HHsearch alignment for GI: 254781017 and conserved domain: COG1947

>COG1947 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase [Lipid metabolism].
Probab=99.88  E-value=7e-20  Score=144.98  Aligned_cols=259  Identities=17%  Similarity=0.137  Sum_probs=168.7

Q ss_pred             CCEEEEECCEEEEEE----CCCEEEC-CCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHHCCCHHHHHHHH
Q ss_conf             878999717049997----4353308-94289877677289999986898499995364444656612015089999999
Q gi|254781017|r    5 LHKICVSAPGSLVLM----GEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMA   79 (324)
Q Consensus         5 ~~ki~~~aPGKv~L~----GEh~v~~-G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~i~~~   79 (324)
T Consensus         1 ~~~~~~~apAKiNL~L~V~gkr~DGYHel~sl~~~id~~D~l~i~~~~~~~~~~~~~~---~~~lp~~~-NLv~rAa~ll   76 (289)
T COG1947           1 MMSTKFPAPAKINLFLHVTGKRADGYHELETLFQFIDLGDELTIRPRDDDGFIVLGTF---ADGLPTDE-NLVYRAAELL   76 (289)
T ss_pred             CCCEEEECCCEEEEEEEECCCCCCCCEEEEEEEEEECCCCEEEEEECCCCCCEEECCC---CCCCCCCC-HHHHHHHHHH
T ss_conf             9636872154488888853558998434589999941487899998778872696677---77887743-1999999999


Q ss_pred             HHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCE
Q ss_conf             99718778738999826875354887402456655677764045666601455788887765214688754477662985
Q gi|254781017|r   80 INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL  159 (324)
Q Consensus        80 l~~~~~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg~  159 (324)
T Consensus        77 ~~~~~~~~~v~I~l~K~IPv~aGLGGGSSdAAa~L~~Ln~l-w~~~ls~~eL~~Lg~~L---------GaDVPffl~g~t  146 (289)
T COG1947          77 RKRTGIAGGVSIHLDKNIPVGAGLGGGSSDAAAVLVALNEL-WGLGLSLEELAELGLRL---------GADVPFFLSGGT  146 (289)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHH---------CCCCCEEEECCC
T ss_conf             99868999827999836865576766457899999999998-67999999999999986---------898671431885


Q ss_pred             EEEEECCCEEEEEE-CC-CCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHH
Q ss_conf             89985275156730-47-77526765841798999988899886082348999999984033207889873048644568
Q gi|254781017|r  160 ICYQMPKYSIEKID-FI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA  237 (324)
Q Consensus       160 i~~~~~~~~~~~~~-~~-~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~  237 (324)
T Consensus       147 A~a~G~GE~l~~~~~~~~~~~vl~~P~v~vsT~~vy~-~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~NdLe~~~  221 (289)
T COG1947         147 AFAEGRGEKLEPLEDPPEKWYVLAKPGVGVSTKEVYK-DPELTRNTPKSEPLIA----ALSLENLKQIAPFLINDLEKVA  221 (289)
T ss_pred             EEEEECCCEEEECCCCCCCEEEEEECCCCCCHHHHHC-CCCCCCCCCCCHHHHH----HHHHHHHHHHHHHCCCCHHHHH
T ss_conf             6988736351477778875299995898998799970-8675646677224558----7865527764102036457889


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHH
Q ss_conf             9999989999861678779999999999719945997268997548999846653268999
Q gi|254781017|r  238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ  298 (324)
Q Consensus       238 ~lm~~~~~~L~~lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~  298 (324)
T Consensus       222 ~----------~---~~p~v~~~~~~l~~-~ga~~~~mSGSGs--tvF~l~~~~~~a~~~~  266 (289)
T COG1947         222 L----------R---LYPEVKEALSELLE-YGALPARMSGSGS--TVFALFDTEKEAQRVA  266 (289)
T ss_pred             H----------H---HCHHHHHHHHHHHH-CCCCCCEEECCCC--CEEEEECCHHHHHHHH
T ss_conf             8----------8---58689999999764-1354436824787--2899938768899999