RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781016|ref|YP_003065429.1| diphosphomevalonate
decarboxylase/isopentenyl-diphosphate delta-isomerase [Candidatus
Liberibacter asiaticus str. psy62]
         (355 letters)



>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure,
           ATP binding, cholesterol biosynthesis, structural
           genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP:
           d.14.1.5 d.58.26.2
          Length = 416

 Score =  295 bits (756), Expect = 1e-80
 Identities = 98/333 (29%), Positives = 164/333 (49%), Gaps = 19/333 (5%)

Query: 12  YIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI-- 69
            +   +      +S   P NIA  KYWGKRD+KLNLP N+S+S++L      T  +    
Sbjct: 14  LVPRGSHMTVYTASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQDDLRTLTSAATA 73

Query: 70  -DSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSK-----------VYFLIETSNNIP 117
            + + D + LNG+  S  +   +   +     R+  +               I + NN P
Sbjct: 74  PEFERDTLWLNGEPHSIDNERTQNCLRDLRQLRKEMESKDASLPTLSQWKLHIVSENNFP 133

Query: 118 TKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQ 177
           T AGLASSA+GFAAL  A+ ++Y +P+ +  +SR+AR GSGSACRS + G+  W  G  +
Sbjct: 134 TAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFGGYVAWEMGKAE 193

Query: 178 NGMDSFAVPFNNQ--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTD 234
           +G DS AV   +   WP ++  +L + D +K + S + M++T   S  F +     +   
Sbjct: 194 DGHDSMAVQIADSSDWPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKR 253

Query: 235 LAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQ--Q 292
              +++AI+++DF    +    ++   HAT + + PP+ Y    + + +       Q   
Sbjct: 254 FEVMRKAIVEKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYG 313

Query: 293 SIPIYFTLDAGPNLKLLFTHKIEETIKQFFPEI 325
              + +T DAGPN  L +  + E  +  F  ++
Sbjct: 314 ETIVAYTFDAGPNAVLYYLAENESKLFAFIYKL 346


>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate
           decarboxylase, lyase; 1.80A {Trypanosoma brucei}
          Length = 380

 Score =  295 bits (756), Expect = 1e-80
 Identities = 86/314 (27%), Positives = 141/314 (44%), Gaps = 24/314 (7%)

Query: 29  PSNIALCKYWGKRDS--KLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKI 83
           P NIA  KYWGKR+    L LP N+S S++L      +  +V    D + D + LNG ++
Sbjct: 11  PINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGTEV 70

Query: 84  SSQSSFFKKTTQFCDLFRQFSKVY-----FLIETSNNIPTKAGLASSASGFAALTLALFR 138
                   +        R             I + NN PT AG+ASSASG+ A++ AL R
Sbjct: 71  DV--GKTPRVQSMLLHLRSTCPEELKNKKVNIVSENNFPTAAGMASSASGYCAMSAALIR 128

Query: 139 IYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQ--WPDLRI 196
            +        +S +ARLGSGSACRS + GF  W  G   +G D  A  F ++  WP++++
Sbjct: 129 AFKSTTN---VSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQV 185

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQW-TQQISTDLAHIKQAIIDQDFIKLGEVAE 255
               +   +K + S + M+ +   SP   +  ++ +   +    +AI  +DF    E+A 
Sbjct: 186 MCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIAM 245

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWD--ARQQSIPIYFTLDAGPNLKLLFTHK 313
             +  +        P + Y  +++   +  V    A++    + +T DAG N  L    +
Sbjct: 246 LESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVLKE 305

Query: 314 ----IEETIKQFFP 323
                   + + FP
Sbjct: 306 DLPEAVAMLMEHFP 319


>3f0n_A Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis,
           lipid synthesis, lyase, steroid biosynthesis, sterol
           biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_A
          Length = 414

 Score =  283 bits (724), Expect = 5e-77
 Identities = 99/326 (30%), Positives = 148/326 (45%), Gaps = 34/326 (10%)

Query: 29  PSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVI---DSDADCIILNGQKISS 85
           P NIA+ KYWGKRD  L LP+N+SLS++L      T  TV    D   D I LNG++   
Sbjct: 29  PVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWLNGRE--- 85

