RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781016|ref|YP_003065429.1| diphosphomevalonate
decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)



>gnl|CDD|33213 COG3407, MVD1, Mevalonate pyrophosphate decarboxylase [Lipid
           metabolism].
          Length = 329

 Score =  260 bits (666), Expect = 4e-70
 Identities = 125/320 (39%), Positives = 183/320 (57%), Gaps = 16/320 (5%)

Query: 20  INEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI--DSDADCII 77
           +    +A    NIAL KYWGKRD  LN+PLN+S+S++L    T T    +  + + D  I
Sbjct: 2   LKSIITASAYPNIALIKYWGKRDEALNIPLNSSISVTLEDFSTTTTAEELTENDEEDTFI 61

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFS--KVYFLIETSNNIPTKAGLASSASGFAALTLA 135
           LNG+         +K  +  D FR+         I + NN PT AGLASSA+G AAL  A
Sbjct: 62  LNGEL---SEDENEKARRVLDRFRKEYGISFKVKIVSYNNFPTAAGLASSAAGAAALAAA 118

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPD 193
           L R+Y +    E LSR+ARLGSGSA RS + GF  W  G    G DS A        W +
Sbjct: 119 LNRLYDLDLDDEFLSRIARLGSGSASRSIFGGFVLWEKG---EGEDSAAEQLFRLDLWKE 175

Query: 194 LRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEV 253
           L + +L I  ++KK+ SRE M++T   SPF+  W +    DL  +K+AI ++DF K+GE+
Sbjct: 176 LAMIVLVISPKKKKVSSREGMQLTAETSPFYDAWLEHSEEDLEEMKEAIREKDFEKIGEL 235

Query: 254 AEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHK 313
           AE ++L+MHAT++++ PP  Y   E+++ +E V + R++   +YFT+DAGPN+K++   +
Sbjct: 236 AENDSLEMHATLMSSGPPFFYLTDESLRIIEFVHELRKEGNAVYFTMDAGPNVKVITLEE 295

Query: 314 ----IEETIKQFFPEITIID 329
               + E +K        ID
Sbjct: 296 NLIDLLEILKTLECIDGSID 315


>gnl|CDD|38044 KOG2833, KOG2833, KOG2833, Mevalonate pyrophosphate decarboxylase
           [Lipid transport and metabolism].
          Length = 395

 Score =  204 bits (521), Expect = 2e-53
 Identities = 114/317 (35%), Positives = 168/317 (52%), Gaps = 30/317 (9%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLG--HLGTITHITVIDS-DADCIILNGQKISS 85
           P NIA+ KYWGKRD +LNLP N+S+S++L    L T+T   V  S + D + LNG+++  
Sbjct: 13  PVNIAVIKYWGKRDEELNLPTNDSISVTLSQDDLCTLTTAVVSPSFEEDRMWLNGKEVP- 71

Query: 86  QSSFFKKTTQFC-DLFRQFS--------------KVYFLIETSNNIPTKAGLASSASGFA 130
                 K  Q C    R+ +               +   I + NN PT AGLASSA+GFA
Sbjct: 72  ---ISNKRYQRCLREIRRLARDREESEASLPSNGPLKLHIASVNNFPTAAGLASSAAGFA 128

Query: 131 ALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPF--N 188
           AL LAL R+Y + +  E LSR+AR GSGSACRS Y GF  W  G   +G DS AV    +
Sbjct: 129 ALVLALARLYGLDDSPEELSRIARQGSGSACRSLYGGFVAWEMGELDDGSDSVAVQIAPS 188

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTD-LAHIKQAIIDQDF 247
           + WP+LRI +L + D +KK GS E M  +   S       + +    +  +++AI ++DF
Sbjct: 189 SHWPELRILILVVSDAKKKTGSTEGMRRSVETSQLLQHRIESVVPQRIQQMREAIRERDF 248

Query: 248 IKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERV--WDARQQSIPIYFTLDAGPN 305
               ++  K++ + HA  +   PP+ Y    + + +  V  ++A      + +T DAGPN
Sbjct: 249 ESFAKLTMKDSNQFHAVCLDTFPPIFYLNDTSWRIISLVHEFNASAGGTRVAYTFDAGPN 308

Query: 306 LKLLFTHKIEETIKQFF 322
             L+    +EE + Q  
Sbjct: 309 AVLIV---LEENVSQLL 322


>gnl|CDD|144028 pfam00288, GHMP_kinases_N, GHMP kinases N terminal domain.  This
           family includes homoserine kinases, galactokinases and
           mevalonate kinases.
          Length = 67

