (28%), Positives = 143/348 (41%), Gaps = 24/348 (6%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHI---TVIDSDADCIILNGQK- 82
             P NIAL KYWGK D     P  +S+SL+L      T     T  D       LNG+  
Sbjct: 2   TCPVNIALLKYWGKGDDLNIYPSTSSISLTLNQAHVGTKTAMFTKNDLKESLFKLNGKLL 61

Query: 83  ------ISSQSSFFKKTTQFCDLF--RQFSKVYFLIETSNNIPTKAGLASSASGFAALTL 134
                 +S  +  F K  Q       R     +  +E+ NN PT AGLASSASG AA   
Sbjct: 62  DVLIVGMSIFTILFIKLAQLRSRLDGRLVPSPFLCVESENNFPTSAGLASSASGTAAFAF 121

Query: 135 ALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDL 194
           AL  +Y +     SLSR     S   CRS   GF +W      +      +   + WP+L
Sbjct: 122 ALGTMYGLDGDYTSLSRRGSGSS---CRSLLGGFVQW-SNNHDDHTSVQQLFPASYWPEL 177

Query: 195 RIGLLKIIDREKKIGSREAMEITRHHSPFFTQ-WTQQISTDLAHIKQAIIDQDFIKLGEV 253
           R+ +    +  K +GS +AM      S  F              I  A+ D+DF  L EV
Sbjct: 178 RVLICVTNENPKPVGSTDAMLCCVKTSYLFRNGRVPSSKIHEKEIISALKDRDFSALAEV 237

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIP--IYFTLDAGPNLKLLFT 311
             + + ++HA  +   PP +Y  + +   M+ V       +   + +T DAGPN  LL  
Sbjct: 238 TMRESNQLHALCLDTWPPCIYLNELSHSIMDFVHSINNYFMKNVVAYTFDAGPNAFLLTE 297

Query: 312 HKIEETIKQFFPE-----ITIIDPLDSPDLWSTKDSLSQKNSIELGIS 354
            +    + ++  E     +     +++ D  + K   S K     GIS
Sbjct: 298 SQNISVVLKYLVECFGYTVEADSFVNNADKITIKCMNSNKYLKITGIS 345


>gi|297699432|ref|XP_002826792.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pongo abelii]
          Length = 399

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 99/366 (27%), Positives = 149/366 (40%), Gaps = 43/366 (11%)

Query: 16  CNPKINEKSSAFLPSNIALCKY-------W---GK---RDSKLN------LPLNNSLSLS 56
            + K     +   P NIA+ KY       W   G+   R   +       +P+  S +  
Sbjct: 2   ASEKPLAAVTCTAPVNIAVIKYCECRGPAWDGDGRERGRGPSVQESASAYVPVMGSRAAW 61

Query: 57  LGHLGTITHITVIDSDADCIILNGQKISSQSSFF--------KKTTQFCDLFRQFSKVYF 108
           LG      H     S      LN Q     S  F        ++ ++  D          
Sbjct: 62  LG----TRHACWAASSKAVAHLNDQLGLGLSGVFLVRCLAQKRRNSRDGDPLPSSLSFKV 117

Query: 109 LIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGF 168
            + + NN PT AGLASSA+G+A L   L R+Y +      LS VAR GSGSACRS Y GF
Sbjct: 118 HVASVNNFPTAAGLASSAAGYACLAYTLARVYGVE---SDLSEVARRGSGSACRSLYGGF 174

Query: 169 CEWICGTDQNGMDSFA--VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQ 226
            EW  G   +G DS A  V   + WP+LR+ +L +   +K  GS   M  +   SP    
Sbjct: 175 VEWQMGEQADGKDSIAWQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRF 234

Query: 227 WTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER 285
                +   +A + + I ++DF    ++  K++ + HAT +   PP+ Y    + + +  
Sbjct: 235 RADSVVPARVAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHL 294

Query: 286 VWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSP-DLWSTKDS 342
           V           + +T DAGPN  +       +T+ +F   +    P  S  D +     
Sbjct: 295 VHRFNAHHGDTKVAYTFDAGPNAVIFALD---DTVAEFVAAVRHSFPPGSNGDTFLKGLQ 351

Query: 343 LSQKNS 348
           LS    
Sbjct: 352 LSPAPL 357


>gi|298253293|ref|ZP_06977085.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis 5-1]
 gi|297532688|gb|EFH71574.1| mevalonate pyrophosphate decarboxylase [Gardnerella vaginalis 5-1]
          Length = 365

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 110/325 (33%), Positives = 154/325 (47%), Gaps = 30/325 (9%)

Query: 9   LHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNS-------------LSL 55
           +   I          + A   +NIAL KYWGKRD KL LP  +S             +S 
Sbjct: 6   IQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVSF 65

Query: 56  SLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETS 113
                       V + + D   L+ +KIS  +  F++     DL R+ + +     + + 
Sbjct: 66  ------------VNNLEQDTFTLDNEKISPSAKPFRRVVAMLDLVREIAGISTKASVISH 113

Query: 114 NNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWIC 173
           N +PT AGLASSASGFAAL  A      +      LSR+AR GSGSACRS + G   W  
Sbjct: 114 NIVPTAAGLASSASGFAALASAASYAAGLNLTPRELSRLARCGSGSACRSIFGGLSIWHA 173

Query: 174 GTDQNGMDSFAV---PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ 230
           G D     +  +       +  +L + ++ + D +K I SREAM  T   SP + QW +Q
Sbjct: 174 GCDDETSYAEPIENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQ 233

Query: 231 ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDAR 290
              DL   K AI   D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R
Sbjct: 234 SKDDLEIAKNAIKRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMR 293

Query: 291 QQSIPIYFTLDAGPNLKLLFTHKIE 315
           +    ++ T+DAGPN+K+L +    
Sbjct: 294 KDGWLVWSTMDAGPNVKVLTSGDDA 318


>gi|149918167|ref|ZP_01906659.1| mevalonate diphosphate decarboxylase [Plesiocystis pacifica SIR-1]
 gi|149820927|gb|EDM80334.1| mevalonate diphosphate decarboxylase [Plesiocystis pacifica SIR-1]
          Length = 344

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 108/321 (33%), Positives = 154/321 (47%), Gaps = 20/321 (6%)

Query: 23  KSSAFLPSNIALCKYWGKR---DSKLNLPLNNSLSLSLGHLGTITHITVIDSD-ADCIIL 78
            + A   SNIAL KYWGKR   D  LNLP   SLS++LG L T T +    +  +D   L
Sbjct: 6   AARAVAHSNIALVKYWGKRAGVDPALNLPAVGSLSMTLGELRTDTTVAPAPAGGSDRFEL 65

Query: 79  NGQKISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALT 133
           +G  +  + +   K     D     + +       ++ + N++PT AGLASSASGFAALT
Sbjct: 66  DGALVEGKPA--AKVFAHLDRLHALAGLEGARPACVVTSINHLPTAAGLASSASGFAALT 123

Query: 134 LALFRIYSIPEKSESLSR-----VARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
           +A    Y + +  +  +R      +R GSGSA RS +  F     G  ++G D  A P  
Sbjct: 124 VAAAGAYGLYDSLDGAARTRLSGWSRQGSGSAARSLWGAFVRLDAGAAEDGSDCIARPLE 183

Query: 189 NQWPDLRIG---LLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQ 245
                       ++      KK+GS   ME +R  SP++  W +    DL   + A+  Q
Sbjct: 184 VPAALAADLRLLVVHTARGAKKVGSTGGMESSRLTSPYYGPWVESSPADLDAAEAALNAQ 243

Query: 246 DFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYF-TLDAGP 304
           DF  LG V E +  KMHA M+A  PPL+YW   T++ +  V   R    P  F T DAGP
Sbjct: 244 DFDALGAVMEHSCFKMHACMLATVPPLIYWNGTTLEVIREVQSVRADGGPKGFVTSDAGP 303

Query: 305 NLKLLFTHKIEETIKQFFPEI 325
           ++K+L      E +      +
Sbjct: 304 HVKVLVRAAEAEDLAAGLAAV 324


>gi|283782813|ref|YP_003373567.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis 409-05]
 gi|283441019|gb|ADB13485.1| diphosphomevalonate decarboxylase [Gardnerella vaginalis 409-05]
          Length = 365

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 116/313 (37%), Positives = 165/313 (52%), Gaps = 6/313 (1%)

Query: 9   LHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV 68
           +   I          + A   +NIAL KYWGKRD KL LP  +SLSL+L  L T T ++ 
Sbjct: 6   IQPKITFDASLSPNSAFAKANANIALIKYWGKRDEKLILPYTSSLSLTLSDLSTTTSVSF 65

Query: 69  IDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASS 125
           +++ + D   L+ +KISS +  F++     DL R+ +++     + + N +PT AGLASS
Sbjct: 66  VNNLEQDTFTLDNEKISSSAKTFRRVVAMLDLVREIARISTKASVISHNIVPTAAGLASS 125

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           ASGFAAL  A      +      LSR+AR GSGSACRS + G   W  G D     +  +
Sbjct: 126 ASGFAALASAASYAAGLNLTPRELSRLARRGSGSACRSIFGGLSIWHAGCDDETSYAEPI 185

Query: 186 ---PFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAI 242
                  +  +L + ++ + D +K I SREAM  T   SP + QW +Q   DL   K AI
Sbjct: 186 ENAQVALKNLNLAMIVVTLDDSKKPISSREAMRRTVETSPTYMQWVEQSKDDLEIAKNAI 245

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDA 302
              D  +LGEV E+NA  MH TM  A P + Y    T   +E V + R+    ++ T+DA
Sbjct: 246 KRADIEQLGEVVERNAFGMHETMHNAVPSVNYLTSSTHIVLEAVKNMRKDGWLVWSTMDA 305

Query: 303 GPNLKLLFTHKIE 315
           GPN+K+L +    
Sbjct: 306 GPNVKVLTSGDDA 318


>gi|290580617|ref|YP_003485009.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           NN2025]
 gi|254997516|dbj|BAH88117.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           NN2025]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 168/307 (54%), Gaps = 10/307 (3%)