Query: 86  QSSFFKKTTQFCDLFRQFSK----------------VYFLIETSNNIPTKAGLASSASGF 129
           +     +        R+ ++                    + + NN PT AGLASSA+G+
Sbjct: 86  EDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFPTAAGLASSAAGY 145

Query: 130 AALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
           A L   L ++Y +      LS VAR GSGSACRS Y GF EW  G   +G DS A     
Sbjct: 146 ACLAYTLAQVYGVEGD---LSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQIAP 202

Query: 190 Q--WPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQ-ISTDLAHIKQAIIDQD 246
           +  WP LRI +L +   +K+ GS   M+ +   S       +  +   +  + + I +QD
Sbjct: 203 EWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKEMTRCIQEQD 262

Query: 247 FIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS--IPIYFTLDAGP 304
           F    ++  K++ + HAT +   PP+ Y    + + ++ V           + +T DAGP
Sbjct: 263 FQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGP 322

Query: 305 NLKLLFTHK----IEETIKQFFPEIT 326
           N  +             ++  FP   
Sbjct: 323 NAVIFTLEDTVAEFVAAVRHSFPPAA 348


>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative
           II(PSI II), NYSGXRC, structural genomics; 2.27A
           {Legionella pneumophila}
          Length = 323

 Score =  254 bits (650), Expect = 2e-68
 Identities = 88/316 (27%), Positives = 147/316 (46%), Gaps = 25/316 (7%)

Query: 23  KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSD---ADCIILN 79
              A  P+NIAL KY GK+D   NLP N+SLS +L +L +   +  + +     + + + 
Sbjct: 2   HWFAQAPANIALIKYMGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIP 61

Query: 80  GQKISSQSSFFKKTTQFCDLFRQFSK-----VYFLIETSNNIPTKAGLASSASGFAALTL 134
           G      +   +   +F D   +  +       FLI++SNN P  +GLASSAS FAALT 
Sbjct: 62  GAP--EFNLSVEAQKRFIDHLVRLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTK 119

Query: 135 ALFRIYSIPEKS-----ESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNN 189
                 S   +      +  ++++RLGSGS+CRSFY  +  W       G    A+    
Sbjct: 120 CASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW------TGDKVSAIDL-- 171

Query: 190 QWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIK 249
            + DL   ++ I  +EK+I SR A ++ +  SPF+   +++   +L  +  A  ++D+  
Sbjct: 172 PYKDLLHQVIVISSQEKEIPSRVAHKLVKT-SPFYETRSERAEANLKLLLNAFENKDWTS 230

Query: 250 LGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS-IPIYFTLDAGPNLKL 308
           + ++     L MH        P  Y    T+  +  +     +       T+DAGPN+ L
Sbjct: 231 IYQICWHEFLDMHQLFKTCEKPFSYITDNTLHILSVIEKFWNEKGDGPVVTMDAGPNVHL 290

Query: 309 LFTHKIEETIKQFFPE 324
           L+     +  +QF  +
Sbjct: 291 LYRSDQTDLARQFKSD 306


>2gs8_A Mevalonate pyrophosphate decarboxylase; structural genomics, PSI,
           protein structure initiative; HET: MSE; 1.50A
           {Streptococcus pyogenes m1 gas}
          Length = 317

 Score =  228 bits (583), Expect = 1e-60
 Identities = 97/308 (31%), Positives = 152/308 (49%), Gaps = 7/308 (2%)

Query: 17  NPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDSDADCI 76
           N       +    +NIA+ KYWGK +    +P  +S+SL+L ++ T T ++ +   A   
Sbjct: 2   NAMDPNVITVTSYANIAIIKYWGKENQAKMIPSTSSISLTLENMFTTTSVSFLPDTATSD 61

Query: 77  ILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLAL 136
                 I        K +   D FRQ  + +  +ET NN+PT AGL     G +AL  A 
Sbjct: 62  QFYINGILQNDEEHTKISAIIDQFRQPGQAFVKMETQNNMPTAAGLXXXXXGLSALVKAC 121

