HHsearch alignment for GI: 254781017 and conserved domain: COG2605

>COG2605 Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only].
Probab=100.00  E-value=7.6e-42  Score=283.98  Aligned_cols=298  Identities=19%  Similarity=0.180  Sum_probs=231.7

Q ss_pred             EEECCEEEEEECCCEEE------CCCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHHCCCHHHHHHHH-HH
Q ss_conf             99717049997435330------894289877677289999986898499995364444656612015089999999-99
Q gi|254781017|r    9 CVSAPGSLVLMGEHGVL------HGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMA-IN   81 (324)
Q Consensus         9 ~~~aPGKv~L~GEh~v~------~G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~i~~~-l~   81 (324)
T Consensus         3 i~raPLRItfgGGGTDvepy~~k~GGaVlnatIdky~y~~i~~~~d~~I~~~~~~~~~v~~~~~~~h~~~~~~~l~r~~l   82 (333)
T COG2605           3 ISRAPLRITFGGGGTDVEPYCSKHGGAVLNATIDKYIYVTIEKGFDDEIRVRYDRTEFVKSYLENEHKPLVVESLKRDFL   82 (333)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHCCCEEEEEEEEEEEEEEECCCCCCEEEEECCHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             02055389852787676077875387777755310799997168885389952357765126765376189999999987


Q ss_pred             HHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCC-HHHHHHHCCCEE
Q ss_conf             7187787389998268753548874024566556777640456666014557888877652146887-544776629858
Q gi|254781017|r   82 HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLI  160 (324)
Q Consensus        82 ~~~~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG-~D~~a~~~Gg~i  160 (324)
T Consensus        83 ~~~g~~~~el~~~~D~P~GSGLGSSSa~vvaLl~a~~~~k-g~~~~~~~LA~eAy~IER~~l~~~gG~QDqYaaA~GGFn  161 (333)
T COG2605          83 EFNGGTPIELHTQSDAPPGSGLGSSSAFVVALLNALHAWK-GESLGPYELAREAYEIEREDLKIVGGKQDQYAAAFGGFN  161 (333)
T ss_pred             HHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCE
T ss_conf             3149974699984378999987734799999999999985-787898999999999889985454666237899847921


Q ss_pred             EEEECC---CEEEEEE--------CCCCCCEEECCCCCCHHHHHHH-HHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             998527---5156730--------4777526765841798999988-899886082348999999984033207889873
Q gi|254781017|r  161 CYQMPK---YSIEKID--------FIFPIHLIYSGYKTPTAQVLKK-ISYIEIEYPEINEINQKIYALMGKLSQISCQAL  228 (324)
Q Consensus       161 ~~~~~~---~~~~~~~--------~~~~l~l~~tg~~~~T~~~v~~-v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al  228 (324)
T Consensus       162 fMEf~~~~~V~v~pL~i~~e~~~Ele~~~lL~yTGi~R~Ss~V~~dQ~~~~~~~~~~~~e----~~~~mk~~A~~~~~al  237 (333)
T COG2605         162 FMEFRGNGEVVVNPLRINRERTAELEARLLLYYTGITRQSSEVIEDQVRNVVDGDEETLE----ALHEMKALAYEMKDAL  237 (333)
T ss_pred             EEEECCCCCEEEEECCCCHHHHHHHHHCEEEEEECCCCCHHHHHHHHHHHHHCCCHHHHH----HHHHHHHHHHHHHHHH
T ss_conf             799748983898003344668999874069988164022558899999876315188999----9999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             0486445689999989999861--67877999999999971994599726899754899984665326899999999997
Q gi|254781017|r  229 RNKNLKVLAQAMNRQQGLLETL--GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA  306 (324)
Q Consensus       229 ~~~d~~~l~~lm~~~~~~L~~l--gvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~  306 (324)
T Consensus       238 ~~nd~~~f~~~l~~gW~~KK~ls~~ISN~~IDriy~~A~-~~GA~~gKl~GaG~gGFllf~~~p~k~~~l----~r~l~~  312 (333)
T COG2605         238 VRNDIPEFGQILDRGWEAKKKLSSRISNDAIDRIYELAL-KNGAYGGKLSGAGGGGFLLFFCDPSKRNEL----ARALEK  312 (333)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH-HCCCHHCEEECCCCCCEEEEEECCCCHHHH----HHHHHH
T ss_conf             863357799999767776455335767477899999998-667322223026886279999685424899----999998


Q ss_pred             CCCEEEEEEC
Q ss_conf             7978999414
Q gi|254781017|r  307 KGIDIVPITP  316 (324)
Q Consensus       307 ~g~~~~~~~~  316 (324)
T Consensus       313 ~~~~~~~~~F  322 (333)
T COG2605         313 EQGFVVDTSF  322 (333)
T ss_pred             HCCCEEEEEE
T ss_conf             4497378776