BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (324 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040694|gb|ACT57490.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 324

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY
Sbjct: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL
Sbjct: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
           QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL
Sbjct: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM
Sbjct: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV
Sbjct: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300

Query: 301 NCHMHAKGIDIVPITPSHSTSLYR 324
           NCHMHAKGIDIVPITPSHSTSLYR
Sbjct: 301 NCHMHAKGIDIVPITPSHSTSLYR 324


>gi|315122512|ref|YP_004063001.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495914|gb|ADR52513.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 327

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 268/325 (82%), Gaps = 3/325 (0%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCL KI V+APGS+VLMGEH VL+G AALVFAI+KR+ L LTLRKDRLINI+SSLGQY
Sbjct: 1   MGQCLQKIRVNAPGSIVLMGEHAVLYGQAALVFAIDKRISLCLTLRKDRLININSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDL M HPSFSFII A+ +IKP  GFDL++ S++D +LGLGSSAAIT +ITAALLTL
Sbjct: 61  CGSLDLPMSHPSFSFIITALEYIKPESGFDLEITSEIDCRLGLGSSAAITASITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFP 177
           QY K+P  +EI   A+ IVLK QG +SGIDLAASI+GGLI Y+M    +YSIE + +  P
Sbjct: 121 QYQKKPPKEEIFKKAYDIVLKTQGKASGIDLAASIYGGLIFYRMSELSEYSIEHVSYNLP 180

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           IHL+YSGYKTPT+QVL KIS +EIEYP I +INQ IYALMG+LS+IS  ALR+ N+K+LA
Sbjct: 181 IHLVYSGYKTPTSQVLNKISQVEIEYPAIKKINQTIYALMGELSEISLHALRDGNIKLLA 240

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
           QAMNRQQGLLETLGVSD  LS+IVW+LREQ  +MA+KISGSGLGDCVIALG+     L Y
Sbjct: 241 QAMNRQQGLLETLGVSDPTLSDIVWRLREQSLVMAAKISGSGLGDCVIALGESRSQFLFY 300

Query: 298 QSVNCHMHAKGIDIVPITPSHSTSL 322
            S++C MH+KGI I PIT S+ST L
Sbjct: 301 PSIDCSMHSKGIYIAPITSSYSTHL 325


>gi|78486074|ref|YP_391999.1| GHMP kinase [Thiomicrospira crunogena XCL-2]
 gi|78364360|gb|ABB42325.1| mevalonate kinase [Thiomicrospira crunogena XCL-2]
          Length = 295

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 177/297 (59%), Gaps = 7/297 (2%)

Query: 19  MGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIM 78
           MGEH V++GH A+  ++N R+ ++ + R D  I+I S+LG +         HPS  ++I 
Sbjct: 1   MGEHSVVYGHKAIASSLNHRLSIHWSTRNDNEIHIVSTLGHHITDTQTLAEHPSLKWVIA 60

Query: 79  AINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAH 136
            + H +     G ++++ S   S +GLGSSAA+  A+   L  +   K  S + +  T  
Sbjct: 61  CLKHYQTKLITGLNIEIDSDFSSTVGLGSSAAVLAAMLGGLDYITQEK-ASLEALFDTGL 119

Query: 137 AIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKI 196
            I+  +QG  SG DLAAS+HGG+I +     S++K+   FPI L+Y GYKT TA VL+K+
Sbjct: 120 KIIQSIQGRGSGTDLAASLHGGIILFDPQNQSVQKLVCDFPISLVYCGYKTSTATVLEKV 179

Query: 197 SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSK 256
           +    ++ +  E+   +Y +MG+ ++ + Q+L N ++    + +N  QGL++ LGV+D+ 
Sbjct: 180 A---TDWQDQPELLHHLYQIMGQTTEAAYQSLVNNDVDSFYKRVNTYQGLMDALGVNDAT 236

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP-YQSVNCHMHAKGIDIV 312
           LS +V++LR+   I ASKISGSGLGDCVI  G     +LP Y+S+  H+  +G+ I 
Sbjct: 237 LSHLVYQLRQDREIQASKISGSGLGDCVIGFGIMQPQTLPNYESILAHLSTEGLSIT 293