Query: 31  NIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNGQKISSQSSF 89
           NIA+ KYWGK ++K  +P  +S+SL+L ++ T T +T+  +++AD   ++   I    + 
Sbjct: 23  NIAIIKYWGKTNTKKMIPATSSISLTLENMYTETRLTLLRNAEADEFYIDH--ILQNEAE 80

Query: 90  FKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
            +K ++  D FR+ +  +  +ETSNN+PT AGL+SS+SG +AL  A    +      E L
Sbjct: 81  HRKISKVLDFFRKETPFFVKVETSNNMPTAAGLSSSSSGLSALVKAANIFFETNATQEEL 140

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
           +++A+  SGS+ RSF+     W    D++  + + VP +     L + +L + D  K I 
Sbjct: 141 AQIAKFASGSSSRSFFGPLTAW----DKDSGEIYPVPSD---LKLAMIMLVLNDTRKPIS 193

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR+ M+     S  F  W  Q   D   +   +   DF K+G++ E NAL MHAT   A+
Sbjct: 194 SRQGMQRCSETSTNFADWIAQSEKDYVAMLDYLKAADFEKVGDLTEANALAMHATTRTAN 253

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIID 329
           PP  Y  K + Q MERV + R+Q    YFT+DAGPN+K+L   K  E + + F +   I 
Sbjct: 254 PPFSYLTKASYQAMERVKELRRQGERCYFTMDAGPNVKVLCLEKDLERLSRIFAQDYQII 313

Query: 330 PLDSPDL 336
              + +L
Sbjct: 314 VSKTKEL 320


>gi|309799713|ref|ZP_07693930.1| diphosphomevalonate decarboxylase [Streptococcus infantis SK1302]
 gi|308116669|gb|EFO54128.1| diphosphomevalonate decarboxylase [Streptococcus infantis SK1302]
          Length = 290

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 91/293 (31%), Positives = 151/293 (51%), Gaps = 11/293 (3%)

Query: 46  NLPLNNSLSLSLGHLGTITHITVIDSD--ADCIILNGQKISSQSSFFKKTTQFCDLFRQF 103
            +P  +S+SL+L ++ T T ++ + +D  +D   +NGQ  +       K ++  D +R  
Sbjct: 1   MVPATSSISLTLENMFTETTLSPLPADASSDAFYINGQLQNEAEHV--KMSKIIDRYRPE 58

Query: 104 SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRS 163
              +  I+T NN+PT AGL+SS+SG +AL  A    + +    + L+  A+  SGS+ RS
Sbjct: 59  GAGFVRIDTKNNMPTAAGLSSSSSGLSALVKACNAYFQLGLDRKDLALEAKFASGSSSRS 118

Query: 164 FYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
           FY     W    D++  + + V   +    L + +L + D++K I SR+ M++    S  
Sbjct: 119 FYGPLAAW----DKDSGEIYPV---DTDLKLGMIMLVLEDQKKPISSRDGMKLCVETSTT 171

Query: 224 FTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGM 283
           F  W +Q   D   +   + + DF K+GE+ EKNAL MHAT   A+P   Y    + + M
Sbjct: 172 FEDWVRQSEQDYKDMLVYLKESDFKKVGELTEKNALAMHATTKTATPSFSYLTDASYEAM 231

Query: 284 ERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           + V   R+Q    YFT+DAGPN+K+L   K  E + +   +   +    + DL
Sbjct: 232 DFVRQLREQGESCYFTMDAGPNVKVLCLEKDLEHLSELLCQRYRLIVSKTKDL 284


>gi|326771745|ref|ZP_08231030.1| diphosphomevalonate decarboxylase [Actinomyces viscosus C505]
 gi|326637878|gb|EGE38779.1| diphosphomevalonate decarboxylase [Actinomyces viscosus C505]
          Length = 343

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 114/297 (38%), Positives = 157/297 (52%), Gaps = 9/297 (3%)

Query: 32  IALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCIILNGQKISSQSSF 89
           IAL KYWGK D    +P  +SLSL+LG   T T ++    D  AD + +NG   S  +  
Sbjct: 28  IALIKYWGKVDEAQAIPATSSLSLTLGGTRTTTTVSFDGGDGAADSVTING--TSPSAVE 85

Query: 90  FKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSE 147
            ++ T+F DL R  S V     I +  ++P  AGLASSA+GFAAL  A  R   +     
Sbjct: 86  LERVTRFLDLVRARSGVTAPATITSRASVPLAAGLASSAAGFAALAAAASRAAGMDLDGR 145

Query: 148 SLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKK 207
            LSR+AR GSGSA RS + G   W  G D     S+A P      DL + ++ +  R K 
Sbjct: 146 ELSRLARRGSGSATRSVFGGLVLWNAGHDDAS--SYAEPVA-CEMDLAMVVVVLSQRYKP 202

Query: 208 IGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIA 267
           I S  AM  T   SP F  W +    DL    +A+   D  +LGE+ E NAL MHATMIA
Sbjct: 203 ISSTRAMRATMASSPLFPAWVEASGRDLQVALEAVRAGDLARLGEIVEGNALGMHATMIA 262

Query: 268 ASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           A P ++YW  +T+  +  +   R++ +PI+ T+DAGPN+K+L      E +     +
Sbjct: 263 ARPGIIYWLPQTVAALHAIRAMREEGLPIWATIDAGPNVKVLTEGTRAEEVAAALRD 319


>gi|125580503|gb|EAZ21434.1| hypothetical protein OsJ_05037 [Oryza sativa Japonica Group]
          Length = 493

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 77/228 (33%), Positives = 113/228 (49%), Gaps = 20/228 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 266 ATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 325

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 326 KEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLASS 385

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
            +G       L  + ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV
Sbjct: 386 VAGLVCFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAV 445

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI 231
              +   W DL I +  +  ++K+  S   M  +   SP      Q+ 
Sbjct: 446 QLADEAHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQRK 493


>gi|24379381|ref|NP_721336.1| putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           UA159]
 gi|24377310|gb|AAN58642.1|AE014934_6 putative mevalonate diphosphate decarboxylase [Streptococcus mutans
           UA159]
          Length = 310

 Score =  255 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 106/316 (33%), Positives = 170/316 (53%), Gaps = 10/316 (3%)

Query: 22  EKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV-IDSDADCIILNG 80
           +       +NIA+ KYWGK ++K  +P  +S+SL+L ++ T T +T+  +++AD   ++ 
Sbjct: 4   KSVKVKSYANIAIIKYWGKTNTKKMIPATSSISLTLENMYTETRLTLLRNAEADEFYIDH 63

Query: 81  QKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
             I    +  +K ++  D FR+ +  +  +ETSNN+PT AGL+SS+SG +AL  A    +
Sbjct: 64  --ILQNEAEHRKISKVLDFFRKETPFFVKVETSNNMPTAAGLSSSSSGLSALVKAANIFF 121

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
                 E L+++A+  SGS+ RSF+     W    D++  + + VP +     L + +L 
Sbjct: 122 ETNATQEELAQIAKFASGSSSRSFFGPLTAW----DKDSGEIYPVPSD---LKLAMIMLV 174

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           + D  K I SR+ M+     S  F  W  Q   D   +   +   DF K+G++ E NAL 
Sbjct: 175 LNDTRKPISSRQGMQRCSETSTNFADWIAQSEKDYVAMLDYLKAADFEKVGDLTEANALA 234

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHAT   A+PP  Y  K + Q MERV + R+Q    YFT+DAGPN+K+L   K  E + +
Sbjct: 235 MHATTRTANPPFSYLTKASYQAMERVKELRRQGERCYFTMDAGPNIKVLCLEKDLERLSR 294

Query: 321 FFPEITIIDPLDSPDL 336
            F +   I    + +L
Sbjct: 295 IFAQDYQIIVSKTKEL 310


>gi|218189885|gb|EEC72312.1| hypothetical protein OsI_05503 [Oryza sativa Indica Group]
          Length = 311

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 112/226 (49%), Gaps = 20/226 (8%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNG 80
           ++   P+NIA+ KYWGKRD  L LP+N+S+S++L   HL   T + V  S  +D + LNG
Sbjct: 13  ATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNG 72

Query: 81  QKISSQSSFFKKTTQFCDLF---------------RQFSKVYFLIETSNNIPTKAGLASS 125
           ++IS     F+   +                      + K++  I + NN PT AGLASS
Sbjct: 73  KEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLASS 132

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
            +G       L  + ++ E    LS +AR GSGSACRS Y GF +W  G + +G DS AV
Sbjct: 133 VAGLVCFVFTLGNLMNVKEDYGELSSIARQGSGSACRSIYGGFVKWCMGKNNDGSDSIAV 192

Query: 186 PFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQ 229
              +   W DL I +  +  ++K+  S   M  +   SP      Q
Sbjct: 193 QLADEAHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQ 238


>gi|312385830|gb|EFR30235.1| hypothetical protein AND_00303 [Anopheles darlingi]
          Length = 427

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 76/285 (26%), Positives = 124/285 (43%), Gaps = 20/285 (7%)

Query: 59  HLGTITHITVIDS-DADCIILNGQKISSQSSFFKKTTQFCDL---------FRQFSKVYF 108
            L T T IT       + + LNG + S  +   ++                  +  +   
Sbjct: 88  DLRTKTTITAGPELSKNVLRLNGAEESFDNPRIQRCLLEVRRKARESGKCTRPELLEWNI 147

Query: 109 LIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGF 168
            +E+ NN PT AGLASSASG+A     L  +Y I    E LS +AR+GSGSACRS + G+
Sbjct: 148 HVESENNFPTAAGLASSASGYACFVYTLATLYGIE--GEELSGIARMGSGSACRSLHSGY 205

Query: 169 CEWICGTDQNGMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQ 226
            +W+ G   +G DS AV       WP++ + +L + DR+K   S   M  +   S     
Sbjct: 206 VQWVKGDRADGADSIAVQLAPATAWPEMHVLILVVNDRKKATASTHGMATSVKTSDLLRY 265

Query: 227 WTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMER 285
                    +  +K+A+ ++DF   G +A K++ + HA  +   PP  Y    +   +  
Sbjct: 266 RASTCVPERVDQLKKALEERDFDTFGRIAMKDSNQFHAVCLDTYPPCFYMNDVSRSIIRL 325