Query: 137 FRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRI 196
            +++      ++L++ A+  SGS+ RSF+     W         DS A+        + +
Sbjct: 122 DQLFDTQLDQKALAQKAKFASGSSSRSFFGPVAAWD-------KDSGAIYKVETDLKMAM 174

Query: 197 GLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAEK 256
            +L +   +K I SRE M++ R  S  F QW +Q + D  H+   +   +F K+G++ E 
Sbjct: 175 IMLVLNAAKKPISSREGMKLCRDTSTTFDQWVEQSAIDYQHMLTYLKTNNFEKVGQLTEA 234

Query: 257 NALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIEE 316
           NAL MHAT   A+PP  Y  KE+ Q ME V + RQ+    YFT+DAGPN+K+L   K   
Sbjct: 235 NALAMHATTKTANPPFSYLTKESYQAMEAVKELRQEGFACYFTMDAGPNVKVLCLEKDLA 294

Query: 317 TIKQFFPE 324
            + +   +
Sbjct: 295 QLAERLGK 302


>2hk2_A Diphosphomevalonate decarboxylase; mevalonate diphosphate
           decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB:
           2hk3_A
          Length = 331

 Score =  217 bits (554), Expect = 3e-57
 Identities = 126/318 (39%), Positives = 180/318 (56%), Gaps = 9/318 (2%)

Query: 19  KINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS-DADCII 77
           ++ +   A   +NIAL KYWGK+D  L +P+NNS+S++L    T T +T  D    D   
Sbjct: 4   EMIKSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTETKVTFNDQLTQDQFW 63

Query: 78  LNGQKISSQSSFFKKTTQFCDLFRQFSKV--YFLIETSNNIPTKAGLASSASGFAALTLA 135
           LNG+K+S +    +K +++ D+ R  + +  Y  IE+ N +PT AGLASSAS +AAL  A
Sbjct: 64  LNGEKVSGK--ELEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGLASSASAYAALAAA 121

Query: 136 LFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLR 195
             +   +    + LSR+AR+GSGSA RS Y GF EW  G       +  +  N+   DL 
Sbjct: 122 CNQALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSYAVPLESNHFEDDLA 181

Query: 196 IGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFIKLGEVAE 255
           +  + I    KK+ SR  M +TR+ S F+  W   I  DLA  K AI D+DF +LGEV E
Sbjct: 182 MIFVVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKAAIQDKDFKRLGEVIE 241

Query: 256 KNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFTLDAGPNLKLLFTHKIE 315
           +N L+MHAT + ++PP  Y  +E+   M  V + R+   P YFT+DAGPN+K+L   K +
Sbjct: 242 ENGLRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFTMDAGPNVKILVEKKNK 301

Query: 316 ETIKQF----FPEITIID 329
           + I       F    IID
Sbjct: 302 QQIIDKLLTQFDNNQIID 319


>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET:
           ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5
           d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A*
          Length = 296

 Score = 53.1 bits (126), Expect = 1e-07
 Identities = 30/277 (10%), Positives = 74/277 (26%), Gaps = 21/277 (7%)

Query: 52  SLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQF-SKVYFLI 110
              L L     +  +  ID     I ++ + I +             +   F       I
Sbjct: 20  VFGLCLKEPYDVIEVEAIDDKEIIIEVDDKNIPTDPDKNVAGIVAKKMIDDFNIGKGVKI 79

Query: 111 ETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSA---CRSFYRG 167
                +   +GL SSA+  A    A+  ++ +      L   A  G  ++     +    
Sbjct: 80  TIKKGVKAGSGLGSSAASSAGTAYAINELFKLNLDKLKLVDYASYGELASSGAKHADNVA 139

Query: 168 FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
              +   T     +   V        L I +           +RE +             
Sbjct: 140 PAIFGGFTMVTNYEPLEVLHIPIDFKLDILIAIPNISINTKEAREILPKAVGLKDLVNNV 199

Query: 228 TQQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVW 287
                     +  A+ ++D    G     + +            +   + + I    ++ 
Sbjct: 200 -----GKACGMVYALYNKDKSLFGRYMMSDKV------------IEPVRGKLIPNYFKIK 242

