HHsearch results for GI: 254781017 and protein with PDBid: 2ww4_A

>2ww4_A 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-mevalonate pathway, isoprenoid biosynthesis, transferase; HET: ADP; 2.00A {Escherichia coli} PDB: 1oj4_A*
Probab=99.88  E-value=6.8e-21  Score=150.01  Aligned_cols=260  Identities=15%  Similarity=0.159  Sum_probs=164.0

Q ss_pred             EEECCEEEEEEC----CCEEECCC---EEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHHCCCHHHHHHHHHH
Q ss_conf             997170499974----35330894---28987767728999998689849999536444465661201508999999999
Q gi|254781017|r    9 CVSAPGSLVLMG----EHGVLHGH---AALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAIN   81 (324)
Q Consensus         9 ~~~aPGKv~L~G----Eh~v~~G~---~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~i~~~l~   81 (324)
                      .--||+||||+=    ...  .|+   ..+-..||++..++++++++..+.+........  ...+........+.....
T Consensus         4 ~~~aPAKiNL~L~V~~kr~--dGyH~l~s~~~~i~L~D~I~i~~~~~~~i~i~~~~~~~~--~~~n~~~ka~~~l~~~~~   79 (283)
T 2ww4_A            4 QWPSPAKLNLFLYITGQRA--DGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVE--HEDNLIVRAARLLMKTAA   79 (283)
T ss_dssp             EEEEEEEEEEEEEEEEECT--TSCEEEEEEEEEEEEEEEEEEEEESSSCEEECSCBTTBC--GGGSHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEECCEEECCCCC--CCCCEEEEEEEEECCCCEEEEEECCCCCEEEECCCCCCC--CCCCHHHHHHHHHHHHHH
T ss_conf             6587023706631088799--997503678897078859999998999889970776577--310168999999999865


Q ss_pred             H---HCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCC
Q ss_conf             7---1877873899982687535488740245665567776404566660145578888776521468875447766298
Q gi|254781017|r   82 H---IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG  158 (324)
Q Consensus        82 ~---~~~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg  158 (324)
                      .   +....|++|++..+||+++|||||||.++|++.+++++ ++.+++.+++.++|..+         |.|+..+.+||
T Consensus        80 ~~~~~~~~~~~~I~i~KnIP~gaGLGggSs~aAa~l~~ln~l-~~~~l~~~~l~~~a~~i---------gsDVp~~l~g~  149 (283)
T 2ww4_A           80 DSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHL-WQCGLSMDELAEMGLTL---------GADVPVFVRGH  149 (283)
T ss_dssp             HTTCSCTTCEEEEEEECCCC-CTTSCHHHHHHHHHHHHHHHH-TTCCCCHHHHHHHHHTT---------CTTHHHHHHTB
T ss_pred             HHHHCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHC---------CCCCCCEECCC
T ss_conf             543127789769999748987766775717999999999997-17883089999987321---------57874322486


Q ss_pred             EEEEEECCCEEEEEEC-CCCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHH
Q ss_conf             5899852751567304-777526765841798999988899886082348999999984033207889873048644568
Q gi|254781017|r  159 LICYQMPKYSIEKIDF-IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA  237 (324)
Q Consensus       159 ~i~~~~~~~~~~~~~~-~~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~  237 (324)
                      ..+.......+.+++. ...+++++.+...+|+++-+.+..... .+.             ...+....+...+|++...
T Consensus       150 ~a~~~g~Ge~i~~~~~~~~~~vlv~P~~~iST~~~~~~~~~~~~-~~~-------------~~~~~~~~~~~~Ndle~~~  215 (283)
T 2ww4_A          150 AAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRN-TPK-------------RSIETLLKCEFSNDCEVIA  215 (283)
T ss_dssp             CEEEETTTTEEEECCCCCCEEEEECCSCCCCHHHHHTCTTSCCC-CCC-------------CCHHHHHTSCCCBTTHHHH
T ss_pred             CEEECCCCCEEEECCCCCCCCEEECCCCCCCHHHHHHCCCCCCC-CCC-------------CCHHHHHHHHHHCCHHHHH
T ss_conf             16743898676403565432067448978772999970001337-740-------------1399999765413189999


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             99999899998616787799999999997199459972689975489998466532689999999999779789994145
Q gi|254781017|r  238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPS  317 (324)
Q Consensus       238 ~lm~~~~~~L~~lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  317 (324)
                      .          ++   .|++.++.+.+.+. |  ++.|||+|+  |++++++++.+++   ++.+.+. ..++.+-+++-
T Consensus       216 ~----------~~---~p~i~~i~~~l~~~-g--~~~mSGSGs--tvFal~~~~~~a~---~~~~~~~-~~~~~~~~k~~  273 (283)
T 2ww4_A          216 R----------KR---FREVDAVLSWLLEY-A--PSRLTGTGA--CVFAEFDTESEAR---QVLEQAP-EWLNGFVAKGV  273 (283)
T ss_dssp             H----------HH---CHHHHHHHHHHHTT-S--CEEECTTSS--CEEEEESSHHHHH---HHHHHCC-C-CCEEEEEEE
T ss_pred             H----------HH---CHHHHHHHHHHHCC-C--CEEEECHHH--EEEEEECCHHHHH---HHHHHCC-CCCCEEEECCC
T ss_conf             9----------86---86999999998566-9--868626401--1105879999999---9998640-40769994867


Q ss_pred             C
Q ss_conf             4
Q gi|254781017|r  318 H  318 (324)
Q Consensus       318 ~  318 (324)
                      +
T Consensus       274 ~  274 (283)
T 2ww4_A          274 N  274 (283)
T ss_dssp             S
T ss_pred             C
T ss_conf             5