>gi|89094694|ref|ZP_01167630.1| GHMP kinase [Oceanospirillum sp. MED92]
 gi|89081040|gb|EAR60276.1| GHMP kinase [Oceanospirillum sp. MED92]
          Length = 309

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 180/310 (58%), Gaps = 7/310 (2%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           +  I V  PGS++LMGEH VL G  AL  A++K + + L  R D  I+IDS+L QY   L
Sbjct: 1   MSTIKVKVPGSIMLMGEHAVLFGEKALACAVDKYIHIELVPRPDSEIHIDSALAQYQSVL 60

Query: 65  DLAMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
           +     P  SF+I A+     K   GF L++ S+   ++GLGSSAA+T  + AAL     
Sbjct: 61  EDIADEPKLSFVIAAVRRYSAKLPSGFLLRIQSEFSHKVGLGSSAAVTAGVVAALSAFT- 119

Query: 123 HKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
           ++   P  +   A  IV +VQ G  SG DL ASI+G ++ Y++    I  +  +  I L 
Sbjct: 120 NQSLEPQALFDKALKIVHQVQEGRGSGTDLVASIYGAVVSYRVEPREITSLPALPEISLF 179

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           Y+GYKT T  VLK +    ++ PE+     +IY LMG +++ +  AL+ KN   L + MN
Sbjct: 180 YAGYKTKTPDVLKIVEAKAVKQPEVY---SEIYKLMGLVTEKAEVALKQKNWLALGELMN 236

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN 301
             QGL++ LGVSD  L +I++ LR    I+ +KISGSGLGDCV++LG     +LPY+ + 
Sbjct: 237 NYQGLMDALGVSDRSLCDIIYSLRGSGRILGAKISGSGLGDCVLSLGNDSGLTLPYEQIP 296

Query: 302 CHMHAKGIDI 311
             + A+G+ I
Sbjct: 297 VGVSAEGVTI 306


>gi|29653946|ref|NP_819638.1| mevalonate kinase [Coxiella burnetii RSA 493]
 gi|154707393|ref|YP_001424027.1| phosphomevalonate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|161830011|ref|YP_001596533.1| mevalonate kinase [Coxiella burnetii RSA 331]
 gi|165918997|ref|ZP_02219083.1| mevalonate kinase [Coxiella burnetii RSA 334]
 gi|212212909|ref|YP_002303845.1| phosphomevalonate kinase [Coxiella burnetii CbuG_Q212]
 gi|29541209|gb|AAO90152.1| phosphomevalonate kinase [Coxiella burnetii RSA 493]
 gi|154356679|gb|ABS78141.1| phosphomevalonate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|161761878|gb|ABX77520.1| mevalonate kinase [Coxiella burnetii RSA 331]
 gi|165917322|gb|EDR35926.1| mevalonate kinase [Coxiella burnetii RSA 334]
 gi|212011319|gb|ACJ18700.1| phosphomevalonate kinase [Coxiella burnetii CbuG_Q212]
          Length = 313

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 169/302 (55%), Gaps = 12/302 (3%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY---CGSLDLAM 68
           APGSL+L+GE+ VL G  A+V AI+K + + L+ R D  INIDS LG+    C S+ L+ 
Sbjct: 7   APGSLMLLGEYAVLQGKTAIVAAIDKFISISLSPRHDEKINIDSPLGKLTLDCQSIKLS- 65

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
             P F F++ A+   K   G D+ + S L   +GLGSSAA+TVA+  A L        + 
Sbjct: 66  --PPFEFVLAALASKKLPSGCDINIQSTLPPAIGLGSSAAVTVALLTA-LNAWLQMSMTK 122

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           +++   A  ++  VQG  SG D AASI+GG++ +  P +S+  +    PI  IYSG K  
Sbjct: 123 NDLWQQALTVIKTVQGKGSGADCAASIYGGVLAFSNPPFSVTSLKSRPPITAIYSGKKLT 182