Query: 288 DARQQSIPIYFTLDAGPNLKLLFTHKIEETIKQFFPE 324
           +  +  +       +GP++      +  + ++    +
Sbjct: 243 EEVKDKVYGITISGSGPSIIAFPKEEFIDEVENILRD 279


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 51.9 bits (124), Expect = 2e-07
 Identities = 65/421 (15%), Positives = 108/421 (25%), Gaps = 190/421 (45%)

Query: 6   RHILHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNL----------PLNNSL-- 53
             ++   I      ++E        +    K + +    LN+          P  + L  
Sbjct: 181 HVLVGDLIKFSAETLSELIR--TTLDA--EKVFTQ---GLNILEWLENPSNTPDKDYLLS 233

Query: 54  ---SLSL-GHLGTITHITVIDSDADCIILN---GQKISSQSSFFKKTTQFCDLFRQ-FSK 105
              S  L G +  + H  V        +L    G+                   R     
Sbjct: 234 IPISCPLIG-VIQLAHYVVT-----AKLLGFTPGE------------------LRSYLKG 269

Query: 106 VYFLIET--SNNIPTKAGLASSAS--GF-----AALTLALFRI----------YSIP--- 143
                 T  S  + T   +A + S   F      A+T+ LF I           S+P   
Sbjct: 270 A-----TGHSQGLVTAVAIAETDSWESFFVSVRKAITV-LFFIGVRCYEAYPNTSLPPSI 323

Query: 144 -EKSES--------------LSRVA----------------RLG------------SGSA 160
            E S                L++                  ++             SG  
Sbjct: 324 LEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPP 383

Query: 161 CRSFYRGFCEWIC------GTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAM 214
            +S Y G    +       G DQ+      +PF+ +        L +             
Sbjct: 384 -QSLY-GLNLTLRKAKAPSGLDQS-----RIPFSERKLKFSNRFLPVA------------ 424

Query: 215 EITRHHSPFFTQWTQQISTDLAHIKQAI------I---D----QDFIKLGEVAEKNALKM 261
             +  HS      +  I+ DL     +       I   D     D   L      +  + 
Sbjct: 425 --SPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSG----SISER 478

Query: 262 HATMIAASPPLLYWQKETIQGMERVWDARQQSIPIYFT--LDAGP----NLKLLFTHKIE 315
               I   P  + W+  T       + A         T  LD GP     L +L TH+ +
Sbjct: 479 IVDCIIRLP--VKWETTT------QFKA---------THILDFGPGGASGLGVL-THRNK 520

Query: 316 E 316
           +
Sbjct: 521 D 521



 Score = 39.2 bits (91), Expect = 0.001
 Identities = 34/207 (16%), Positives = 56/207 (27%), Gaps = 82/207 (39%)

Query: 1   MSLSLRHI----LHRYIGECNPKINEKSSAFLPSNIALCKYWGKRDSKLNLPLNNS---- 52
           M LS+ ++    +  Y+ + N        + LP              ++ + L N     
Sbjct: 338 M-LSISNLTQEQVQDYVNKTN--------SHLP-----------AGKQVEISLVNGAKNL 377

Query: 53  ----LSLSLGHLGTITHITVIDSDADCIILNGQKISS---QSSF-FKK-----TTQFCDL 99
                  SL  L               + L   K  S   QS   F +     + +F  +
Sbjct: 378 VVSGPPQSLYGL--------------NLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPV 423

Query: 100 FRQFSKVYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSIP-----------EKSES 148
              F     L+  S+ I     L  +   F A  +       IP             S S
Sbjct: 424 ASPFHSHL-LVPASDLI--NKDLVKNNVSFNAKDIQ------IPVYDTFDGSDLRVLSGS 474

Query: 149 LSRVARLGSGSACRSFYRGFCEWICGT 175
           +    R+          R   +W   T
Sbjct: 475 I--SERI-----VDCIIRLPVKWETTT 494



 Score = 39.2 bits (91), Expect = 0.001
 Identities = 44/264 (16%), Positives = 74/264 (28%), Gaps = 94/264 (35%)

Query: 101 RQFSKVYFLIETSNNIPTKAGLASSASGFAALTL-ALFRIYSIPEKSESLSR-------- 151
           R  +  +  +E    +PT       AS F A  L   F    +PE +E  +         
Sbjct: 7   RPLTLSHGSLEHVLLVPT-------ASFFIASQLQEQF-NKILPEPTEGFAADDEPTTPA 58

