HHsearch alignment for GI: 254781017 and conserved domain: pfam00288

>pfam00288 GHMP_kinases_N GHMP kinases N terminal domain. This family includes homoserine kinases, galactokinases and mevalonate kinases.
Probab=99.34  E-value=1.6e-12  Score=98.45  Aligned_cols=67  Identities=39%  Similarity=0.433  Sum_probs=61.1

Q ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCC
Q ss_conf             899982687535488740245665567776404566660145578888776521468875447766298
Q gi|254781017|r   90 DLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG  158 (324)
Q Consensus        90 ~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg  158 (324)
T Consensus         1 ~i~i~s~iP~g~GLgSSaa~~~a~~~al~~~~-~~~l~~~~l~~~a~~~E~-~~g~~~G~d~~~~~~gg   67 (67)
T pfam00288         1 DIEIESNIPLGAGLGSSAALAVALLLALNELF-GLPLSKEELARLALEAEG-AIGVNSGDDVAASVYGG   67 (67)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHH-CCCCCHHHHHHHHHHHHH-HHCCCCHHHHHHHHCCC
T ss_conf             92575689986786556999999999999995-899899999999999999-81898811677642277