HHsearch alignment for GI: 254781017 and conserved domain: KOG1537

>KOG1537 consensus.
Probab=98.49  E-value=1.8e-06  Score=60.07  Aligned_cols=215  Identities=17%  Similarity=0.191  Sum_probs=119.0

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHC----------------------CC
Q ss_conf             73899982687535488740245665567776404566660145578888776521----------------------46
Q gi|254781017|r   88 GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ----------------------GI  145 (324)
Q Consensus        88 g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~----------------------g~  145 (324)
T Consensus        94 ~Tk~hvtNPiplgrGigssgta~~aGv~l~ne~-a~LGlsk~~mldy~lmierhpdn~~a~mmGgf~GSflr~l~e~E~~  172 (355)
T KOG1537          94 TTKKHVTNPIPLGRGIGSSGTAKMAGVRLVNES-ADLGLSKGSMLDYSLMIERHPDNAVAEMMGGFLGSFLRALLESEAK  172 (355)
T ss_pred             CEEEEECCCCCCCCCCCCHHHHHHHHHEECCHH-HHCCCCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             002541377656555230345665442130447-6528761023017888764717789999866789999875876664


Q ss_pred             CCC--HH-HHHHHCCCEEEEEEC-CCEE---EEEECCC--CCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             887--54-477662985899852-7515---6730477--7526765841798999988899886082348999999984
Q gi|254781017|r  146 SSG--ID-LAASIHGGLICYQMP-KYSI---EKIDFIF--PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYAL  216 (324)
Q Consensus       146 ~sG--~D-~~a~~~Gg~i~~~~~-~~~~---~~~~~~~--~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~  216 (324)
T Consensus       173 ~~~~~ad~ilp~~~gg~~li~~lpP~dlg~~~r~pw~~~lk~i~viP~Fel~T~k~R~v---LPt~yp~~d~V~N-----  244 (355)
T KOG1537         173 VSGYHADNILPAIMGGFVLIRNLPPLDLGKPLRFPWDKDLKFILVIPDFELPTKKMRAV---LPTEYPMVDHVWN-----  244 (355)
T ss_pred             HCCCCHHHHCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHH---CCCCCCCEEEEEC-----
T ss_conf             23788777250125870550588952236633377776613899944444660455420---6755663002200-----


Q ss_pred             HCCCCHHHHHHHCCC-CHHHHHH-HHHH-HHHHHHHHCCCCHHHHHHHHHHHH--CCCCEEEECCCCCCCCEEEEEECCC
Q ss_conf             033207889873048-6445689-9999-899998616787799999999997--1994599726899754899984665
Q gi|254781017|r  217 MGKLSQISCQALRNK-NLKVLAQ-AMNR-QQGLLETLGVSDSKLSEIVWKLRE--QPHIMASKISGSGLGDCVIALGKGD  291 (324)
Q Consensus       217 ~~~i~~~~~~al~~~-d~~~l~~-lm~~-~~~~L~~lgvs~~~l~~li~~~~~--~~g~~~aklsGAG~GG~~i~l~~~~  291 (324)
T Consensus       245 lqrlA-~LttAl~~~p~n~~L~y~~m~DkvhqPyRa--~LIPGl~~il~~~~p~t~pGl~GiclSGAGP--T~lAlat-e  318 (355)
T KOG1537         245 LQRLA-ALTTALLEGPDNVMLGYALMSDKVHQPYRA--PLIPGLEAILKAALPATYPGLFGICLSGAGP--TALALAT-E  318 (355)
T ss_pred             HHHHH-HHHHHHHCCCCCHHHHHHHHHCCCCCCCCC--CCCCCHHHHHHHHCCCCCCCEEEEEECCCCC--EEEEEEC-C
T ss_conf             88899-999998149971355556653212475314--5574189999861855678624588438897--3688743-7


Q ss_pred             CCHHHHHHHHHHHHHCCCE--EEEEECC
Q ss_conf             3268999999999977978--9994145
Q gi|254781017|r  292 LNSLPYQSVNCHMHAKGID--IVPITPS  317 (324)
Q Consensus       292 ~~~~~~~~~~~~~~~~g~~--~~~~~~~  317 (324)
T Consensus       319 nf~eI~~~mv~~F~K~G~kcs~~~l~pa  346 (355)
T KOG1537         319 NFQEIGEKMVEAFWKVGHKCSVASLKPA  346 (355)
T ss_pred             CHHHHHHHHHHHHHHHCCEEEEEEECCC
T ss_conf             4789999999999861844346762002