Query: 286 VWDARQQS-----IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
           V     ++     + + ++ DAGPN  L    +    +      +
Sbjct: 326 VHAINGRAGVDAPVKVAYSYDAGPNACLFLQERDVAEVSAIVRRV 370


>gi|55822530|ref|YP_140971.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           CNRZ1066]
 gi|55738515|gb|AAV62156.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           CNRZ1066]
          Length = 314

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 93/317 (29%), Positives = 166/317 (52%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++    D+ +D + +  +
Sbjct: 6   VSVKSYANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPKDATSDVMYIGDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  D+FR     +  IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDIFRTNPNQHVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L   +  + + + 
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVLCMEEDLDRLAEH 296

Query: 322 FPEITIIDPLDSPDLWS 338
             +   +    + +L  
Sbjct: 297 LRKDYQVIVSRTKELPD 313


>gi|312277964|gb|ADQ62621.1| Diphosphomevalonate decarboxylase, putative [Streptococcus
           thermophilus ND03]
          Length = 314

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 94/317 (29%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++    D+ +D + +  +
Sbjct: 6   VSVKSYANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPEDATSDVMYIGDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  D+FR        IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDIFRTDPNQPVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L   +  + +   
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVLCLEEDLDRLADH 296

Query: 322 FPEITIIDPLDSPDLWS 338
           F +   +    + +L  
Sbjct: 297 FRKDYQVIVSRTKELPD 313


>gi|257051777|ref|YP_003129610.1| diphosphomevalonate decarboxylase [Halorhabdus utahensis DSM 12940]
 gi|256690540|gb|ACV10877.1| diphosphomevalonate decarboxylase [Halorhabdus utahensis DSM 12940]
          Length = 323

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 77/308 (25%), Positives = 136/308 (44%), Gaps = 10/308 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVID-SDADCIILNGQ 81
           K++A       L KY G RD +L  P ++S+SL      + T +        D  +++G+
Sbjct: 2   KATATAHPIQGLVKYHGIRDPELRTPYHDSISLCTAPSNSTTTVAFEPERPEDEYVIDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            I  + +  ++     D  R+ + +     + + NN P+  G  SSASGFAAL  AL   
Sbjct: 62  HIDGRGA--ERIRTVVDNVRERADLDERVRVASENNFPSNVGFGSSASGFAALATALVEA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +      +S +AR GS SA R+   GF +   G++     S  +    +  D    + 
Sbjct: 120 AGLDLSRPEISTIARRGSTSAARAVTGGFSDLRAGSNDADCRSKRLDVPLE--DDVRIVG 177

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            +I   K+  +          S  F      +   LA ++ A+   DF +  E+AE + L
Sbjct: 178 AVIPAYKETEAAH---EEAAESHMFEGRLAHVHEQLADMRDALGRGDFERSFEIAEHDTL 234

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            + AT +      +YWQ E+++  E V D R   +P+YF+ D G ++ +  T +  + ++
Sbjct: 235 SLAATTMTGPSGWVYWQPESLEVFETVRDLRDDGVPVYFSGDTGASIYVNTTAEYVDRVE 294

Query: 320 QFFPEITI 327
                + I
Sbjct: 295 SAIETLGI 302


>gi|55820639|ref|YP_139081.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMG 18311]
 gi|116627444|ref|YP_820063.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMD-9]
 gi|55736624|gb|AAV60266.1| mevalonate pyrophosphate decarboxylase [Streptococcus thermophilus
           LMG 18311]
 gi|116100721|gb|ABJ65867.1| diphosphomevalonate decarboxylase [Streptococcus thermophilus
           LMD-9]
          Length = 314

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 93/317 (29%), Positives = 165/317 (52%), Gaps = 11/317 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK D+   +P  +S+SL+L ++ T T ++    D+ +D + +  +
Sbjct: 6   VSVKSYANIAIVKYWGKADADRMIPSTSSISLTLENMYTETKLSFLPKDATSDVMYIGDE 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYS 141
               + +   K ++  D+FR        IET NN+PT AGL+SS+SG +AL  A   ++ 
Sbjct: 66  LQGEKET--TKASKVLDIFRTDPNQPVKIETWNNMPTAAGLSSSSSGLSALVKAANELFQ 123

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKI 201
           + +    L+++A+  SGS+ RSF+     W    D++  + + V  +     L + +L +
Sbjct: 124 VGKTQSELAQIAKFASGSSSRSFFGPLAAW----DKDSGEVYPVETD---LKLAMIMLVL 176

Query: 202 IDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKM 261
            D++K + SR+ M++    S  F +W +Q   D   +   +   DF  +GE+ E NAL+M
Sbjct: 177 TDQKKPVSSRDGMKLCTETSTSFPEWIRQSELDYKDMLAYLKANDFQAVGELTEANALRM 236

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQF 321
           H T   A+PP  Y  + + Q M++V   R      YFT+DAGPN+K+L   +  + + + 
Sbjct: 237 HQTTSTANPPFSYLTEASYQAMDKVKALRASGEQCYFTMDAGPNVKVLCMEEDLDRLAEH 296

Query: 322 FPEITIIDPLDSPDLWS 338
             +   +    + +L  
Sbjct: 297 LRKDYQVIVSRTKELPD 313


>gi|255016732|ref|ZP_05288858.1| hypothetical protein LmonF_00676 [Listeria monocytogenes FSL
           F2-515]
          Length = 280

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 105/284 (36%), Positives = 156/284 (54%), Gaps = 11/284 (3%)

Query: 65  HITVIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAG 121
            +   +    D  ILN ++ +       K  +F D  R+   +     I + N++PT AG
Sbjct: 1   TVEWDEKLTQDTFILNNEQKTD-----AKVARFIDKMREEFGISAKAKITSENHVPTAAG 55

Query: 122 LASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMD 181
           LASSAS FAAL LA        +  E +SR+AR GSGSA RS +  F  W  G   +G D
Sbjct: 56  LASSASAFAALALAGSNAAGRKDTKEYISRLARFGSGSASRSVFGDFVIWEKGELADGSD 115

Query: 182 SFAVPFNNQWPD-LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQ 240
           SFAVPF N+  D + + +  + D+EKK+ SR+ M +T   SPFF  W      DL  +KQ
Sbjct: 116 SFAVPFTNKLCDKMSLVVAVVSDKEKKVSSRDGMRLTVETSPFFENWVSAAEIDLEEMKQ 175

Query: 241 AIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTL 300
           AI+D+DFIK+GE+ E+N +KMHAT + A PP  Y+Q ++++ M+ V + R+  IP YFT+
Sbjct: 176 AILDEDFIKVGEITERNGMKMHATTLGAEPPFTYFQPQSLEIMDAVRELRENGIPAYFTM 235

Query: 301 DAGPNLKLLFTHKIEETIKQFFPEI--TIIDPLDSPDLWSTKDS 342
           DAGPN+K++     E  + +    +   ++      +     D 
Sbjct: 236 DAGPNVKVICERANENIVAEKLSGLAKNVLICHAGKEASVVSDE 279


>gi|260890995|ref|ZP_05902258.1| diphosphomevalonate decarboxylase [Leptotrichia hofstadii F0254]
 gi|260859022|gb|EEX73522.1| diphosphomevalonate decarboxylase [Leptotrichia hofstadii F0254]
          Length = 327

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 100/332 (30%), Positives = 170/332 (51%), Gaps = 31/332 (9%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------------- 73
              +NIA+ KYWGK+D++  +P  +S+SL+L  + T T +  I+ +              
Sbjct: 5   KSYANIAIIKYWGKKDAEKMIPSTSSISLTLNDMFTETELEFINDEDIKIAVEKEIKSEN 64

Query: 74  ---------DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
                    D   LNG+     +   +K ++  DLFR+       I T+NN+PT AGL+S
Sbjct: 65  CKDKYSDMADLFYLNGELQD--NVHTEKISKVVDLFRENRSQKVKISTTNNMPTAAGLSS 122

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           S+SG +A+  A   ++        L+++++ GSGS+ RSF+     W    D++  + + 
Sbjct: 123 SSSGLSAVIKACNELFEKNYTQSELAQISKFGSGSSSRSFFGPVAAW----DKDTGEIYE 178

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           V  +     L + +L + + +K+I SR  ME+    S +F +W +Q   D  ++K+ + +
Sbjct: 179 VRTD---LKLAMIVLVLNENKKEISSRNGMELCAKTSTYFDEWVKQSEIDFVNMKKYLAE 235

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
            DF K+G + E+NAL+MH T   A+PP  Y+ ++T + M+ V   R      YFT+DAGP
Sbjct: 236 NDFEKVGILTEENALRMHKTTETANPPFTYFNEKTYEAMDFVKKLRNNGKKCYFTMDAGP 295

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           N+K+L   +  E +   F E   I    +  L
Sbjct: 296 NVKVLCLEEDLEKLAGIFEEKYKIIVSRTVKL 327


>gi|322390283|ref|ZP_08063812.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           903]
 gi|321143014|gb|EFX38463.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           903]
          Length = 316

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 93/300 (31%), Positives = 158/300 (52%), Gaps = 12/300 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQKI 83
           A   +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++    D+ A    ++G+  
Sbjct: 8   AKSYANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETSLSPLPADATAHEFYIDGEFQ 67

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +       K     D  +   +  +  ++TSNN+PT AGL+SS+SG +AL  A  + Y +
Sbjct: 68  NPAE--QAKIGAVIDSLKPADEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNQYYDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E L++ A+  SGS+ RSF+     W    D+   + + V  +     L + +L + 
Sbjct: 126 GLSQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVKTD---LKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKPVSSREGMKRCMETSTNFKEWIEESRQDYKDMLDYLAGNDFERVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L   +  + +   F
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRAAGHACYFTMDAGPNVKVLCLEEDLDQLVPLF 298


>gi|312868395|ref|ZP_07728595.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis
           F0405]
 gi|311096140|gb|EFQ54384.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis
           F0405]
          Length = 316

 Score =  250 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 94/300 (31%), Positives = 158/300 (52%), Gaps = 12/300 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQKI 83
           A   +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++    D+ A    ++G+  
Sbjct: 8   AKSYANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETRLSPLPADATAHEFYIDGEFQ 67