Query: 189 TAQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           TA+ +  ++    + P+   +I+Q+    M +L+  + + +  KN   L + +N  Q L+
Sbjct: 183 TARAIDIVNQRRQKQPDFYQQIDQR----MNELTVQAIEIINAKNWPALGRLLNLGQELM 238

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            T GVS+  L  ++  LR+QP I  +KISG+GLGDCVI +G    +  P  +    +  K
Sbjct: 239 ATFGVSNEILESLIEGLRKQPTIFGAKISGAGLGDCVIGIGTLKPDRFPRNNTEKKLGVK 298

Query: 308 GI 309
            I
Sbjct: 299 QI 300


>gi|20429111|emb|CAD24422.1| phosphomevalonate kinase [Paracoccus zeaxanthinifaciens]
          Length = 305

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 164/291 (56%), Gaps = 18/291 (6%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-YCGSLDL 66
           I  SAPGS+++ GEH V++GH A+V  I +R  + +  R DR+  I S +G    GSLD 
Sbjct: 5   IRASAPGSVMITGEHAVVYGHRAIVAGIEQRAHVTIVPRADRMFRITSQIGAPQQGSLDD 64

Query: 67  AMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH- 123
                ++ F++ AI    P   CGFD+ + S +D +LGLGSSAA+TVA   AL  L    
Sbjct: 65  LPAGGTYRFVLAAIARHAPDLPCGFDMDITSGIDPRLGLGSSAAVTVACLGALSRLAGRG 124

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI----FPIH 179
            E   D+ L     IV  +QG  SG DLAAS+HGG + Y+ P     +I+ +     P  
Sbjct: 125 TEGLHDDALR----IVRAIQGRGSGADLAASLHGGFVAYRAPDGGAAQIEALPVPPGPFG 180

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEIN-QKIYALMGKLSQISCQALRNKNLKVLAQ 238
           L Y+GYKTPTA+VL+ ++    +    NE     +Y+ MG  +  + +A +  +      
Sbjct: 181 LRYAGYKTPTAEVLRLVA----DRMAGNEAAFDALYSRMGASADAAIRAAQGLDWAAFHD 236

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           A+N  Q L+E LGVSD  L  I+ + R+    +A KISGSGLGDCV+ALG 
Sbjct: 237 ALNEYQRLMEQLGVSDDTLDAIIREARDAGAAVA-KISGSGLGDCVLALGD 286


>gi|153207704|ref|ZP_01946351.1| mevalonate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218971|ref|YP_002305758.1| phosphomevalonate kinase [Coxiella burnetii CbuK_Q154]
 gi|120576400|gb|EAX33024.1| mevalonate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|212013233|gb|ACJ20613.1| phosphomevalonate kinase [Coxiella burnetii CbuK_Q154]
          Length = 313

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 169/302 (55%), Gaps = 12/302 (3%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY---CGSLDLAM 68
           APGSL+L+GE+ VL G  A+V AI+K + + L+ R D  INIDS LG+    C S+ L+ 
Sbjct: 7   APGSLMLLGEYAVLQGKTAIVAAIDKFISISLSPRHDEKINIDSPLGKLTLDCQSIKLS- 65

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
             P F F++ A+   K   G D+ + S L   +GLGSSAA+TVA+  A L        + 
Sbjct: 66  --PPFEFVLAALASKKLPSGCDINIQSTLPPAIGLGSSAAVTVALLTA-LNAWLQMSMTK 122

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           +++   A  ++  VQG  SG D AASI+GG++ +  P +S+  +    PI  IYSG K  
Sbjct: 123 NDLWQQALTVIKTVQGKGSGADCAASIYGGVLAFSNPPFSVTSLKSRPPITAIYSGKKLT 182

Query: 189 TAQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           TA+ +  ++    + P+   +I+Q+    M +L+  + + +  KN   L + +N  Q L+
Sbjct: 183 TARAIDIVNQRRQKQPDFYPQIDQR----MNELTVQAIEIINAKNWPALGRLLNLGQELM 238