Query: 152 ---------VARLGSGSAC-------RSFYRGF-CEWICGTDQNGMDSFAVPFNNQWPDL 194
                    V+ L   S               F   ++ G D +   + A        + 
Sbjct: 59  ELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIH---ALAAKLL---QEN 112

Query: 195 RIGLLKIIDREKKI-----GSREAM--EITRHH-SPFFTQWTQQISTDLAHI-----KQA 241
              L+K     K++      +R        +   S  F    + +    A +      Q 
Sbjct: 113 DTTLVKT----KELIKNYITARIMAKRPFDKKSNSALF----RAVGEGNAQLVAIFGGQG 164

Query: 242 IIDQDFIKLGEVAEKNALKMHAT-------MIAASPPLLY--------WQKETIQGMERV 286
             D  F    E+ +     ++ T       +I  S   L          +K   QG+  +
Sbjct: 165 NTDDYF---EELRD-----LYQTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNIL 216

Query: 287 -W--DARQQ-------SIPIYFTL 300
            W  +           SIPI   L
Sbjct: 217 EWLENPSNTPDKDYLLSIPISCPL 240


>3hul_A HSK, HK, homoserine kinase; structural genomics, putative
           homoserine kinase, THRB, amino-acid biosynthesis,
           ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes}
          Length = 298

 Score = 43.0 bits (100), Expect = 9e-05
 Identities = 36/278 (12%), Positives = 81/278 (29%), Gaps = 31/278 (11%)

Query: 52  SLSLSLGHLGTITHITVIDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIE 111
           S  L+L    T+     I ++AD   +                    L    +     + 
Sbjct: 20  SCGLALTLYLTLD----IGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLV 75

Query: 112 TSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGS---GSACRSFYRGF 168
            + +IP   GL SS++   A       +  +    E   R+A        +   +    +
Sbjct: 76  MTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNW 135

Query: 169 CEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWT 228
                    +G D +          +          + ++ + E+  +     PF  +  
Sbjct: 136 VVGAKL---DGEDFYVRHLFPDCALI------AFIPKAELLTSESRGVLPDTLPF--KEA 184

Query: 229 QQISTDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWD 288
            Q S+    +  AI+  D    GE+ E++                    + +  + ++ D
Sbjct: 185 VQASSIANVMIAAILRNDMTLAGEMMERDLWHEKYRS------------QLVPHLAQIRD 232

Query: 289 ARQQSIPIYFTL-DAGPNLKLLFTHKIEETIKQFFPEI 325
             +        L  AGP + +     +   ++     +
Sbjct: 233 VAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTL 270


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 37.3 bits (85), Expect = 0.005
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 10/35 (28%)

Query: 255 EKNAL-KMHATM-IAA--SPPLLYWQKETIQG-ME 284
           EK AL K+ A++ + A  S P L      I+  ME
Sbjct: 18  EKQALKKLQASLKLYADDSAPAL-----AIKATME 47


>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus
           aureus}
          Length = 308

 Score = 35.4 bits (81), Expect = 0.017
 Identities = 25/151 (16%), Positives = 42/151 (27%), Gaps = 12/151 (7%)

Query: 108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVA----RLGSGSACRS 163
             +    N+P   GL SSA+   A   A +         E L   A    ++  G     
Sbjct: 87  LAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKSLTKEELIEKANWAEQIAHGKPSGI 146

Query: 164 FYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHS-- 221
             +          Q G        +          + +ID   K  +R+A+         
Sbjct: 147 DTQTIVSGKPVWFQKGHAETLKTLSLDGY------MVVIDTGVKGSTRQAVHDVHKLCED 200

Query: 222 PFFTQWTQQISTDLAHIKQAIIDQDFIKLGE 252
           P +    + I   +      I    F  L +
Sbjct: 201 PQYMSHVKHIGKLVLRASDVIEHHKFEALAD 231


>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A
           {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB:
           2r42_A* 2r3v_A
          Length = 395