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +       K     D  +   +  +  ++TSNN+PT AGL+SS+SG +AL  A  R Y +
Sbjct: 68  NPAE--QAKIGAVIDGLKPADEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNRYYDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E L++ A+  SGS+ RSF+     W    D+   + + V  +     L + +L + 
Sbjct: 126 GLSQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVKTD---LKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKSVSSREGMKRCMETSTNFKEWVEESRQDYKDMLDYLAANDFERVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L   +  + +   F
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRAAGHACYFTMDAGPNVKVLCLEEDLDQLVPLF 298


>gi|51598941|ref|YP_073129.1| mevalonate pyrophosphate decarboxylase [Borrelia garinii PBi]
 gi|51573512|gb|AAU07537.1| mevalonate pyrophosphate decarboxylase [Borrelia garinii PBi]
          Length = 312

 Score =  250 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 153/295 (51%), Gaps = 16/295 (5%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKK 92
           AL KYWGK+D+ LN+P  +SL++S+    +I+ + + D   D IILN + +  Q+   +K
Sbjct: 12  ALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELELSD--QDEIILNSKPVVFQN--REK 67

Query: 93  TTQFCDLFRQFS---KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
              F D  RQ      V F I++ NN PT AGLASS+SGFA++   + + ++      S 
Sbjct: 68  V--FFDYARQILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFN-KYSFNSA 124

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
           S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK++ 
Sbjct: 125 SNLARVGSASAARAVYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEKELS 180

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AM I +HH  ++  W               + +DFI+ G    K+   M A M A+ 
Sbjct: 181 SRVAMNICKHHEFYYDAWIASSKKIFKDALYFFLKKDFIRFGATVVKSYQNMFALMFAS- 239

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             + Y++  TI  ++   + R + I ++ T+DAGP +K L   +   TI +   +
Sbjct: 240 -SIFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFLCLEENLNTILKRLKQ 293


>gi|68473922|ref|XP_719064.1| hypothetical protein CaO19.6105 [Candida albicans SC5314]
 gi|68474127|ref|XP_718960.1| hypothetical protein CaO19.13524 [Candida albicans SC5314]
 gi|46440756|gb|EAL00059.1| hypothetical protein CaO19.13524 [Candida albicans SC5314]
 gi|46440864|gb|EAL00166.1| hypothetical protein CaO19.6105 [Candida albicans SC5314]
          Length = 264

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 77/220 (35%), Positives = 116/220 (52%), Gaps = 3/220 (1%)

Query: 106 VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFY 165
           +   I + NN PT AGLASSA+GFAAL  A+ ++Y +P+    LS++AR GSGSACRS +
Sbjct: 1   MKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYELPQDMSELSKIARKGSGSACRSLF 60

Query: 166 RGFCEWICGTDQNGMDSFAVPFN--NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
            GF  W  GT  +G DS AV       WP LR  +L + D +K   S   M+ T   S  
Sbjct: 61  GGFVAWEMGTLPDGQDSKAVEIAPLEHWPSLRAVILVVSDDKKDTPSTTGMQSTVATSDL 120

Query: 224 FTQWT-QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           F     + +      +K+AI+D+DF K  E+  K++   HA  + + PP+ Y    + + 
Sbjct: 121 FAHRIAEVVPQRFEAMKKAILDKDFPKFAELTMKDSNSFHAVCLDSYPPIFYLNDTSKKI 180

Query: 283 MERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           ++ V    QQ +   +T DAGPN  + +    ++ +    
Sbjct: 181 IKMVETINQQEVVAAYTFDAGPNAVIYYDEANQDKVLSLL 220


>gi|296875769|ref|ZP_06899832.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           15912]
 gi|296433234|gb|EFH19018.1| diphosphomevalonate decarboxylase [Streptococcus parasanguinis ATCC
           15912]
          Length = 316

 Score =  249 bits (636), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 94/300 (31%), Positives = 159/300 (53%), Gaps = 12/300 (4%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQKI 83
           A   +NIA+ KYWGK D+K  +P  +S+SL+L ++ T T ++    D+ A    ++G+  
Sbjct: 8   AKSYANIAIIKYWGKEDAKQMVPSTSSISLTLENMYTETSLSPLPADATAHEFYIDGEFQ 67

Query: 84  SSQSSFFKKTTQFCDLFRQFSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +       K     D  +  ++  +  ++TSNN+PT AGL+SS+SG +AL  A  R Y +
Sbjct: 68  NPAE--QAKIGAVIDGLKPVNEAGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNRYYDL 125

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               E L++ A+  SGS+ RSF+     W    D+   + + V  +     L + +L + 
Sbjct: 126 GLTQEELAQKAKFASGSSSRSFFGPLAAW----DKESGEIYKVKTD---LKLAMIMLVLN 178

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
           D++K + SRE M+     S  F +W ++   D   +   +   DF ++G++ E+NAL MH
Sbjct: 179 DKQKPVSSREGMKRCMETSTNFKEWIEESRQDYKDMLDYLAGNDFEQVGQLTERNALAMH 238

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           AT   A+P   Y  +E+ + M+ V + R      YFT+DAGPN+K+L   +  + +   F
Sbjct: 239 ATTRTATPAFSYLTEESHKAMDFVRELRVAGHACYFTMDAGPNVKVLCLEEDLDQLMPLF 298


>gi|219684321|ref|ZP_03539265.1| diphosphomevalonate decarboxylase [Borrelia garinii PBr]
 gi|219672310|gb|EED29363.1| diphosphomevalonate decarboxylase [Borrelia garinii PBr]
          Length = 312

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 153/295 (51%), Gaps = 16/295 (5%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKK 92
           AL KYWGK+D+ LN+P  +SL++S+    +I+ + + D   D IILN + +  Q+   +K
Sbjct: 12  ALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELELSD--QDEIILNSKPVVFQN--REK 67

Query: 93  TTQFCDLFRQF---SKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
              F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++      S 
Sbjct: 68  V--FFDYARKIISEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFN-KYSFNSA 124

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
           S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK++ 
Sbjct: 125 SNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEKELS 180

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AM I +HH  ++  W               + +DFI+ G    K+   M A M A+ 
Sbjct: 181 SRVAMNICKHHEFYYDAWIASSKKIFKDALYFFLKKDFIRFGANVVKSYQNMFALMFAS- 239

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             + Y++  TI  ++   + R + I ++ T+DAGP +K L   K   TI +   +
Sbjct: 240 -SIFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFLCLEKNLNTILKRLKQ 293


>gi|257124948|ref|YP_003163062.1| diphosphomevalonate decarboxylase [Leptotrichia buccalis C-1013-b]
 gi|257048887|gb|ACV38071.1| diphosphomevalonate decarboxylase [Leptotrichia buccalis C-1013-b]
          Length = 327

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 99/332 (29%), Positives = 167/332 (50%), Gaps = 31/332 (9%)

Query: 27  FLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDA------------- 73
              +NIA+ KYWGK++++  +P  +S+SL+L  + T T +  I+                
Sbjct: 5   KSYANIAIVKYWGKKNAEKMIPSTSSISLTLNDMFTETEMEFINDSDIKIAVEKEIKSEN 64

Query: 74  ---------DCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLAS 124
                    D   LNG+     S   +K ++  DLFR        I T+NN+PT AGL+S
Sbjct: 65  YKDKYSDMTDLFYLNGELQD--SVHTEKISKVVDLFRGNRSQKVKISTTNNMPTAAGLSS 122

Query: 125 SASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFA 184
           S+SG +A+  A   ++        L+++++ GSGS+ RSF+     W    D++  + + 
Sbjct: 123 SSSGLSAVIKACNELFGKNYTQSELAQISKFGSGSSSRSFFGPVAAW----DKDTGEIYE 178

Query: 185 VPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIID 244
           V  +     L + +L + + +K+I SR  ME+    S +F +W +Q   D  ++K+ + +
Sbjct: 179 VKTD---LKLAMIVLVLNENKKEISSRNGMELCAKTSTYFDEWVKQSEIDFVNMKKYLAE 235

Query: 245 QDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGP 304
            D  K+G + E+NAL+MH T   A+PP  Y+ ++T + M+ V + R      YFT+DAGP
Sbjct: 236 NDLEKVGILTEENALRMHKTTETANPPFSYFNEKTYEAMDFVKNLRNNGEKCYFTMDAGP 295

Query: 305 NLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
           N+K+L      E +   F E   I    +  L
Sbjct: 296 NVKVLCLEDDLEKLAGIFEEKYKIIVSKTVKL 327


>gi|219685538|ref|ZP_03540355.1| diphosphomevalonate decarboxylase [Borrelia garinii Far04]
 gi|219672937|gb|EED29959.1| diphosphomevalonate decarboxylase [Borrelia garinii Far04]
          Length = 312

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 153/295 (51%), Gaps = 16/295 (5%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKK 92
           AL KYWGK+D+ LN+P  +SL++S+    +I+ + + D   D IILN + +  Q+   +K
Sbjct: 12  ALIKYWGKKDAFLNIPATSSLAVSVDKFYSISELELSD--QDEIILNSKPVVFQN--REK 67

Query: 93  TTQFCDLFRQFS---KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
              F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++      S 
Sbjct: 68  V--FFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFN-KYSFNSA 124

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
           S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I   EK++ 
Sbjct: 125 SNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIIDSNEKELS 180

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SR AM I +HH  ++  W               + +DFI+ G    K+   M A M A+ 
Sbjct: 181 SRVAMNICKHHEFYYDAWITSSKKIFKDALYFFLKKDFIRFGANVVKSYQNMFALMFAS- 239

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             + Y++  TI  ++   + R + I I+ T+DAGP +K L   K   TI +   +
Sbjct: 240 -SIFYFKSSTIDLIKYAANLRNEGIFIFETMDAGPQVKFLCLEKNLNTILKRLKQ 293


>gi|320582344|gb|EFW96561.1| diphosphomevalonate decarboxylase [Pichia angusta DL-1]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 126/244 (51%), Gaps = 10/244 (4%)

Query: 106 VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFY 165
           ++  I + NN PT AGLASSA+GFAAL  A+ ++Y +P+ +  LS++AR GSGSACRS +
Sbjct: 1   MHLHIVSENNFPTAAGLASSAAGFAALISAIAKLYELPQTASDLSKIARKGSGSACRSLF 60