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            T GVS+  L  ++  LR+QP I  +KISG+GLGDCVI +G    +  P  +    +  K
Sbjct: 239 ATFGVSNEILESLIEGLRKQPTIFGAKISGAGLGDCVIGIGTLKPDRFPRNNTEKKLGVK 298

Query: 308 GI 309
            I
Sbjct: 299 QI 300


>gi|258545075|ref|ZP_05705309.1| mevalonate kinase [Cardiobacterium hominis ATCC 15826]
 gi|258519695|gb|EEV88554.1| mevalonate kinase [Cardiobacterium hominis ATCC 15826]
          Length = 301

 Score =  168 bits (426), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 157/284 (55%), Gaps = 8/284 (2%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPGS+++ GEH V++G  A+V AI +R+ + ++ R DR I+I+S+L  +   L   
Sbjct: 5   LTASAPGSIMITGEHAVVYGAPAIVCAIEQRIRIRVSTRADREIHIESALAAHHTDLATL 64

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP   F+I A+    P+ G D+ + S +D  LGLGSSAA+T AITA L  L+  + P 
Sbjct: 65  ADHPQLRFLIAALRQNPPASGLDIAIDSDIDPTLGLGSSAAVTAAITALLYRLR-GQNPD 123

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP--IHLIYSGY 185
              +   A+  +L VQ   SG DLAAS+ GG+I YQ   +++       P  + L Y+GY
Sbjct: 124 LLALHRAAYRTILTVQQRGSGADLAASLAGGIIAYQNRPFTVITPLPAPPSGLSLRYAGY 183

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           KTPTA+VL +I+      P   E  + +Y  MG  S  S  A    +       +N+ Q 
Sbjct: 184 KTPTAEVLARIAASATVDP---EYYRDLYDRMGASSARSIAAAERGDWADFYHELNQYQE 240

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            +  LGV D   +E +   R Q H  A KISGSGLGDC++AL  
Sbjct: 241 HMTALGVCDHTQAEHLAAARPQAH--AVKISGSGLGDCILALAD 282


>gi|254513339|ref|ZP_05125404.1| putative mevalonate kinase [Rhodobacteraceae bacterium KLH11]
 gi|221532343|gb|EEE35339.1| putative mevalonate kinase [Rhodobacteraceae bacterium KLH11]
          Length = 316

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 163/318 (51%), Gaps = 26/318 (8%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-SLDL 66
           I VSAPGS+++ GEH V++G  ++V AI++RV +      +R + I S +       LD+
Sbjct: 6   IKVSAPGSIMITGEHAVVYGQPSIVCAIDQRVTVEALPLTERRVEIVSDIAPPVTLPLDV 65

Query: 67  AMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
                 + FI+ A+         G  L V S++D  LGLGSSAA+T+A   AL T+   +
Sbjct: 66  ISGDGPYRFILSAVELFAGRLKHGVRLTVSSKIDPSLGLGSSAAVTIASLGALATMLGDR 125

Query: 125 EPSPDEIL--TTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF------IF 176
                 +L  T A AI+ + Q   SG DLAAS+ GG+I Y++P   + K+        I 
Sbjct: 126 L----GLLLHTRALAIIRRHQKRGSGADLAASVFGGMIAYKLPTELLNKVPAAETSAKIT 181

Query: 177 PI------HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN 230
           P+       L YSG KTPT+ VL K++   +      E    +Y  MG++ + S    R 
Sbjct: 182 PLPTPPILSLCYSGNKTPTSAVLAKVARSMVGR---EEEFAALYERMGRVVRDSIAFARV 238

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
           +N       ++  QG++E L VSD  L  ++      P  + +KISGSGLGDCV+A+G  
Sbjct: 239 RNWPAFGDTLSEYQGMMEELDVSDPTLERMIDNALACPKTLGAKISGSGLGDCVLAVGAV 298

