RPSBLAST alignment of GI: 254781016 and protein with PDBid: 1fi4

>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP: d.14.1.5 d.58.26.2 Length = 416
 Score =  295 bits (756), Expect = 1e-80
 Identities = 98/333 (29%), Positives = 164/333 (49%), Gaps = 19/333 (5%)

Query: 12  YIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-- 69
            +   +      +S   P NIA  KYWGKRD+KLNLP N+S+S++L      T  +    
Sbjct: 14  LVPRGSHMTVYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATA 73

Query: 70  -DSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-----------VYFLIETSNNIP 117
            + + D + LNG+  S  +   +   +     R+  +               I + NN P
Sbjct: 74  PEFERDTLWLNGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFP 133

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  +
Sbjct: 134 TAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAE 193

Query: 178 NGMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTD 234
           +G DS AV   +   WP ++  +L + D +K + S + M++T   S  F +     +   
Sbjct: 194 DGHDSMAVQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKR 253

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
              +++AI+++DF    +    ++   HAT + + PP+ Y    + + +       Q   
Sbjct: 254 FEVMRKAIVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYG 313

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              + +T DAGPN  L +  + E  +  F  ++
Sbjct: 314 ETIVAYTFDAGPNAVLYYLAENESKLFAFIYKL 346