Query: 166 RGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPF 223
            G+  W  G  +NG DS AV       WPD++  +L + D +K + S   M++T   SP 
Sbjct: 61  GGYVAWEMGELENGEDSKAVEVAPLSHWPDMKACILVVSDDKKDVPSTSGMQLTVKTSPL 120

Query: 224 FTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG 282
           F    +  +      +K++I++++F    E+  K++   HAT + + PP+ Y    + + 
Sbjct: 121 FQHRIEKVVPQRFEEMKKSIVEKNFPLFAELTMKDSNSFHATCLDSYPPIFYLNDTSKRI 180

Query: 283 MERVWDARQ--QSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDLWSTK 340
           ++ +         I   +T DAGPN  + +  K E  +      +       S D W   
Sbjct: 181 IKLINLLNDSVGEIIAAYTYDAGPNAVIYYEQKNESRVLGLLHAV-----FKSVDGWQKI 235

Query: 341 DSLS 344
           D  S
Sbjct: 236 DVKS 239


>gi|169235519|ref|YP_001688719.1| diphosphomevalonate decarboxylase [Halobacterium salinarum R1]
 gi|167726585|emb|CAP13370.1| diphosphomevalonate decarboxylase [Halobacterium salinarum R1]
          Length = 325

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 80/321 (24%), Positives = 135/321 (42%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A       L KY G RD  L +P ++S+S+      T T +      DAD  +++G 
Sbjct: 2   KATARAHPIQGLVKYHGMRDESLRMPYHDSISVCTAPSNTTTTVEFDPDRDADQYVVDGD 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            ++   +   +     D  R  +       +E+ N+ PT  GL SS+SGFAA  LA  R 
Sbjct: 62  TVTGHGA--DRIRSVVDAVRDRAGFDHRVRLESQNSFPTNIGLGSSSSGFAAAALACVRA 119

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     ++S VAR GS SA R+   GF +   G +     S  +    ++      ++
Sbjct: 120 AGLDLDLPTVSTVARRGSASAARAVTGGFSDLHAGLNDADCRSERLDAPAEFASDLRIVV 179

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
             +   K     E+       S  F      +   LA ++ A+   DF ++ E AE ++L
Sbjct: 180 GEVPAYK---ETESAHAEAADSHMFDARLAHVQGQLAEMRDAVRAGDFQRVFETAEHDSL 236

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            + AT +      +YW+ ET+   E V + R   +P YF+ D G  + +  T    + + 
Sbjct: 237 SLAATTMTGPSGWVYWKPETLSIFETVRELRADGVPTYFSTDTGATVYVNTTASHADEV- 295

Query: 320 QFFPEITIIDPLDSPDLWSTK 340
               E  + D      +W   
Sbjct: 296 ----EAAVADCGVDTAVWEVG 312


>gi|15789800|ref|NP_279624.1| diphosphomevalonate decarboxylase [Halobacterium sp. NRC-1]
 gi|10580186|gb|AAG19104.1| diphosphomevalonate decarboxylase [Halobacterium sp. NRC-1]
          Length = 334

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 80/321 (24%), Positives = 135/321 (42%), Gaps = 13/321 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCIILNGQ 81
           K++A       L KY G RD  L +P ++S+S+      T T +      DAD  +++G 
Sbjct: 11  KATARAHPIQGLVKYHGMRDESLRMPYHDSISVCTAPSNTTTTVEFDPDRDADQYVVDGD 70

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
            ++   +   +     D  R  +       +E+ N+ PT  GL SS+SGFAA  LA  R 
Sbjct: 71  TVTGHGA--DRIRSVVDAVRDRAGFDHRVRLESQNSFPTNIGLGSSSSGFAAAALACVRA 128

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
             +     ++S VAR GS SA R+   GF +   G +     S  +    ++      ++
Sbjct: 129 AGLDLDLPTVSTVARRGSASAARAVTGGFSDLHAGLNDADCRSERLDAPAEFASDLRIVV 188

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
             +   K     E+       S  F      +   LA ++ A+   DF ++ E AE ++L
Sbjct: 189 GEVPAYK---ETESAHAEAADSHMFDARLAHVQGQLAEMRDAVRAGDFQRVFETAEHDSL 245

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIK 319
            + AT +      +YW+ ET+   E V + R   +P YF+ D G  + +  T    + + 
Sbjct: 246 SLAATTMTGPSGWVYWKPETLSIFETVRELRADGVPTYFSTDTGATVYVNTTASHADEV- 304

Query: 320 QFFPEITIIDPLDSPDLWSTK 340
               E  + D      +W   
Sbjct: 305 ----EAAVADCGVDTAVWEVG 321


>gi|148359614|ref|YP_001250821.1| mevalonate diphosphate decarboxylase [Legionella pneumophila str.
           Corby]
 gi|296107656|ref|YP_003619357.1| diphosphomevalonate decarboxylase [Legionella pneumophila 2300/99
           Alcoy]
 gi|148281387|gb|ABQ55475.1| mevalonate diphosphate decarboxylase [Legionella pneumophila str.
           Corby]
 gi|295649558|gb|ADG25405.1| diphosphomevalonate decarboxylase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 315

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 91/312 (29%), Positives = 150/312 (48%), Gaps = 29/312 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQK 82
           A  PSNIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G  
Sbjct: 5   AQAPSNIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLSIPGAP 64

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFA----ALT 133
             + S   +K  +F D   +  + +     FLI++SNN P  +GLASSAS FA      +
Sbjct: 65  EFNLSVEAQK--RFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCAS 122

Query: 134 LALFRIYSIPE-KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
           +AL  +   P    +  ++++RLGSGS+CRSFY  +  W                +  + 
Sbjct: 123 IALSDLTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVS--------AIDLPYK 174

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL   ++ I  +EK+I SR A +     SPF+   +++   +L  +  A  ++D+  + +
Sbjct: 175 DLLHQVIVISSQEKEIPSRVAHK-LVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQ 233

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQG---MERVWDARQQSIPIYFTLDAGPNLKLL 309
           +     L MH        P  Y    T+     +E+ W+ +     +  T+DAGPN+ LL
Sbjct: 234 ICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVV--TMDAGPNVHLL 291

Query: 310 FTHKIEETIKQF 321
           +     +  +QF
Sbjct: 292 YRSDQTDLARQF 303


>gi|52842257|ref|YP_096056.1| mevalonate diphosphate decarboxylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629368|gb|AAU28109.1| mevalonate diphosphate decarboxylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 322

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 90/322 (27%), Positives = 153/322 (47%), Gaps = 29/322 (9%)

Query: 16  CNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC 75
            + ++     A  P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D 
Sbjct: 2   TSRRLTMHWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDI 61

Query: 76  ---IILNGQKISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSAS 127
              + + G    + S   +K  +F D   +  + +     FLI++SNN P  +GLASSAS
Sbjct: 62  WEPLTIPGAPEFNLSVEAQK--RFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSAS 119

Query: 128 GFA----ALTLALFRIYSIPE-KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDS 182
            FA      ++AL  +   P    +  ++++RLGSGS+CRSFY  +  W           
Sbjct: 120 SFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVS----- 174

Query: 183 FAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAI 242
                +  + DL   ++ I  +EK+I SR A +     SPF+   +++   +L  +  A 
Sbjct: 175 ---AIDLPYKDLLHQVIVISSQEKEIPSRVAHK-LVKTSPFYETRSERAEANLKLLLNAF 230

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQG---MERVWDARQQSIPIYFT 299
            ++D+  + ++     L MH        P  Y    T+     +E+ W+ +     +  T
Sbjct: 231 ENKDWTSIYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVV--T 288

Query: 300 LDAGPNLKLLFTHKIEETIKQF 321
           +DAGPN+ LL+     +  +QF
Sbjct: 289 MDAGPNVHLLYRSDQTDLARQF 310


>gi|146423582|ref|XP_001487718.1| hypothetical protein PGUG_01095 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 297

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 78/266 (29%), Positives = 130/266 (48%), Gaps = 9/266 (3%)

Query: 98  DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS 157
               Q SK    I + NN PT AGLASSA+GFAAL +A+ +++ +P+    +S++AR GS
Sbjct: 6   PSLPQLSKWKLHIVSENNFPTAAGLASSAAGFAALVVAIAKLFKLPQDMSEISKIARKGS 65

Query: 158 GSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAME 215
           GSACRS + G+  W  G  +NG DS AV       WP ++  +L + D +K   S   M+
Sbjct: 66  GSACRSLFGGYVAWEMGDLENGEDSKAVEVAPVSHWPTMKAAILVVSDDKKDTPSTSGMQ 125

Query: 216 ITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
            T   S  F    +  +      +K++I D++F   G++  +++   HA  + + PP+ Y
Sbjct: 126 TTVATSDLFEHRIKNVVPARFEEMKKSIHDKNFEVFGKLTMQDSNSFHAVCLDSYPPIFY 185

Query: 275 WQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPL- 331
               + + ++ V      +  I   +T DAGPN  + +  + E  +     +   + P  
Sbjct: 186 LTDTSKKIIKLVHQLNDAEGKIIAAYTFDAGPNAVIYYEQQNESKVLGLIHKHFSLIPGW 245

Query: 332 --DSPDLWSTKDSLSQKNSIELGISK 355
                    T D  + +N  + G+SK
Sbjct: 246 DKVDTSKLETVDIAADENIHK-GVSK 270


>gi|111115519|ref|YP_710137.1| mevalonate pyrophosphate decarboxylase [Borrelia afzelii PKo]
 gi|110890793|gb|ABH01961.1| mevalonate pyrophosphate decarboxylase [Borrelia afzelii PKo]
          Length = 312

 Score =  245 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 104/321 (32%), Positives = 159/321 (49%), Gaps = 20/321 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K      +++AL KYWGK+D  LN+P  +SL++S+    +I+ + + D   D IILN + 
Sbjct: 2   KVKCKANASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELSD--RDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFS---KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           +  Q+   +K   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + 
Sbjct: 60  VILQN--REKV--FFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKY 115

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +       S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI   
Sbjct: 116 FD-KYSFNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDESYFNDLRIIFA 170

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I   EK++ SR AM I +HH  ++  W               + +DF+  G    K+  
Sbjct: 171 IIDSSEKELSSRAAMNICKHHGFYYDAWIASSKKIFKDALYFFLKKDFVHFGATIVKSYQ 230