 Score = 51.0 bits (123), Expect = 5e-07
 Identities = 22/49 (44%), Positives = 29/49 (59%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSG 158
           IE  +NIP  AGL SSA+   AL LAL  ++ +P   E L+R+A    G
Sbjct: 2   IEIESNIPLGAGLGSSAALAVALLLALNELFGLPLSKEELARLALEAEG 50


>gnl|CDD|31871 COG1685, COG1685, Archaeal shikimate kinase [Amino acid transport
           and metabolism / Coenzyme metabolism].
          Length = 278

 Score = 41.0 bits (96), Expect = 5e-04
 Identities = 29/126 (23%), Positives = 48/126 (38%), Gaps = 20/126 (15%)

Query: 110 IETSNNIPTKAGLASSASGFAALTLALFRIYSIP-EKSESLSRVARLGSGS--------- 159
           +E  + IP  +GL SS++   AL  A+ +      +  E L   AR    +         
Sbjct: 73  VEVESEIPVGSGLKSSSAASNALVKAVLKALGEEIDDFEILRLGARASKEAGVSVTGAFD 132

Query: 160 -ACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITR 218
            AC S+  G    I  TD   M    +      P+L + +L     EK++ +   +   R
Sbjct: 133 DACASYLGG----IVITDNRKMR---ILRRLDLPELTVLIL--APGEKRLSANVDVNRLR 183

Query: 219 HHSPFF 224
             +P  
Sbjct: 184 LIAPVV 189


>gnl|CDD|31765 COG1577, ERG12, Mevalonate kinase [Lipid metabolism].
          Length = 307

 Score = 40.3 bits (94), Expect = 8e-04
 Identities = 39/175 (22%), Positives = 62/175 (35%), Gaps = 28/175 (16%)

Query: 98  DLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS 157
           +L  Q S   F +E  + IP  AGL SSA+   A+  AL   + +    E L+++A    
Sbjct: 74  ELLNQSSLKPFSLEIDSEIPIGAGLGSSAAVSVAVIKALSAYFGVELSPEELAKLANKV- 132

Query: 158 GSACRSFYRGFCEWICGTDQNGMD--------SFAVPFNNQWPDLRIGLLK---IIDREK 206
                       E I     +G+D          A      +  L I LL    I D   
Sbjct: 133 ------------ELIVQGKASGIDIATITYGGLVAFKKGFDFEKLEIELLGTLVIGDTGV 180

Query: 207 KIGSREAMEITRHHSPFFTQWTQQISTDLAHI----KQAIIDQDFIKLGEVAEKN 257
              ++E +           +    I   +  +    + A+   DF +LGE+   N
Sbjct: 181 PGSTKELVAGVAKLLEEEPEVIDPILDAIGELVQEAEAALQTGDFEELGELMNIN 235


>gnl|CDD|30432 COG0083, ThrB, Homoserine kinase [Amino acid transport and
           metabolism].
          Length = 299

 Score = 37.9 bits (88), Expect = 0.004
 Identities = 31/150 (20%), Positives = 55/150 (36%), Gaps = 13/150 (8%)

Query: 45  LNLPLNNSLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFS 104
           L L L+    + +  +     I V    AD I L+ + +      ++   +F +      
Sbjct: 22  LGLALDLYNDVVVVEVVDKFEIEVEGEGADKIPLDPENL-----VYQAALKFLEALGI-- 74

Query: 105 KVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSG---SAC 161
           +    I     IP   GL SSA+   A   A   +  +P   E L ++A    G   +  
Sbjct: 75  EAGVKIRIEKGIPLGRGLGSSAASIVAALAAANELAGLPLSKEELLQLALEIEGHPDNVA 134

Query: 162 RSFYRGFCEWICGTDQNGMDSFAVPFNNQW 191
            +   G        +++G+ S  VPF +  
Sbjct: 135 PAVLGGLVLV---EEESGIISVKVPFPSDL 161


>gnl|CDD|30502 COG0153, GalK, Galactokinase [Carbohydrate transport and
           metabolism].
          Length = 390

 Score = 36.0 bits (83), Expect = 0.018
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 12/75 (16%)

Query: 113 SNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWI 172
           S NIP  AGL+SSA+   A+ LAL R++++P     L   A++   +  +          
Sbjct: 121 SGNIPIGAGLSSSAALEVAVALALQRLFNLPLDKAEL---AKIAQVAENQ---------F 168

Query: 173 CGTDQNGMDSFAVPF 187
            G +   MD  A  F
Sbjct: 169 VGVNCGIMDQLASAF 183


>gnl|CDD|32130 COG1947, IspE, 4-diphosphocytidyl-2C-methyl-D-erythritol
           2-phosphate synthase [Lipid metabolism].
          Length = 289

 Score = 33.3 bits (76), Expect = 0.11
 Identities = 20/96 (20%), Positives = 38/96 (39%), Gaps = 5/96 (5%)

