HHsearch alignment for GI: 254781017 and conserved domain: PRK02534

>PRK02534 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.
Probab=99.95  E-value=5.8e-25  Score=177.14  Aligned_cols=288  Identities=18%  Similarity=0.161  Sum_probs=193.5

Q ss_pred             CCEEEEECCEEEEEE---------CCCEEECCCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHHCCCHHHH
Q ss_conf             878999717049997---------43533089428987767728999998689849999536444465661201508999
Q gi|254781017|r    5 LHKICVSAPGSLVLM---------GEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF   75 (324)
Q Consensus         5 ~~ki~~~aPGKv~L~---------GEh~v~~G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~   75 (324)
T Consensus         1 M~~~~l~apAKINL~L~V~~kr~dGyH~----l~s~~~~i~l~D~i~i~~~~~~~i~~~~~~~~~~----~~~~Nlv~k-   71 (308)
T PRK02534          1 MHSYTLIAPAKINLHLEILGDRPDGFHE----LAMVMQSIDLADRLEFRNNGDGTIKLRCDHPDLS----TDDDNLIYR-   71 (308)
T ss_pred             CCEEEEEECEEEECCEECCCCCCCCCCE----EEEEEEEECCCCEEEEEECCCCCEEEEECCCCCC----CCCCCHHHH-
T ss_conf             9537898043681043018879999850----4789998168839999998999889986887688----898649999-


Q ss_pred             HHHHH-HHHCCC-CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHH
Q ss_conf             99999-971877-8738999826875354887402456655677764045666601455788887765214688754477
Q gi|254781017|r   76 IIMAI-NHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAA  153 (324)
Q Consensus        76 i~~~l-~~~~~~-~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a  153 (324)
T Consensus        72 a~~~l~~~~~~~~~gv~I~l~KnIPv~aGLGGGSsdAAa~L~~Ln~l-~~~~ls~~~L~~ia~~l---------GsDVPf  141 (308)
T PRK02534         72 AAQLLRKRFPFAELGVDITLEKNIPIGAGLAGGSSDAAAVLVGLNLL-WGLGLTQPELESLAAEL---------GSDVPF  141 (308)
T ss_pred             HHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHC---------CCCCCC
T ss_conf             99999996399988658999836886678884068999999999998-47999989999987511---------688550


Q ss_pred             HHCCCEEEEEECCCEEEEEECCC--CCCEE-ECCCCCCHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHCCCCHHHHHHHC
Q ss_conf             66298589985275156730477--75267-658417989999888998860-823489999999840332078898730
Q gi|254781017|r  154 SIHGGLICYQMPKYSIEKIDFIF--PIHLI-YSGYKTPTAQVLKKISYIEIE-YPEINEINQKIYALMGKLSQISCQALR  229 (324)
Q Consensus       154 ~~~Gg~i~~~~~~~~~~~~~~~~--~l~l~-~tg~~~~T~~~v~~v~~~~~~-~~~~~~~~~~~~~~~~~i~~~~~~al~  229 (324)
T Consensus       142 fl~g~~a~~~G~Ge~l~pl~~~~~~~~llv~~P~~~vST~~~y~~~~~~~~~~~~~~~~~~~~~~~~l~--~~~~~~~~~  219 (308)
T PRK02534        142 CIAGGTQLCFGRGEILEPLPDLDSLGVVLAKYPSLSVSTPWAYKTYRQQFGDTYLSDEEDFEQRRQALR--SGSLLQAIS  219 (308)
T ss_pred             EECCCEEEEECCCCEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCC--CCHHHHHHH
T ss_conf             220851898358867678887765649999589998274999999987503433576034555554213--106889887


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCH-HHHHHHHHHHHHC
Q ss_conf             4864456899999899998616-7877999999999971994599726899754899984665326-8999999999977
Q gi|254781017|r  230 NKNLKVLAQAMNRQQGLLETLG-VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS-LPYQSVNCHMHAK  307 (324)
Q Consensus       230 ~~d~~~l~~lm~~~~~~L~~lg-vs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~-~~~~~~~~~~~~~  307 (324)
T Consensus       220 ~~~~~~l-------~NdLe~~a~~~~P~i~~~~~~L~~~~Ga~~~~mSGSGs--tvFglf~~~~~A~~a~~~l~~~~p~~  290 (308)
T PRK02534        220 AKDPPPL-------RNDLQKVVLPEYPQVAKLLELLSSLPGCLGTMMSGSGP--TCFALFEDQEQAEQALEQVREAFADP  290 (308)
T ss_pred             HCCHHHH-------HHHHHHHHHHCCHHHHHHHHHHHHCCCCCEEEEECHHH--HHEEEECCHHHHHHHHHHHHHHCCCC
T ss_conf             3478988-------64369998873949999999997447988889972410--00379789999999999999867899


Q ss_pred             CCEEEEEE-CCCCCCC
Q ss_conf             97899941-4545644
Q gi|254781017|r  308 GIDIVPIT-PSHSTSL  322 (324)
Q Consensus       308 g~~~~~~~-~~~~~~~  322 (324)
T Consensus       291 ~~~~~v~~~~~~g~~~  306 (308)
T PRK02534        291 GLDAWVCQFISHGIQL  306 (308)
T ss_pred             CCCEEEECCCCCCEEE
T ss_conf             9868975141787374