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI- 318
            M A M A+   + Y++  TI  ++     R + I ++ T+DAGP +K L   K   TI 
Sbjct: 231 NMFALMFAS--SIFYFKNSTIDLIKYAAYLRNKGILVFETMDAGPQVKFLCLEKNLNTIL 288

Query: 319 ---KQFFPEITIIDPLDSPDL 336
              KQ F +I  I      DL
Sbjct: 289 KGLKQNFTDIEFIVSKVGCDL 309


>gi|190345161|gb|EDK36997.2| hypothetical protein PGUG_01095 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 297

 Score =  245 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 135/267 (50%), Gaps = 11/267 (4%)

Query: 98  DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS 157
               Q SK    I + NN PT AGLASSA+GFAAL +A+ +++ +P+    +S++AR GS
Sbjct: 6   PSLPQLSKWKLHIVSENNFPTAAGLASSAAGFAALVVAIAKLFKLPQDMSEISKIARKGS 65

Query: 158 GSACRSFYRGFCEWICGTDQNGMDSFAVPFNN--QWPDLRIGLLKIIDREKKIGSREAME 215
           GSACRS + G+  W  G  +NG DS AV       WP ++  +L + D +K   S   M+
Sbjct: 66  GSACRSLFGGYVAWEMGDLENGEDSKAVEVAPVSHWPTMKAAILVVSDDKKDTPSTSGMQ 125

Query: 216 ITRHHSPFFTQWTQ-QISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
            T   S  F    +  +      +K++I D++F   G++  +++   HA  + + PP+ Y
Sbjct: 126 TTVATSDLFEHRIKNVVPARFEEMKKSIHDKNFEVFGKLTMQDSNSFHAVCLDSYPPIFY 185

Query: 275 WQKETIQGMERVWDAR--QQSIPIYFTLDAGPNLKLLFTHKIEETIK----QFFPEITII 328
               + + ++ V      +  I   +T DAGPN  + +  + E  +     + F  I   
Sbjct: 186 LTDTSKKIIKLVHQLNDAEGKIIAAYTFDAGPNAVIYYEQQNESKVLGLIHKHFSSIPGW 245

Query: 329 DPLDSPDLWSTKDSLSQKNSIELGISK 355
           D +D+  L  T D  + +N  + G+SK
Sbjct: 246 DKVDTSKL-ETVDIAADENIHK-GVSK 270


>gi|224531822|ref|ZP_03672454.1| diphosphomevalonate decarboxylase [Borrelia valaisiana VS116]
 gi|224511287|gb|EEF81693.1| diphosphomevalonate decarboxylase [Borrelia valaisiana VS116]
          Length = 312

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 95/295 (32%), Positives = 150/295 (50%), Gaps = 16/295 (5%)

Query: 33  ALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKK 92
           AL KYWGK+D  LN+P  +SL++S+    +I+ + + D   D IILN + +  Q+   +K
Sbjct: 12  ALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELSD--RDEIILNSKPVILQN--REK 67

Query: 93  TTQFCDLFRQFS---KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESL 149
              F D  R+      V F I++ NN PT AGLASS+SGFA++   + + ++      S 
Sbjct: 68  V--FFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKYFN-KYSFNSA 124

Query: 150 SRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIG 209
           S +AR+GS SA R+ Y GF     G+ +    SF +     + DL I    I   EK++ 
Sbjct: 125 SNLARIGSASAARAIYGGFTILKEGSKE----SFQLRDQYYFDDLCIIFAIIDSNEKELS 180

Query: 210 SREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAAS 269
           SREAM I ++H  ++  W               + +DFI  G    K+   M A M A+ 
Sbjct: 181 SREAMNICKYHEFYYDAWIASSKKIFKDALYFFLKKDFIHFGTTIVKSYQNMFALMFAS- 239

Query: 270 PPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
             + Y++  TI  ++   + R + I ++ T+DAGP +K +   K   TI +   +
Sbjct: 240 -SIFYFKSSTIDLIKYAANLRNEGIFVFETMDAGPQVKFICLEKNLNTILKRLEQ 293


>gi|327405190|ref|YP_004346028.1| diphosphomevalonate decarboxylase [Fluviicola taffensis DSM 16823]
 gi|327320698|gb|AEA45190.1| diphosphomevalonate decarboxylase [Fluviicola taffensis DSM 16823]
          Length = 351

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 85/334 (25%), Positives = 144/334 (43%), Gaps = 49/334 (14%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHL-----------GTITHITVIDS 71
           K +   PSNIA+ KYWGK+ ++  +P                        T     + + 
Sbjct: 12  KVTWRCPSNIAIVKYWGKKGNQ--IP-----------CNSSLSLTLSNSFTEVEAELSEK 58

Query: 72  DADC-----IILNGQKISSQSSFFKKTTQFCDLFRQFSKV----YFLIETSNNIPTKAGL 122
            +D          G+       F ++  +F    R++          I++SN+ P  AG+
Sbjct: 59  TSDEAVQLSYYFEGE---INEQFSQRVAKFLFDNREYFPFIGENAITIQSSNSFPHSAGI 115

Query: 123 ASSASGFAALTLALFRI-------YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGT 175
           ASSAS F A++LAL  I                 S +ARLGSGSA RS + GF  W    
Sbjct: 116 ASSASAFGAISLALLDIAYGIEGKEKDETFYMEASNLARLGSGSASRSMFPGFASWGTND 175

Query: 176 DQ-NGMDSFAVPF---NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI 231
              N  +  A+     +  + +++  +L I D  KK+ S        ++ P+     +Q 
Sbjct: 176 QIQNSSNEHAIEIKEVHPVFHNMKDAILIIEDEPKKVSSSVG-HSLMNNHPYAENRFKQA 234

Query: 232 STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ 291
           +   A + + +   D      + E  AL +HA M+ +    L  +  TI  +E++ + R+
Sbjct: 235 NERTAELVEILKAGDMEAFIHMCESEALTLHAMMMTSMDYYLLVKPGTITAIEKLMEFRK 294

Query: 292 QS-IPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           +S +P+ FTLDAGPN+ +L+    E  +++F   
Sbjct: 295 ESKVPVCFTLDAGPNVHVLYPKAYEVQVEEFINN 328


>gi|328705849|ref|XP_003242922.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform 2
           [Acyrthosiphon pisum]
          Length = 348

 Score =  245 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 89/294 (30%), Positives = 132/294 (44%), Gaps = 24/294 (8%)

Query: 60  LGTITHITVIDS-DADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-----------VY 107
           + T T I        DC+ LNGQ +S +    ++  +  DL R   K             
Sbjct: 1   MHTKTSIIAGPFITEDCVWLNGQIMSIE--RNERLKKCFDLIRNLIKIQKGENSQEVKWK 58

Query: 108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRG 167
             + + NN PT AGLASSA+G+A L   L   +     +  L  +AR GSGSACRS Y G
Sbjct: 59  IRVCSENNFPTAAGLASSAAGYACLVYTLANAFG--LVNGDLPSIARQGSGSACRSIYGG 116

Query: 168 FCEWICGTDQNGMDSFAVPF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFT 225
           F +W  G D  G DS AV    +  WP++RI +L + D +KK  S   M+     S    
Sbjct: 117 FVQWTAGVDDQGYDSTAVQIAADTHWPEMRIIILVVNDSKKKTSSTVGMKQAVKTSELLK 176

Query: 226 QWTQQI-STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
              Q+        I QAI D++F K  E+  +++ + HA  +   PP +Y  + + + + 
Sbjct: 177 YRIQKCVPERTKEIIQAITDKNFEKFAEITMRDSNQFHAICLDTYPPCVYLNQVSHEIIS 236

Query: 285 RVWDARQQS--IPIYFTLDAGPNLKLLFTHKIEETIKQFFPEITIIDPLDSPDL 336
            V D  + +  I + +T  AGPN  L            F  E+  + P   P+ 
Sbjct: 237 FVHDYNEATGQIKVSYTFYAGPNAFLFIQQIDLSL---FMSELVNVFPTMQPNS 287


>gi|284164373|ref|YP_003402652.1| diphosphomevalonate decarboxylase [Haloterrigena turkmenica DSM
           5511]
 gi|284014028|gb|ADB59979.1| diphosphomevalonate decarboxylase [Haloterrigena turkmenica DSM
           5511]
          Length = 327

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 79/325 (24%), Positives = 145/325 (44%), Gaps = 19/325 (5%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-DSDADCIILNGQ 81
           K++A       L KY G RD    LP ++S+SL      T T +    D + D  +++G+
Sbjct: 2   KATAMAHPIQGLVKYHGMRDEIERLPYHDSISLCTAPSHTRTTVEFSMDYEEDTFVVDGE 61

Query: 82  KISSQSSFFKKTTQFCDLFRQFSK-----VYFLIETSNNIPTKAGLASSASGFAALTLAL 136
           ++      +++     +  R  S          +E+ N+ P+  GL SS+SGFAA  +AL
Sbjct: 62  ELDG--RAYERVEAVVEKARSKSDAAHTVYPVRLESENSFPSNVGLGSSSSGFAAAAMAL 119

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRI 196
                +    + +S +AR+GS SA R+    F +   G +     S  +P +    DL+I
Sbjct: 120 AEAAELDASRQEISTIARVGSASAARAVTGAFSQLHTGLNDEDCRSRRIPSDLH-EDLKI 178

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
            +  +   +      E        S  F      I   +A ++ A+ + +F +  E+AE+
Sbjct: 179 VVGLVPYHK----ETEDAHREAADSHMFQARNAHIHGQIAEMRDALRNNEFDRAFELAEQ 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKLLFTHKIE 315
           ++L + AT +      +YWQ  T++    V + R++  IP+YF+ D G ++ +  T +  
Sbjct: 235 DSLSLAATTMTGPSGWVYWQPATLKIFNTVRELREEEDIPVYFSTDTGASVYVNTTEEHV 294

Query: 316 ETIKQFFPEITIIDPLDSPDLWSTK 340
           + +     E  + D   S  +W   
Sbjct: 295 DEV-----EEAVSDCGVSTTVWDVG 314


>gi|319946225|ref|ZP_08020465.1| diphosphomevalonate decarboxylase [Streptococcus australis ATCC
           700641]
 gi|319747607|gb|EFV99860.1| diphosphomevalonate decarboxylase [Streptococcus australis ATCC
           700641]
          Length = 316