 Score = 30.3 bits (67), Expect = 0.58
 Identities = 18/148 (12%), Positives = 37/148 (25%), Gaps = 12/148 (8%)

Query: 108 FLIETSNNIPTKAGLASSASGFAALTLALFRIY------------SIPEKSESLSRVARL 155
             I   + +P  AGL SSA+    +  AL                      E L  + + 
Sbjct: 129 LDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEEDLKSINKW 188

Query: 156 GSGSACRSFYRGFCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAME 215
                              +   G   +     +    L    + + + +    ++  + 
Sbjct: 189 AYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMSSLKRLPALQILLTNTKVPRSTKALVA 248

Query: 216 ITRHHSPFFTQWTQQISTDLAHIKQAII 243
             R     F +    + T +  I     
Sbjct: 249 GVRSRLIKFPEIMAPLLTSIDAISLECE 276


>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes
           thetaiotaomicron, protein structure initiative II(PSI
           II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron}
          Length = 357

 Score = 28.4 bits (62), Expect = 2.4
 Identities = 31/225 (13%), Positives = 61/225 (27%), Gaps = 20/225 (8%)

Query: 69  IDSDADCIILNGQKISSQSSFFKKTTQFCDLFRQFSKVYFLIETSNNIPTKAGLASSASG 128
                  + ++  +I  ++S  K          +     F I T N+ P  +GL +S++ 
Sbjct: 60  AQCCKSYLSMSQLEIDGEASLIKGVYNRIIRDYRLEPKSFKITTYNDAPAGSGLGTSSTM 119

Query: 129 FAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRGFCEWICGTDQNGMDSFAVPFN 188
              +  A     S+P                              G      D +A  F 
Sbjct: 120 VVCILKAFIEWLSLPLGDYE------------TSRLAYEIERKDLGLSGGKQDQYAAAFG 167

Query: 189 NQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQWTQQISTDLAHIKQAIIDQDFI 248
                   G   +   +  +     +++ R              T  +    AII++   
Sbjct: 168 --------GFNYMEFLQNDLVIVNPLKMKRWIVDELESSMVLYFTGRSRSSAAIINEQKK 219

Query: 249 KLGEVAEKNALKMHATMIAASPPLLYWQKETIQGMERVWDARQQS 293
              E  +     MH    +A    L   K  +    R+     ++
Sbjct: 220 NTSEGNQTAIEAMHKIKQSAIDTKLALLKGDVGEFARILGEGWEN 264


>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop,
           beta-alpha-beta, transferase; 2.40A {Methanocaldococcus
           jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A
          Length = 317

 Score = 27.2 bits (59), Expect = 6.0
 Identities = 26/179 (14%), Positives = 51/179 (28%), Gaps = 24/179 (13%)

Query: 108 FLIETSNNIPTKAGLASSASGFAALTLALFRIYSIPEKSESLSRVARLGSGSACRSFYRG 167
           F I  S+ IP   GL SSAS       A+   Y+   K + +             +    
Sbjct: 100 FKINISSKIPISCGLGSSASITIGTIKAVSGFYNKELKDDEI-------------AKLGY 146

Query: 168 FCEWICGTDQNGMDSFAVPFNNQWPDLRIGLLKIIDREKKIGSREAMEITRHHSPFFTQW 227
             E       +  D+  + +           +  I   K    +   E    +  F   +
Sbjct: 147 MVEKEIQGKASITDTSTITY---------KGILEIKNNKFRKIKGEFEEFLKNCKFLIVY 197

Query: 228 TQQI--STDLAHIKQAIIDQDFIKLGEVAEKNALKMHATMIAASPPLLYWQKETIQGME 284
            ++    T     + A I+       E+ +     +          L+    E ++ + 
Sbjct: 198 AEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDEALKIKNKEDFGKLMTKNHELLKKLN 256


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.320    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0540    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,995,941
Number of extensions: 134352
Number of successful extensions: 354
Number of sequences better than 10.0: 1
Number of HSP's gapped: 332
Number of HSP's successfully gapped: 20
Length of query: 355
Length of database: 5,693,230
Length adjustment: 93
Effective length of query: 262
Effective length of database: 3,438,538
Effective search space: 900896956
Effective search space used: 900896956
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.2 bits)