HHSEARCH alignment of GI: 254781017 and SCOP domain: d1h72c2

Alignment
>d1h72c2 d.58.26.1 (C:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=98.09  E-value=2.8e-05  Score=49.70  Aligned_cols=129  Identities=13%  Similarity=0.089  Sum_probs=75.9

Q ss_pred             CCCCCCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHH--HHHHHH-HH
Q ss_conf             477752676584179899998889988608234899999998403320788987304864456899999--899998-61
Q gi|254781017|r  174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR--QQGLLE-TL  250 (324)
Q Consensus       174 ~~~~l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~~lm~~--~~~~L~-~l  250 (324)
                      |..+++++..+...+|+++.+.+   .+..+ ..+...++-     .......++..+|++.+++.+..  -|+--+ . 
T Consensus         1 ~~l~~vl~~P~~~vsT~~aR~~L---P~~~~-~~dav~n~~-----~~~~lv~al~~~d~~l~~~~~~~D~l~Ep~r~~-   70 (133)
T d1h72c2           1 FKLDILIAIPNISINTKEAREIL---PKAVG-LKDLVNNVG-----KACGMVYALYNKDKSLFGRYMMSDKVIEPVRGK-   70 (133)
T ss_dssp             SCCCEEEECCSSCCCHHHHHHTS---CSCCC-HHHHHHHHH-----HHHHHHHHHHTTCHHHHHHHHTTCCSSHHHHHT-
T ss_pred             CEEEEEEEECCCCCCHHHHHHHC---HHHCC-HHHHHHHHH-----HHHHHHHHHHCCCHHHHHHHHHCCCCCCCEECC-
T ss_conf             96699999899988589999866---54397-999987042-----148899987406788999998468444710010-


Q ss_pred             CCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCC
Q ss_conf             678779999999999719945997268997548999846653268999999999977978999414545644
Q gi|254781017|r  251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSL  322 (324)
Q Consensus       251 gvs~~~l~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~  322 (324)
                        ..|+++++.+ +. ..|++|+-|||||+  ++++|++.+......+.++.+++    ..+....+.|..+
T Consensus        71 --l~P~~~~ik~-~l-~~ga~~~~lSGSGP--Tv~al~~~~~~~~~~~~l~~~~~----~~~~~~~~~G~~V  132 (133)
T d1h72c2          71 --LIPNYFKIKE-EV-KDKVYGITISGSGP--SIIAFPKEEFIDEVENILRDYYE----NTIRTEVGKGVEV  132 (133)
T ss_dssp             --TSTTHHHHHH-HH-TTTEEEEEECTTSS--CEEEEECGGGHHHHHHHHHHHCS----CEEEECBCCCCEE
T ss_pred             --CCCCHHHHHH-HH-HCCCEEEEEECCCC--CEEEEECHHHHHHHHHHHHHHHH----HCEEECCCCCCEE
T ss_conf             --4973699999-85-35866999967997--07998373789999999999874----0789457997287


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: GHMP Kinase, C-terminal domain
family: Homoserine kinase
domain: Homoserine kinase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]