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 96/316 (30%), Positives = 163/316 (51%), Gaps = 12/316 (3%)

Query: 24  SSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITV--IDSDADCIILNGQ 81
            S    +NIA+ KYWGK +S+  +P  +S+SL+L ++ T T ++    ++ +    ++G 
Sbjct: 6   VSVKSYANIAIIKYWGKENSEAMVPSTSSISLTLENMYTETRLSPLGPEAKSHAFFIDGV 65

Query: 82  KISSQSSFFKKTTQFCDLFRQFSKV-YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
             +   +   K     D F+   +  +  ++TSNN+PT AGL+SS+SG +AL  A    Y
Sbjct: 66  FQN--EAEQAKIGAVIDRFKPEGETGFVRVDTSNNMPTAAGLSSSSSGLSALVKACNCYY 123

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +       ++ A+  SGS+ RSF+     W    D++  + + V  +     L + +L 
Sbjct: 124 QLGMTQAEQAQAAKFASGSSSRSFFGPLAAW----DKDTGEIYQVETD---LKLAMIMLV 176

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           + D++K + SRE M+     S  F +W +Q + D   +   + D DF K+GE+ E+NAL 
Sbjct: 177 LNDQQKILSSREGMKRCTETSSNFQEWIRQSAQDYQDMLAYLKDNDFEKVGELTERNALL 236

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MH+T   ASP   Y   ++ + ME V   R +    YFT+DAGPN+K+L   +  + +  
Sbjct: 237 MHSTTKTASPAFSYLTDKSYEAMEFVRSLRNEGKRCYFTMDAGPNVKVLCLEEDLDQLVP 296

Query: 321 FFPEITIIDPLDSPDL 336
            F +   I    + DL
Sbjct: 297 LFEQDYRIIVSKTKDL 312


>gi|315288058|ref|ZP_07872190.1| diphosphomevalonate decarboxylase [Listeria ivanovii FSL F6-596]
 gi|313630872|gb|EFR98573.1| diphosphomevalonate decarboxylase [Listeria ivanovii FSL F6-596]
          Length = 265

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 100/264 (37%), Positives = 148/264 (56%), Gaps = 5/264 (1%)

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVYFL--IETSNNIPTKAGLASSASGFAALTLALFRIYS 141
             +     K T+F D  R+   +     I + N++PT AGLASSAS FAAL LA      
Sbjct: 1   DGEEKTDAKVTRFIDKMREEFGLNARALIISENHVPTAAGLASSASAFAALALAGSHAAG 60

Query: 142 IPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPD-LRIGLLK 200
             +  + +S++AR GSGSA RS Y  F  W  G   +G DSFAVPF  +  D + + +  
Sbjct: 61  RNDTQQYISKLARFGSGSASRSIYGDFVIWEKGELADGSDSFAVPFTKKLSDKISMVIAV 120

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           + D++KK+ SR+ M  T   SPFF  W     +DL  +KQAI+ +DFIK+GE+ E+N +K
Sbjct: 121 VSDKKKKVSSRDGMRSTVETSPFFKNWVAAAESDLEEMKQAILAEDFIKVGEITEQNGMK 180

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           MHAT + A PP  Y++  +++ M+ V + R   IP YFT+DAGPN+K++   K E  + +
Sbjct: 181 MHATTLGAEPPFTYFKPLSLEIMDAVRELRGNGIPAYFTMDAGPNVKVICERKNERIVAE 240

Query: 321 FFPEIT--IIDPLDSPDLWSTKDS 342
              E+T  ++      +     D 
Sbjct: 241 KLSELTKNVLICHAGKEASVVSDE 264


>gi|307610771|emb|CBX00383.1| hypothetical protein LPW_21041 [Legionella pneumophila 130b]
          Length = 315

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/312 (28%), Positives = 149/312 (47%), Gaps = 29/312 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQK 82
           A  P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G  
Sbjct: 5   AQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAP 64

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFA----ALT 133
             + S   +K  +F D   +  + +     FLI++SNN P  +GLASSAS FA      +
Sbjct: 65  EFNLSVEAQK--RFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCAS 122

Query: 134 LALFRIYSIPE-KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
           +AL  +   P    +  ++ +RLGSGS+CRSFY  +  W                +  + 
Sbjct: 123 IALSELTQKPLPSIDEQAQWSRLGSGSSCRSFYAPWALWTGDKVS--------AIDLPYK 174

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL   ++ I  +EK+I SR A +     SPF+   +++   +L  +  A  ++D+  + +
Sbjct: 175 DLLHQVIVISSQEKEISSRVAHK-LVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQ 233

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQG---MERVWDARQQSIPIYFTLDAGPNLKLL 309
           +     L MH        P  Y    T+     +E+ W+ +     +  T+DAGPN+ LL
Sbjct: 234 ICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVV--TMDAGPNVHLL 291

Query: 310 FTHKIEETIKQF 321
           +     +  +QF
Sbjct: 292 YRSDQTDLARQF 303


>gi|187918542|ref|YP_001884105.1| diphosphomevalonate decarboxylase [Borrelia hermsii DAH]
 gi|119861390|gb|AAX17185.1| diphosphomevalonate decarboxylase [Borrelia hermsii DAH]
          Length = 312

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 87/302 (28%), Positives = 146/302 (48%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K       ++AL KYWGKRD  LN+P  +S+++S+    +I+ + +     D IILN + 
Sbjct: 2   KIRCKANPSLALIKYWGKRDKFLNIPATSSIAVSVDKFYSISELELSC--KDEIILNSRA 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           I  Q         +         V F + + NN PT AGLASS+SGFA++   + R ++ 
Sbjct: 60  IVLQEREIN-FFNYARKILNEPNVGFRVISENNFPTAAGLASSSSGFASIAACILRYFNQ 118

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
               +  S++AR+GS SA R+ Y GF     G       +F +   N + DL I    + 
Sbjct: 119 -YSHQKASQLARIGSASAARAIYGGFTFLKEGAR----SAFQLNNFNYFNDLCIIFAIVD 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
            R+K + SR AMEI +    ++  W +            ++  DF + G    K+   M 
Sbjct: 174 SRKKDMSSRAAMEICKQEKFYWDAWIKSSRNIFKEALFFLLKGDFNEFGLKIVKSYQCMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M+++   ++Y++  TI+ ++ +   R + I ++ T+DAGP +K+L   K  E +    
Sbjct: 234 ALMLSS--SIIYFKSNTIELIKYIAALRSRGISVFETMDAGPQVKVLCLKKDLELVLTEL 291

Query: 323 PE 324
             
Sbjct: 292 TS 293


>gi|54297968|ref|YP_124337.1| hypothetical protein lpp2023 [Legionella pneumophila str. Paris]
 gi|53751753|emb|CAH13175.1| hypothetical protein lpp2023 [Legionella pneumophila str. Paris]
          Length = 315

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/312 (28%), Positives = 150/312 (48%), Gaps = 29/312 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQK 82
           A  P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G  
Sbjct: 5   AQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLSIPGAP 64

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFA----ALT 133
             + S   +K  +F D   +  + +     FLI++SNN P  +GLASSAS FA      +
Sbjct: 65  EFNLSVEAQK--RFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCAS 122

Query: 134 LALFRIYSIPE-KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
           +AL  +   P    +  ++++RLGSGS+CRSFY  +  W                +  + 
Sbjct: 123 IALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALWTGDKVS--------AIDLPYK 174

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL   ++ I  +EK+I SR A +     SPF+   +++   +L  +  A  ++D+  + +
Sbjct: 175 DLLHQVIVISSQEKEIPSRVAHK-LVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQ 233

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQG---MERVWDARQQSIPIYFTLDAGPNLKLL 309
           +     L MH        P  Y    T+     +E+ W+ +     +  T+DAGPN+ LL
Sbjct: 234 ICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVV--TMDAGPNVHLL 291

Query: 310 FTHKIEETIKQF 321
           +     +  +QF
Sbjct: 292 YRSDQTDLARQF 303


>gi|312147908|gb|ADQ30567.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi JD1]
          Length = 312

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 93/302 (30%), Positives = 150/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M A+   + Y++  TI  +    D R + I ++ T+DAGP +KLL   +   TI +  
Sbjct: 234 ALMFAS--SIFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKLLCLEENLNTILKGL 291

Query: 323 PE 324
            +
Sbjct: 292 KQ 293


>gi|9711347|dbj|BAB07818.1| mevalonate diphosphate decaroboxylase [Kitasatospora griseola]
          Length = 300

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 94/276 (34%), Positives = 141/276 (51%), Gaps = 10/276 (3%)

Query: 55  LSLGHLGTITHITVID-SDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIE 111
           ++L    T T + +   +  D +  NG+  + ++    + T F  L R+ S       +E
Sbjct: 1   MTLDIFPTTTRVQLAPGAGQDTVAFNGEPATGEAER--RITAFLRLVRERSGRTERARVE 58

Query: 112 TSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEW 171
           T N +PT AGLASSASGFAAL +A    Y +   +  LSR+AR GSGSA RS + GF  W
Sbjct: 59  TENTVPTGAGLASSASGFAALAVAAAAAYGLGLDARGLSRLARRGSGSASRSIFDGFAVW 118

Query: 172 ICG-----TDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQ 226
             G      ++  + S+A P      +  + +  +    K + SREAM  T   SP +  
Sbjct: 119 HAGHAGGTPEEADLGSYAEPVPAVDLEPALVVAVVSAAPKAVSSREAMRRTVDTSPLYEP 178

Query: 227 WTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV 286
           W      DLA I  A+   +   +GE+AE+NAL MHATM+AA P + Y    ++  ++ V
Sbjct: 179 WAVSSRADLADIGAALARGNLPAVGEIAERNALGMHATMLAARPAVRYLSPASLAVLDGV 238

Query: 287 WDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
              R+  +P Y T+DAGPN+K+L      E + +  
Sbjct: 239 LQLRRDGVPAYATMDAGPNVKVLCPRSDAERVAEAL 274


