HHSEARCH alignment of GI: 254781017 and SCOP domain: d1kkha2

Alignment
>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=99.84  E-value=1.3e-20  Score=146.70  Aligned_cols=123  Identities=24%  Similarity=0.350  Sum_probs=98.6

Q ss_pred             CCEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             52676584179899998889988608234899999998403320788987304864456899999899998616787799
Q gi|254781017|r  178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKL  257 (324)
Q Consensus       178 l~l~~tg~~~~T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al~~~d~~~l~~lm~~~~~~L~~lgvs~~~l  257 (324)
                      +++.+++.+++|+++++.|+...    ...++    +..+..++   .+|++.+|++.||++|+++|.+|++||||+|++
T Consensus        14 Lv~~~t~~~~~t~~~v~~v~~~~----~~~~i----~~~~~~~~---~~al~~~d~~~lg~lm~~~~~~l~~lgvs~~~i   82 (137)
T d1kkha2          14 LIVYAEKRKKKTAELVNEVAKIE----NKDEI----FKEIDKVI---DEALKIKNKEDFGKLMTKNHELLKKLNISTPKL   82 (137)
T ss_dssp             EEEEEECCCSCHHHHHHHHHTCT----THHHH----HHHHHHHH---HHHHHCCSHHHHHHHHHHHHHHHHTTTCCCHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH----HHHHH----HHHHHHHH---HHHHHCCCHHHHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             99973683342999999999997----62299----99999999---999982899999999999999998705895899


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             999999997199459972689975489998466532689999999999779789994145
Q gi|254781017|r  258 SEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPS  317 (324)
Q Consensus       258 ~~li~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  317 (324)
                      |.+++.+++. | +|+|+||||+|||+++|++++..    +.+.+.|.++|++++.++-.
T Consensus        83 d~l~~~~~~~-g-~GaKitGAGgGG~~ial~~~~~~----~~~~~~l~~~~~~~f~~~~~  136 (137)
T d1kkha2          83 DRIVDIGNRF-G-FGAKLTGAGGGGCVIILVNEEKE----KELLKELNKEDVRIFNCRMM  136 (137)
T ss_dssp             HHHHHHHHHH-S-SEEEECSSSSSEEEEEECCGGGH----HHHHHHHHTSSCEEEEECBC
T ss_pred             HHHHHHHHHC-C-CCCCCCCCCCCCEEEEEECHHHH----HHHHHHHHHCCCHHEEEECC
T ss_conf             9999999853-8-87420158998179998573549----99999999818301322547


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: GHMP Kinase, C-terminal domain
family: Mevalonate kinase
domain: Mevalonate kinase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]