HHsearch results for GI: 254781017 and protein with PDBid: 2hke_A

>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei}
Probab=99.54  E-value=7.2e-12  Score=92.92  Aligned_cols=269  Identities=13%  Similarity=0.160  Sum_probs=147.5

Q ss_pred             CEEEEECCEEEEEEC---CC-----EEECCCEEEEEEEC---CEEEEEEEECCC---CEEEEEECCCCCCCCCCHHHCCC
Q ss_conf             789997170499974---35-----33089428987767---728999998689---84999953644446566120150
Q gi|254781017|r    6 HKICVSAPGSLVLMG---EH-----GVLHGHAALVFAIN---KRVILYLTLRKD---RLINIDSSLGQYCGSLDLAMFHP   71 (324)
Q Consensus         6 ~ki~~~aPGKv~L~G---Eh-----~v~~G~~ai~~aI~---~~~~~~~~~~~~---~~i~i~~~~~~~~~~~~~~~~~~   71 (324)
                      +.|+++||-.|-|+=   -+     ..+=-.+.|+++++   .++..++..+++   +.+.+...  +    .+ ....+
T Consensus         4 ~~vt~~AP~NIAlIKYWGKrD~~e~L~lP~N~SiS~TL~~~~~~T~Ttv~~~~~~~~D~~~lNG~--~----~~-~~~~~   76 (380)
T 2hke_A            4 QCVTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLNGT--E----VD-VGKTP   76 (380)
T ss_dssp             CEEEEEECCEEEEECCCCBCTTCTTTTCBSSCEEEEEBCSSSCCEEEEEEEESSCSSCEEEETTE--E----EC-GGGCH
T ss_pred             CEEEEEEECEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCEEEECCE--E----CC-CCCCH
T ss_conf             61999820513465326777888677789998057995599976899999888887757999997--7----87-42016


Q ss_pred             HHHHHHHHHHHHC----CCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             8999999999718----778738999826875354887402456655677764045666601455788887765214688
Q gi|254781017|r   72 SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISS  147 (324)
Q Consensus        72 ~~~~i~~~l~~~~----~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~s  147 (324)
                      -+..++..++...    ....++|....++|..+||.||||-.+|++.|+..+. +.   ..++..+|..      |.+|
T Consensus        77 ri~~~l~~ir~~~~~~~~~~~~~I~S~NnFPtaAGLASSAsg~AALa~al~~~~-~~---~~~lS~lAR~------GSGS  146 (380)
T 2hke_A           77 RVQSMLLHLRSTCPEELKNKKVNIVSENNFPTAAGMASSASGYCAMSAALIRAF-KS---TTNVSMLARL------GSGS  146 (380)
T ss_dssp             HHHHHHHHHHTSSCHHHHTCEEEEEEEECSCTTSCCCHHHHHHHHHHHHHHHHH-TC---SSCHHHHHHH------HCGG
T ss_pred             HHHHHHHHHHHHCHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHH-CC---CHHHHHHHHH------HCCC
T ss_conf             899999999985614304751699975788205657877899999999999874-25---4457899875------2765


Q ss_pred             CHHHHHHHCCCEEEEEECCCE------EEEEE--CCCC-----CCEEECCCCCC--HHHHHHHHHHHHHHCCCHHHHHHH
Q ss_conf             754477662985899852751------56730--4777-----52676584179--899998889988608234899999
Q gi|254781017|r  148 GIDLAASIHGGLICYQMPKYS------IEKID--FIFP-----IHLIYSGYKTP--TAQVLKKISYIEIEYPEINEINQK  212 (324)
Q Consensus       148 G~D~~a~~~Gg~i~~~~~~~~------~~~~~--~~~~-----l~l~~tg~~~~--T~~~v~~v~~~~~~~~~~~~~~~~  212 (324)
                         .+-|+|||++.+..+...      -.++.  ..++     +++++.+.+.-  |..+    +...+..|.+......
T Consensus       147 ---AcRSi~GGfv~W~~g~~~dgsds~A~qi~~~~~w~~l~~~ilvvs~~~K~vsSt~GM----~~~v~TSpl~~~r~~~  219 (380)
T 2hke_A          147 ---ACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQVMCAVLKGAQKDVSSTKGM----QQSLKTSPLMKKRISE  219 (380)
T ss_dssp             ---GGGGGSSSEEEEECCSCTTSTTCEEEEEECTTSCTTEEEEEEECCCCSCCCCHHHHH----HHHHHHCTTHHHHHHT
T ss_pred             ---CHHHHCCCEEEECCCCCCCCCCCCEEECCCCCCCCCCEEEEEEECCCCCCCCCHHHH----HHHHHHCCCHHHHHHH
T ss_conf             ---013303884572268999960000352366445511206999943776777752889----9998839108999998


Q ss_pred             HHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHH------C--CCCHHHHHHH---HHHHH-CCCCEEEECCCCCC
Q ss_conf             99840332078898730486445689999989999861------6--7877999999---99997-19945997268997
Q gi|254781017|r  213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------G--VSDSKLSEIV---WKLRE-QPHIMASKISGSGL  280 (324)
Q Consensus       213 ~~~~~~~i~~~~~~al~~~d~~~l~~lm~~~~~~L~~l------g--vs~~~l~~li---~~~~~-~~g~~~aklsGAG~  280 (324)
                         ...+..++..+|++++|++.|+++.-..-..+.++      .  .-+|..-++|   +..+. .++.-.+--.=||+
T Consensus       220 ---~~~~~~~~~~~Ai~~~Df~~~~ei~e~ds~~mHA~~l~s~Ppi~Yl~~~S~~ii~~V~~~r~~~~~~~v~yT~DAGP  296 (380)
T 2hke_A          220 ---TVPERMKIASRAIKARDFATFAEIAMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGA  296 (380)
T ss_dssp             ---HHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHTSSSCCCCCCHHHHHHHHHHHHHHHHHTSCCEEEECCSSS
T ss_pred             ---HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             ---63778999999998399999999999999999999853799879978469999999999997468941999978898


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHH
Q ss_conf             54899984665326899999999
Q gi|254781017|r  281 GDCVIALGKGDLNSLPYQSVNCH  303 (324)
Q Consensus       281 GG~~i~l~~~~~~~~~~~~~~~~  303 (324)
                        -+..|+..+..+++++.+...
T Consensus       297 --Nv~ll~~~~~~~~v~~~l~~~  317 (380)
T 2hke_A          297 --NCFLFVLKEDLPEAVAMLMEH  317 (380)
T ss_dssp             --CEEEEEEGGGHHHHHHHHHHH
T ss_pred             --CEEEEECCCCHHHHHHHHHHH
T ss_conf             --779997251299999999987