HHsearch results for GI: 254781017 and protein with PDBid: 3hul_A

>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes}
Probab=99.97  E-value=4e-29  Score=202.07  Aligned_cols=283  Identities=15%  Similarity=0.156  Sum_probs=194.7

Q ss_pred             EEEEECCEEEEEECCCEEECCCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHHCCCHHHHHHHHHHHHCCC
Q ss_conf             89997170499974353308942898776772899999868984999953644446566120150899999999971877
Q gi|254781017|r    7 KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPS   86 (324)
Q Consensus         7 ki~~~aPGKv~L~GEh~v~~G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~~   86 (324)
                      +|.||+|+++--.|-     |+.+|.+|||+|.++++++.++.... ....   ...++.+..+..   +....+.+...
T Consensus         2 ~~~v~~Pat~aN~g~-----Gfd~lg~Ai~l~d~v~v~~~~~~~~i-~~~~---~~~~~~d~~nli---~~~~~~~~~~~   69 (298)
T 3hul_A            2 SLRIRVPATTANLGP-----GFDSCGLALTLYLTLDIGAEADSWYI-EHNI---GGGIPHDETNVI---IETALNLAPNL   69 (298)
T ss_dssp             CEEEEEEEEEESCTT-----CTTTEEEEEEEEEEEEEEEECSSCEE-ECCC---CTTCCSSTTSHH---HHHHHHHCTTC
T ss_pred             EEEEEEEEEHHHCCC-----CHHHEEEECCCCEEEEEEECCCCEEE-EECC---CCCCCCCCHHHH---HHHHHHHHCCC
T ss_conf             799996017565072-----72551560108859999983895599-9378---677999952699---99999863437


Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCEEEEEE-C
Q ss_conf             873899982687535488740245665567776404566660145578888776521468875447766298589985-2
Q gi|254781017|r   87 CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM-P  165 (324)
Q Consensus        87 ~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~~~~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg~i~~~~-~  165 (324)
                      .+++|+++++||+++|||||||.++|++.+++++ ++..++.+++.+++...+      +++.|..++.+||...+.. .
T Consensus        70 ~~~~I~i~k~IP~gaGLGssSa~aaA~l~al~~~-~~~~l~~~~l~~~~~~~~------~~~~~~~~~~~~g~~~~~~~~  142 (298)
T 3hul_A           70 TPHHLVMTCDIPPARGLGSSSAAVVAGIELANTL-AELNLSKEEKVRIAAEIE------GHPDNVAPAVLGNWVVGAKLD  142 (298)
T ss_dssp             CCEEEEEEECSCTTSSSSHHHHHHHHHHHHHHHH-TTCCCCHHHHHHHHHHHH------SCSTTHHHHHHCSEEEEEEET
T ss_pred             CCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH-HCCCCCHHHHHHHHHHCC------CCCCCCCEEEECCCEEEEECC
T ss_conf             8837999726877668785288999999999997-287777678898864345------567887639975836999658


Q ss_pred             CCEEEEEECC--CCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             7515673047--77526765841798999988899886082348999999984033207889873048644568999998
Q gi|254781017|r  166 KYSIEKIDFI--FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ  243 (324)
Q Consensus       166 ~~~~~~~~~~--~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~~lm~~~  243 (324)
                      ...+..++.+  ..++++.++...+|++..+.+    .+.....+....     .........++.++|++.++.+++..
T Consensus       143 ~~~~~~~~~~~~~~~vi~~~~~~~st~~~~~~~----~~~~~~~~~~~~-----~~~~~~~~~~~~~~d~~~~~~~~~~~  213 (298)
T 3hul_A          143 GEDFYVRHLFPDCALIAFIPKAELLTSESRGVL----PDTLPFKEAVQA-----SSIANVMIAAILRNDMTLAGEMMERD  213 (298)
T ss_dssp             TEEEEEEECCC-CEEEEEECCCCCC------------CCEEEHHHHHHH-----HHHHHHHHHHHTTTCHHHHHHHHTCC
T ss_pred             CCEEEEECCCCCCCEEEEECCCCCCCCEEEEEC----CCCCCHHHHHHH-----HHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             856899336876417999468345511212201----023665666554-----44567888766338899998653101


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCC--CEEEEEEC-CCCC
Q ss_conf             99998616787799999999997199459972689975489998466532689999999999779--78999414-5456
Q gi|254781017|r  244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG--IDIVPITP-SHST  320 (324)
Q Consensus       244 ~~~L~~lgvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~~g--~~~~~~~~-~~~~  320 (324)
                      +.........+|+++++++.++ ..|+++++|||+|+  |+++|++++.    .+++.+++.+.|  ++++.+++ ..|.
T Consensus       214 ~~~~~~~~~l~p~l~~l~~~~~-~~Ga~ga~lSGsGp--tvfal~~~~~----a~~v~~~l~~~~~~~~v~~~~~~~~Ga  286 (298)
T 3hul_A          214 LWHEKYRSQLVPHLAQIRDVAK-NQGAYAACLSGAGP--TVLVFAPRNL----ANKLQTSLQTLEIDADVLLLDVEGSGA  286 (298)
T ss_dssp             CC-----CTTGGGHHHHHHHHH-TTTCCEEEECTTSS--CEEEEECGGG----HHHHHHHHHTTCCSSEEEEEEBCCCCC
T ss_pred             CCCHHHHHHHCHHHHHHHHHHH-HCCCCEEEEECCCC--CEEEEECHHH----HHHHHHHHHHCCCCEEEEEEEECCCCE
T ss_conf             0006789885615899999998-49993899945015--1799977999----999999998659986999900269956


Q ss_pred             CCCC
Q ss_conf             4459
Q gi|254781017|r  321 SLYR  324 (324)
Q Consensus       321 ~~~~  324 (324)
                      +|+|
T Consensus       287 ~V~~  290 (298)
T 3hul_A          287 EVFR  290 (298)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9998