Query: 65  HITVIDSDADCIILNGQK-ISSQSSFFKKTTQ-FCDLFRQFSKVYFLIETSNNIPTKAGL 122
            I   D D   ++      + +  +   +  +           V   ++   NIP  AGL
Sbjct: 43  TIRPRDDDGFIVLGTFADGLPTDENLVYRAAELLRKRTGIAGGVSIHLD--KNIPVGAGL 100

Query: 123 ASSASGFAALTLALFRIYSIPEKSESLSRVA-RLGS 157
              +S  AA+ +AL  ++ +    E L+ +  RLG+
Sbjct: 101 GGGSSDAAAVLVALNELWGLGLSLEELAELGLRLGA 136


>gnl|CDD|35850 KOG0631, KOG0631, KOG0631, Galactokinase [Carbohydrate transport
           and metabolism].
          Length = 489

 Score = 32.3 bits (73), Expect = 0.23
 Identities = 22/84 (26%), Positives = 32/84 (38%), Gaps = 10/84 (11%)

Query: 101 RQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSA 160
           R    V   I    ++PT +GL+SSA+   A  LA  ++   P    S   +A +     
Sbjct: 136 RFEPPVGLSILNDGSVPTGSGLSSSAAWLCAAALATLKLNLGPNFIISKKDLATI----- 190

Query: 161 CRSFYRGFCEWICGTDQNGMDSFA 184
                    E   G +  GMD  A
Sbjct: 191 -----TVVAESYIGLNSGGMDQAA 209


>gnl|CDD|36467 KOG1253, KOG1253, KOG1253, tRNA methyltransferase [Translation,
           ribosomal structure and biogenesis].
          Length = 525

 Score = 31.9 bits (72), Expect = 0.26
 Identities = 16/71 (22%), Positives = 26/71 (36%), Gaps = 6/71 (8%)

Query: 221 SPFFTQWTQQ------ISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLY 274
            P +    Q        S  L   + A+++  +   G  A  NA+K +A M      L  
Sbjct: 399 VPLYYSLNQLCSVLKCNSPPLKKFRSALLNAGYRVSGSHANPNAIKTNAPMSHIWDILRC 458

Query: 275 WQKETIQGMER 285
           W K+    +E 
Sbjct: 459 WIKDHPVKLEN 469


>gnl|CDD|33679 COG3890, ERG8, Phosphomevalonate kinase [Lipid metabolism].
          Length = 337

 Score = 28.8 bits (64), Expect = 2.6
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 7/63 (11%)

Query: 88  SFFKKTTQFC--DLFRQFSKVYFLIETSNNIP---TKAGLASSASGFAALTLALFRIYSI 142
            +F   +Q C  +L       Y   + SN      TK GL SSA+   +LT  LF  ++ 
Sbjct: 73  KYFAYLSQNCFQNLEVFADDAY--YDQSNFFFDDGTKTGLGSSAAVATSLTCGLFLSHAN 130

Query: 143 PEK 145
              
Sbjct: 131 ATN 133


>gnl|CDD|144841 pfam01398, Mov34, Mov34/MPN/PAD-1 family.  Members of this family
           are found in proteasome regulatory subunits, eukaryotic
           initiation factor 3 (eIF3) subunits and regulators of
           transcription factors. This family is also known as the
           MPN domain and PAD-1-like domain. It has been shown that
           this domain occurs in prokaryotes.
          Length = 117

 Score = 27.0 bits (60), Expect = 7.8
 Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 8/55 (14%)

Query: 180 MDSFAVPFN------NQWPDLRIGLLKIIDREKKIGSREAMEITRHHS-PFFTQW 227
            +SFA+P                 + K+++  KK+   E   +  +HS P +  W
Sbjct: 46  TNSFALPQEETEDDVEAVELDHEYMEKMLEMLKKVNRDE-EVVGWYHSHPGYGCW 99


>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) -
           superfamily II helicase [DNA replication, recombination,
           and repair].
          Length = 730

 Score = 26.8 bits (59), Expect = 8.8
 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 8/40 (20%)

Query: 311 THKIEETIKQFFPEITIIDPLDSPDLWSTKDSLSQKNSIE 350
           T +IEE +K+ FP   II            D+  +K ++E
Sbjct: 493 TERIEEELKRLFPGARIIR--------IDSDTTRRKGALE 524


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.320    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0687    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 4,239,504
Number of extensions: 215881
Number of successful extensions: 483
Number of sequences better than 10.0: 1
Number of HSP's gapped: 477
Number of HSP's successfully gapped: 17
Length of query: 355
Length of database: 6,263,737
Length adjustment: 95
Effective length of query: 260
Effective length of database: 4,210,882
Effective search space: 1094829320
Effective search space used: 1094829320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.2 bits)