HHsearch results for GI: 254781017 and protein with PDBid: 2hfs_A

>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A*
Probab=100.00  E-value=0  Score=393.81  Aligned_cols=306  Identities=23%  Similarity=0.305  Sum_probs=247.7

Q ss_pred             ECCEEEEEECCCEEECCCEEEEEEECCEEEEEEEECCC-CEEEEEECCCCCCCCCCHHHCCCH---HHHHHHHHHHHCCC
Q ss_conf             71704999743533089428987767728999998689-849999536444465661201508---99999999971877
Q gi|254781017|r   11 SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS---FSFIIMAINHIKPS   86 (324)
Q Consensus        11 ~aPGKv~L~GEh~v~~G~~ai~~aI~~~~~~~~~~~~~-~~i~i~~~~~~~~~~~~~~~~~~~---~~~i~~~l~~~~~~   86 (324)
                      .|||||+|+|||+||||++||++|||+|++++++++++ ..+.++........... ..+...   ...+...+....+.
T Consensus        17 ~~~GKv~L~GEhavv~G~~al~~AI~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~~~~~   95 (332)
T 2hfs_A           17 IGYGKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYIA-QKRDEQIKAHQLVLDHLKVDLSG   95 (332)
T ss_dssp             EEEEEEEEECTTGGGGTCCEEEEEEEEEEEEEEEEETTCCSEEEEECCCCCTTHHH-HHHHHHHHHHHHHHHHTTBCCSS
T ss_pred             EEEEEEEEEECCEEECCCCEEEEEEECCEEEEEEECCCCCCEEEECCCCCCCCCCC-CCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             65369999935712359768999930707999998689985697457766754312-23336779999999997313789


Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCEEEEEECC
Q ss_conf             87389998268753548874024566556777640456666014557888877652146887544776629858998527
Q gi|254781017|r   87 CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK  166 (324)
Q Consensus        87 ~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg~i~~~~~~  166 (324)
                      .|++|.++|+||.|+|||||||++||++.|++.+ ++.++++++++++|+.+|+.+||++||+|+++|+|||+++|++.+
T Consensus        96 ~g~~i~i~s~iP~g~GLGSSaA~~va~~~al~~~-~~~~ls~~el~~~A~~~E~~~~g~~sG~D~~as~~Gg~~~~~~~~  174 (332)
T 2hfs_A           96 DGLKMFIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDEEVNLSAFVGEGGYHGTPSGADNTAATYGGLILYRRQN  174 (332)
T ss_dssp             SEEEEEEECSCCCCTTSCHHHHHHHHHHHHHHHH-HTCCCCHHHHHHHHHHHGGGSSSCCCSHHHHHHHHCEEEEEEECS
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHH-HHHCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEECC
T ss_conf             9879999479987778660889999999999877-750589999999999998751589876437899769869999579


Q ss_pred             CE--EEEEECC--CCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             51--5673047--7752676584179899998889988608234899999998403320788987304864456899999
Q gi|254781017|r  167 YS--IEKIDFI--FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR  242 (324)
Q Consensus       167 ~~--~~~~~~~--~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~~lm~~  242 (324)
                      ..  ..+++++  ..+++++++.+++|+++++.++..+.+.+.   ....+.+.+.++++++.++++.+|++.|+++|++
T Consensus       175 ~~~~~~~~~~~~~~~l~l~~tg~~~~T~~~~~~~~~~~~~~~~---~~~~~~~~i~~i~~~~~~al~~~~~~~lg~lm~~  251 (332)
T 2hfs_A          175 GKSVFKPIAFQQRLYLVVVGTGINASTAKVVNDVHKMKQQQPV---QFKRLYDNYTHIVSQAREALQKGDLQRLGQLMNA  251 (332)
T ss_dssp             SSEEEEEECCCSCEEEEEEECSCCCCHHHHHHHHHHHHHHCHH---HHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9579998455551479998189762249999764455553427---7776666789999999987750004567899999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCC-HHHHHHHHHHHHHCCC-EEEEEECCCCC
Q ss_conf             899998616787799999999997199459972689975489998466532-6899999999997797-89994145456
Q gi|254781017|r  243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN-SLPYQSVNCHMHAKGI-DIVPITPSHST  320 (324)
Q Consensus       243 ~~~~L~~lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~-~~~~~~~~~~~~~~g~-~~~~~~~~~~~  320 (324)
                      +|.+|++++||+|+++++++.+++ .|++|+|+||||+|||+++|++++.. ....+.+++.+.+.+| +.+.++|+.|.
T Consensus       252 ~~~~l~~l~vs~p~l~~l~~~a~~-~GalgaklsGaG~Gg~~ial~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~p~~g~  330 (332)
T 2hfs_A          252 NHDLCRQIDVSCRELESIVQTCRT-YGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCPEAKFIWRYTVQPSAAS  330 (332)
T ss_dssp             HHHHHHHTTCCCHHHHHHHHHHHH-TTCSEEEEESSCSSSEEEEEESSHHHHHHHHHHHHHHCTTCCEEEEEEECCSCC-
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHH-CCCCEEEECCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             999998538998899999999997-8994899927898664999987878899999999998886598258997678778


Q ss_pred             CC
Q ss_conf             44
Q gi|254781017|r  321 SL  322 (324)
Q Consensus       321 ~~  322 (324)
                      +|
T Consensus       331 ~i  332 (332)
T 2hfs_A          331 NL  332 (332)
T ss_dssp             --
T ss_pred             CC
T ss_conf             89