HHsearch alignment for GI: 254781017 and conserved domain: PTZ00290

>PTZ00290 galactokinase; Provisional.
Probab=100.00  E-value=0  Score=339.50  Aligned_cols=321  Identities=16%  Similarity=0.168  Sum_probs=222.6

Q ss_pred             CCCCCE-----EEEECCEEEEEECCCEEECCCEEEEEEECCEEEEEEEEC---CCCEEEEEECCCCC-CC-----CCCHH
Q ss_conf             988878-----999717049997435330894289877677289999986---89849999536444-46-----56612
Q gi|254781017|r    2 GQCLHK-----ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR---KDRLINIDSSLGQY-CG-----SLDLA   67 (324)
Q Consensus         2 ~~~~~k-----i~~~aPGKv~L~GEh~v~~G~~ai~~aI~~~~~~~~~~~---~~~~i~i~~~~~~~-~~-----~~~~~   67 (324)
T Consensus        27 ~~~~~~~~~~~~farAPGRVNLIGEHtDYngg~VLP~AI~~~t~i~va~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (468)
T PTZ00290         27 KVENDADVEWLLFTFAPGRVNFIGEHVDYMGGYVCPAAVLEGCHILVGRVKHFCDHKLRFATETDEHFVLDHLGGAKHNK  106 (468)
T ss_pred             CCCCCCCCCCEEEEECCCEEEEECCCCCCCCCEEECEEECCCEEEEEEECCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             79986542124799778726540231022898546747016809999842578774699850677652157667788898


Q ss_pred             HCCCHHHHHHH-HHHHHCC------CCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC---------------
Q ss_conf             01508999999-9997187------7873899982687535488740245665567776404566---------------
Q gi|254781017|r   68 MFHPSFSFIIM-AINHIKP------SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE---------------  125 (324)
Q Consensus        68 ~~~~~~~~i~~-~l~~~~~------~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~---------------  125 (324)
T Consensus       107 ~W~nY~~Gv~~~~l~~~g~~~~~~~~~G~~~~v~g~VP~GsGLSSSAAleva~~~al~~~~-~~~~~~~~~~~~~~~~i~  185 (468)
T PTZ00290        107 AWTTFVRGAATLRLNRLGVAIDAPSLQGVCMVVHGTLPMGAGMSASASFGVALLNAINTVV-TRRYKGCPTSPGRRYSIL  185 (468)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHH-HCCCCCCCCCCCCCCCCC
T ss_conf             7631789999999997198767788860599998988774157899999999999999987-422344333432111234


Q ss_pred             --CCCH---HHHHHHHHHHHHHCCCCCC-HHHHHHHCCC---EEEEEECCCEEEEEECC------CCCCEEECCCCCCH-
Q ss_conf             --6601---4557888877652146887-5447766298---58998527515673047------77526765841798-
Q gi|254781017|r  126 --PSPD---EILTTAHAIVLKVQGISSG-IDLAASIHGG---LICYQMPKYSIEKIDFI------FPIHLIYSGYKTPT-  189 (324)
Q Consensus       126 --~~~~---~i~~lA~~~E~~~~g~~sG-~D~~a~~~Gg---~i~~~~~~~~~~~~~~~------~~l~l~~tg~~~~T-  189 (324)
T Consensus       186 ~~~sk~e~~~la~~aqraEn~yvGv~~GiMDQ~aS~~g~~g~al~iDc~~l~~e~v~~~p~~~~~~~~vi~nS~v~h~L~  265 (468)
T PTZ00290        186 PPMSKEELIELAKQARRIETEFCGVNVGIMDQFISAFAEEDKFMFLDCKSLTFESHDMTPLLGDGACFLLIDSMIKHDLL  265 (468)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCEEEEECCCCCEEECCCCCCCCCCCEEEEEECCCHHCCC
T ss_conf             55567789999999999987105788640778899755579589997277753431578666787189998377302046


Q ss_pred             -----------HHHHHHHHHHHHHC----C----------C-------HHHHHHHH--------HHHHCCCCH------H
Q ss_conf             -----------99998889988608----2----------3-------48999999--------984033207------8
Q gi|254781017|r  190 -----------AQVLKKISYIEIEY----P----------E-------INEINQKI--------YALMGKLSQ------I  223 (324)
Q Consensus       190 -----------~~~v~~v~~~~~~~----~----------~-------~~~~~~~~--------~~~~~~i~~------~  223 (324)
T Consensus       266 ~sa~~~Yn~Rr~ece~a~~~l~~~~l~~~~~~~~~l~~~~~~~~~~~d~~~~l~~~~~~~~~~~~~Ra~HVv~E~~RVl~  345 (468)
T PTZ00290        266 GGTAGMYNTVRSDQEGAQKKIGKHRYRGKPFTFSDLVRNPKKYTFDGDVVAFMESCKPLMTPGEFERGTYNIMEQIRTLE  345 (468)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHEEECHHHHHHH
T ss_conf             66423678999999999999818752145310777751624302113589999875642486663000046328899999


Q ss_pred             H-------HHHHCCCCHHHHHHHHHHHHHHHHH-HCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHH
Q ss_conf             8-------9873048644568999998999986-1678779999999999719945997268997548999846653268
Q gi|254781017|r  224 S-------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSL  295 (324)
Q Consensus       224 ~-------~~al~~~d~~~l~~lm~~~~~~L~~-lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~  295 (324)
T Consensus       346 ~~~~~~~~~~l~~~~~~~~lG~LMneSH~Slrd~YEvScpELD~Lve~~~~~~Ga~GARmTGaGFGGC~VaLV~~~~ve~  425 (468)
T PTZ00290        346 FIKLNDPELPLSREERFRKAGEILNAGHQGMRDLMKITTPELDFIHELINEEKGVAGGRMMGGGFGGCIILLLKKNAVDR  425 (468)
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCEEEEEEECHHHHHH
T ss_conf             99866655544122169999999997278898575898188999999997616985700037764021799955878999


Q ss_pred             HHHHHHHHHHH-CCCE--EEEEECCCCCCCC
Q ss_conf             99999999997-7978--9994145456445
Q gi|254781017|r  296 PYQSVNCHMHA-KGID--IVPITPSHSTSLY  323 (324)
Q Consensus       296 ~~~~~~~~~~~-~g~~--~~~~~~~~~~~~~  323 (324)
T Consensus       426 f~~~v~~~Y~~~~g~~~~~~~~~~~~GA~V~  456 (468)
T PTZ00290        426 VVAHVREKFKARFGVENDVYPVVAGDGAFVV  456 (468)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCEEE
T ss_conf             9999999999975999858997227993899