HHsearch results for GI: 254781017 and protein with PDBid: 1kkh_A

>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A
Probab=100.00  E-value=0  Score=362.61  Aligned_cols=296  Identities=23%  Similarity=0.310  Sum_probs=236.1

Q ss_pred             CCCCEEEEECCEEEEEECCCEEECCCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCC--------HH---HCCC
Q ss_conf             888789997170499974353308942898776772899999868984999953644446566--------12---0150
Q gi|254781017|r    3 QCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD--------LA---MFHP   71 (324)
Q Consensus         3 ~~~~ki~~~aPGKv~L~GEh~v~~G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~--------~~---~~~~   71 (324)
                      |-+.+|.+|||||++|+|||+||+|++||++|||+|+++++++++++.+.+.+.........+        ..   .+..
T Consensus         1 ~~~~~~~v~aPgki~L~GEh~v~~G~~al~~aI~~~~~v~i~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (317)
T 1kkh_A            1 PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFKY   80 (317)
T ss_dssp             CTTCCEEEEEEEEEEEECTTGGGGTCCEEEEEEEEEEEEEEEECCSSEEEEEETTTTEEEEEETTTGGGCCGGGSGGGHH
T ss_pred             CCCCEEEEEEEEEEEEECCCCEECCCCEEEEEECCEEEEEEEECCCCEEEEEECCCCCCEEEEHHHCCCCCCCCCCCHHH
T ss_conf             99983999931099998167134799889999626599999998899799997478862688601132358554422899


Q ss_pred             HHHHHHHHHHHHC--CCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             8999999999718--77873899982687535488740245665567776404566660145578888776521468875
Q gi|254781017|r   72 SFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI  149 (324)
Q Consensus        72 ~~~~i~~~l~~~~--~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~  149 (324)
                      ....+...+++..  +..|++|.++|+||.|+|||||||++||++++++.+ ++..+++++++++|+.+|+.+++.+||+
T Consensus        81 ~~~~~~~~~~~~~~~~~~g~~i~i~s~iP~g~GLGSSsA~~va~~~al~~~-~~~~l~~~el~~la~~~E~~~~~~~s~~  159 (317)
T 1kkh_A           81 CLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTIKAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASIT  159 (317)
T ss_dssp             HHHHHHHHHHHTTCCCCSCEEEEEEECSCSSSSSCHHHHHHHHHHHHHHHT-TTCCCCHHHHHHHHHHHHHHHSSSCCSH
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHH-HHCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             999999999982878898669999678988778745689999998876444-1015887887766688986228888876


Q ss_pred             HHHHHHCCCEEEEEECCCEEEEEE------CCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHH
Q ss_conf             447766298589985275156730------47775267658417989999888998860823489999999840332078
Q gi|254781017|r  150 DLAASIHGGLICYQMPKYSIEKID------FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI  223 (324)
Q Consensus       150 D~~a~~~Gg~i~~~~~~~~~~~~~------~~~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~  223 (324)
                      |++++.|||+++++..+....+.+      ....+++++++...+|+++++.++....    ..++.+       ++...
T Consensus       160 D~~~~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~----~~~~~~-------~i~~~  228 (317)
T 1kkh_A          160 DTSTITYKGILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIEN----KDEIFK-------EIDKV  228 (317)
T ss_dssp             HHHHHHHCSEEEESSSCEEEECHHHHHHHHTCCEEEEEEECCCSCHHHHHHHHHTCTT----HHHHHH-------HHHHH
T ss_pred             CHHHHCCCCEEEEECCCCEEECCCHHHCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHH----HHHHHH-------HHHHH
T ss_conf             3034305865996179613611202001111222200206743142989998887766----778999-------98887


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHH
Q ss_conf             89873048644568999998999986167877999999999971994599726899754899984665326899999999
Q gi|254781017|r  224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH  303 (324)
Q Consensus       224 ~~~al~~~d~~~l~~lm~~~~~~L~~lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~  303 (324)
                      ..+|++.+|++.|+++|+++|..++++++++|+++++++.+++. | +++|+||||+|||+++|++++..    +++.++
T Consensus       229 ~~eal~~~d~~~l~~~m~~~~~~~~~~~i~~~~l~~l~~~~~~~-g-~~ak~sGaG~Gg~~~~~~~~~~~----~~~~~~  302 (317)
T 1kkh_A          229 IDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRF-G-FGAKLTGAGGGGCVIILVNEEKE----KELLKE  302 (317)
T ss_dssp             HHHHHHCCSHHHHHHHHHHHHHHHHTTTCCCHHHHHHHHHHHHH-S-SEEEECSSSSSEEEEEECCGGGH----HHHHHH
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHC-C-CEEEEECCCCCCEEEEEECHHHH----HHHHHH
T ss_conf             88876500057899999997999987289988999999999837-9-58998078863889999881579----999999


Q ss_pred             HHHCCCEEEEEEC
Q ss_conf             9977978999414
Q gi|254781017|r  304 MHAKGIDIVPITP  316 (324)
Q Consensus       304 ~~~~g~~~~~~~~  316 (324)
                      |.++|++++....
T Consensus       303 ~~~~~~~~~~~~~  315 (317)
T 1kkh_A          303 LNKEDVRIFNCRM  315 (317)
T ss_dssp             HHTSSCEEEEECB
T ss_pred             HHHCCCEEEEEEE
T ss_conf             9974983999994