RPSBLAST alignment for GI: 254781016 and conserved domain: COG0083

>gnl|CDD|30432 COG0083, ThrB, Homoserine kinase [Amino acid transport and metabolism]. Length = 299
 Score = 37.9 bits (88), Expect = 0.004
 Identities = 31/150 (20%), Positives = 55/150 (36%), Gaps = 13/150 (8%)

Query: 45  LNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
           L L L+    + +  +     I V    AD I L+ + +      ++   +F +      
Sbjct: 22  LGLALDLYNDVVVVEVVDKFEIEVEGEGADKIPLDPENL-----VYQAALKFLEALGI-- 74

Query: 105 KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSG---SAC 161
           +    I     IP   GL SSA+   A   A   +  +P   E L ++A    G   +  
Sbjct: 75  EAGVKIRIEKGIPLGRGLGSSAASIVAALAAANELAGLPLSKEELLQLALEIEGHPDNVA 134

Query: 162 RSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
            +   G        +++G+ S  VPF +  
Sbjct: 135 PAVLGGLVLV---EEESGIISVKVPFPSDL 161