>gi|54294939|ref|YP_127354.1| hypothetical protein lpl2018 [Legionella pneumophila str. Lens]
 gi|53754771|emb|CAH16258.1| hypothetical protein lpl2018 [Legionella pneumophila str. Lens]
          Length = 315

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 90/312 (28%), Positives = 149/312 (47%), Gaps = 29/312 (9%)

Query: 26  AFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADC---IILNGQK 82
           A  P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +  D    + + G  
Sbjct: 5   AQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLERLPTKKDIWEPLTIPGAP 64

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFA----ALT 133
             + S   +K  +F D   +  + +     FLI++SNN P  +GLASSAS FA      +
Sbjct: 65  EFNLSVEAQK--RFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCAS 122

Query: 134 LALFRIYSIPE-KSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWP 192
           +AL  +   P    +  ++ +RLGSGS+CRSFY  +  W                +  + 
Sbjct: 123 IALSELTQKPLPSIDEQAQWSRLGSGSSCRSFYAPWALWTGDKVS--------AIDLPYK 174

Query: 193 DLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           DL   ++ I  +EK+I SR A +     SPF+   +++   +L  +  A  ++D+  + +
Sbjct: 175 DLLHQVIVISSQEKEIPSRVAHK-LVKTSPFYETRSERAEANLKLLLNAFENKDWTSIYQ 233

Query: 253 VAEKNALKMHATMIAASPPLLYWQKETIQG---MERVWDARQQSIPIYFTLDAGPNLKLL 309
           +     L MH        P  Y    T+     +E+ W+ +     +  T+DAGPN+ LL
Sbjct: 234 ICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVV--TMDAGPNVHLL 291

Query: 310 FTHKIEETIKQF 321
           +     +  +QF
Sbjct: 292 YRSDQTDLARQF 303


>gi|216263644|ref|ZP_03435639.1| diphosphomevalonate decarboxylase [Borrelia afzelii ACA-1]
 gi|215980488|gb|EEC21309.1| diphosphomevalonate decarboxylase [Borrelia afzelii ACA-1]
          Length = 312

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 104/321 (32%), Positives = 159/321 (49%), Gaps = 20/321 (6%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K      +++AL KYWGK+D  LN+P  +SL++S+    +I+ + + D   D IILN + 
Sbjct: 2   KVKCKANASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELSD--RDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFS---KVYFLIETSNNIPTKAGLASSASGFAALTLALFRI 139
           +  Q+   +K   F D  R+      V F I++ NN PT AGLASS+SGFA++   + + 
Sbjct: 60  VILQN--REKV--FFDYARKILSEPNVRFKIKSENNFPTAAGLASSSSGFASIAACILKY 115

Query: 140 YSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLL 199
           +       S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI   
Sbjct: 116 FD-KYSFNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDESYFNDLRIIFA 170

Query: 200 KIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNAL 259
            I   EK++ SR AM I +HH  ++  W               + +DF+  G    K+  
Sbjct: 171 IIDSSEKELSSRAAMNICKHHGFYYDAWIASSKKIFKDALYFFLKKDFVHFGANIVKSYQ 230

Query: 260 KMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETI- 318
            M A M A+   + Y++  TI  ++     R + I ++ T+DAGP +K L   K   TI 
Sbjct: 231 NMFALMFAS--SIFYFKNSTIDLIKYAAYLRNKGILVFETMDAGPQVKFLCLEKNLNTIL 288

Query: 319 ---KQFFPEITIIDPLDSPDL 336
              KQ F +I  I      DL
Sbjct: 289 KGLKQNFTDIEFIVSKVGCDL 309


>gi|225548898|ref|ZP_03769875.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 94a]
 gi|225370501|gb|EEG99937.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 94a]
          Length = 312

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 93/302 (30%), Positives = 150/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHKFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M A+   + Y++  TI  +    D R + I ++ T+DAGP +KLL   +   TI +  
Sbjct: 234 ALMFAS--SIFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKLLCLEENLNTILKGL 291

Query: 323 PE 324
            +
Sbjct: 292 KQ 293


>gi|195941505|ref|ZP_03086887.1| mevalonate pyrophosphate decarboxylase [Borrelia burgdorferi 80a]
 gi|226320477|ref|ZP_03796043.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 29805]
 gi|226234119|gb|EEH32834.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 29805]
          Length = 312

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 149/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M A+   + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI +  
Sbjct: 234 ALMFAS--SIFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGL 291

Query: 323 PE 324
            +
Sbjct: 292 KQ 293


>gi|221217970|ref|ZP_03589437.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 72a]
 gi|221192276|gb|EEE18496.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi 72a]
          Length = 312

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 149/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M A+   + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI +  
Sbjct: 234 ALMFAS--SIFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGL 291

Query: 323 PE 324
            +
Sbjct: 292 KQ 293


>gi|300711592|ref|YP_003737406.1| diphosphomevalonate decarboxylase [Halalkalicoccus jeotgali B3]
 gi|299125275|gb|ADJ15614.1| diphosphomevalonate decarboxylase [Halalkalicoccus jeotgali B3]
          Length = 321

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 76/320 (23%), Positives = 138/320 (43%), Gaps = 14/320 (4%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K +A       L KY G RD +L LP ++S+S+      T T     D   D  +++G++
Sbjct: 3   KITAVAHPIQGLAKYHGMRDPELRLPYHDSISVCTAPSHTKTTARFEDRTEDVYVVDGEE 62

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLALFRIY 140
           +S +    ++     D  R+ + +     +E+ N+  +  G  SS+SGFAA  +AL    
Sbjct: 63  LSGRGK--ERVAAVVDRVRELAGIDDRVRLESENSFRSNVGFGSSSSGFAAAAMALCNAA 120

Query: 141 SIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLK 200
            +      +S VAR GS SA R+    F     G +     S  +    +  D    +  
Sbjct: 121 ELDLSRPDISTVARRGSSSAARAVTGAFSHLRTGLNDADCRSERIETELE--DELRIVAG 178

Query: 201 IIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALK 260
           ++   K     E        S  F      +   +A ++ A+ + DF +  E+AE ++L 
Sbjct: 179 LVPSYK---ETEQAHEEAADSHMFGARMAHMHGQIAELRDALREGDFDRTFELAEHDSLS 235

Query: 261 MHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQ 320
           + AT +      +YWQ ETI+   RV + R + +P+Y++ D G ++ +  T +  + ++ 
Sbjct: 236 LAATTMTGPAGWVYWQPETIEIFNRVRELRDEGVPVYYSTDTGASVYVNTTEEHVQRVEA 295

Query: 321 FFPEITIIDPLDSPDLWSTK 340
              E  +        +W   
Sbjct: 296 EVAEAGV-----ETHVWEVG 310


>gi|322790718|gb|EFZ15462.1| hypothetical protein SINV_01729 [Solenopsis invicta]
          Length = 339

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 84/262 (32%), Positives = 123/262 (46%), Gaps = 12/262 (4%)

Query: 70  DSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKV----YFLIETSNNIPTKAGLASS 125
           D   DCI LNG++   ++   +   +      Q S         I + NN PT AGLASS
Sbjct: 5   DFKEDCIWLNGREEDIKNIRLQNCLKEIRKRSQLSDYINDWKIHICSKNNFPTAAGLASS 64

Query: 126 ASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAV 185
           A+G+A LT AL ++Y I      +S +AR GSGSACRS   GF  W  G+D+ G DS A 
Sbjct: 65  AAGYACLTAALAKLYKIE---GDISIIARSGSGSACRSVMGGFVRWQMGSDKYGTDSLAK 121

Query: 186 PF--NNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQI-STDLAHIKQAI 242
                + WP++RI +L + D +KK+ S   M  +   S       + +       ++QAI
Sbjct: 122 QIVPTSYWPEMRILILVVNDEQKKVPSAIGMRRSIETSELLKYRIKHVVPERANKMQQAI 181

Query: 243 IDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--QSIPIYFTL 300
           I++DF    E+  K++ + HA  +   PP +Y    +   M  V         + I +T 
Sbjct: 182 IEKDFKSFAELTMKDSNQFHAVCLDTYPPCIYTNDISNSIMNLVHSYNDAVNDVKIAYTY 241

Query: 301 DAGPNLKLLFTHKIEETIKQFF 322
           DAGPN  L    K    +    
Sbjct: 242 DAGPNATLYLLEKDVPAVIGVL 263


>gi|312149286|gb|ADQ29357.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi N40]
          Length = 312

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 149/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +++ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSVSELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFF 322
           A M A+   + Y++  TI  +    D R + I ++ T+DAGP +K L   +   TI +  
Sbjct: 234 ALMFAS--SIFYFKNSTIDLIRYAADLRNEGIFVFETMDAGPQVKFLCLEENLNTILKGL 291

Query: 323 PE 324
            +
Sbjct: 292 KQ 293


>gi|224532415|ref|ZP_03673045.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi WI91-23]
 gi|224512722|gb|EEF83093.1| diphosphomevalonate decarboxylase [Borrelia burgdorferi WI91-23]
          Length = 312

 Score =  242 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 149/302 (49%), Gaps = 10/302 (3%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQK 82
           K    + +++AL KYWGK+D  LN+P  +SL++S+    +I+ + +   + D IILN + 
Sbjct: 2   KIKCKVHASLALIKYWGKKDVFLNIPATSSLAVSVDKFYSISELELS--NRDEIILNSKP 59

Query: 83  ISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI 142
           +    +  K    +         V F I++ NN PT AGLASS+SGFA++   + + ++ 
Sbjct: 60  V-ILKNREKVFFDYARKILNEPNVRFKIKSKNNFPTAAGLASSSSGFASIAACILKYFN- 117

Query: 143 PEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKII 202
                S S +AR+GS SA R+ Y GF     G+ +    SF +   + + DLRI    I 
Sbjct: 118 KYSCNSASNLARVGSASAARAIYGGFTILKEGSKE----SFQLRDQSYFNDLRIIFAIID 173

Query: 203 DREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMH 262
             EK++ SR AM I + H  ++  W               + +DFI  G    K+   M 
Sbjct: 174 SNEKELSSRAAMNICKRHEFYYDAWIASSKKIFKDALYFFLKKDFIHFGATIVKSYQNMF 233

Query: 263 ATMIAASPPLLYWQKET