Query: 291 DLNSL--PYQSVNCHMHA 306
             N    P  S   H++A
Sbjct: 299 PSNFFQAPVTSKGLHVYA 316


>gi|284162110|ref|YP_003400733.1| mevalonate kinase [Archaeoglobus profundus DSM 5631]
 gi|284012107|gb|ADB58060.1| mevalonate kinase [Archaeoglobus profundus DSM 5631]
          Length = 292

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 169/301 (56%), Gaps = 19/301 (6%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG ++L GEH V++G  A+V AIN R   Y    K   I I+S LG+   SLD  + H
Sbjct: 4   SAPGKVILFGEHAVVYGRHAVVSAINLRC--YAKAEKASDITIESPLGKT--SLDFKV-H 58

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           P  S+ I   + I+P  G  LK+ S +    GLGSS+A+TVA+  + L L +    S +E
Sbjct: 59  PYVSYAIKRFSEIRPVKGVYLKIWSDIPIASGLGSSSAVTVAVLKS-LDLLFETNLSNEE 117

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF--IFPIHLIYSGYKTP 188
           I   A  + L VQGI SG D   S  GG   + +P+   E+ID      + +IY+G  + 
Sbjct: 118 IFELARKVELDVQGIGSGTDPFVSTFGG--TWLIPER--ERIDIGDYLDLTVIYTGKASI 173

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T+ +++K++ +   Y ++ E   +I+  +  +S  S  AL++++ + L+  +   Q LL+
Sbjct: 174 TSDMVRKVANLREMYGDVIE---RIFDAIDSISLRSISALKDRDFEALSFLVRTNQLLLK 230

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
            LGVS  ++ EIV KL      + +KI+G+G G  VIALG  DL+   Y+ ++  ++A+G
Sbjct: 231 ALGVSCREIDEIVNKLENLG--IPAKITGAGGGGSVIALGSVDLDG--YKCLSVSLNAEG 286

Query: 309 I 309
           +
Sbjct: 287 V 287


>gi|146329469|ref|YP_001209401.1| GHMP kinase family protein [Dichelobacter nodosus VCS1703A]
 gi|146232939|gb|ABQ13917.1| GHMP kinase family protein [Dichelobacter nodosus VCS1703A]
          Length = 303

 Score =  136 bits (343), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 164/308 (53%), Gaps = 12/308 (3%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SA GS+++ GEH V++G  A+V AI +R+ + LT R D  I I S+LG Y  +    
Sbjct: 3   IETSASGSVMICGEHAVVYGQPAIVAAIAQRIRVRLTPRNDDKITIHSALGDYESTAGFL 62

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             +   +F+I  +     S G  L++ S +D  LGLGSSAA+TVA  AA    ++  E  
Sbjct: 63  KPYRPLAFVIACLERYPHSGGLTLEIDSAIDPTLGLGSSAAVTVATLAA--LARHTGEDE 120

Query: 128 PDEIL-TTAHAIVLKVQGISSGIDLAASIHGGLICYQ-MPKYSIEKIDF-IFPIHLIYSG 184
             E L T A  IV  +Q   SG DLAAS+ GG+I Y+ +P+ S+  +      + L YSG
Sbjct: 121 RRETLHTQALTIVRSLQSRGSGADLAASLWGGMIAYRNLPEVSVSALPLPPVDVGLRYSG 180

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
           YKTPT  VL +I+      P+      ++Y  MG+ +  +  A  + + +    A+   Q
Sbjct: 181 YKTPTDVVLYQIAEKMRGSPDFYA---QLYQTMGETAAHAIAAAEHHHWQDFYAALAHYQ 237

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
             +E LGV D  L+ ++   R  P  +ASKISGSGLGDC+I+  K    +LP       +
Sbjct: 238 QHMEELGVCDDTLAAMIAAARAHPDTLASKISGSGLGDCIISFAK----TLPADHQKITI 293

Query: 305 HAKGIDIV 312
             +G+  +
Sbjct: 294 DMQGVQFI 301


>gi|18978009|ref|NP_579366.1| mevalonate kinase [Pyrococcus furiosus DSM 3638]
 gi|23821778|sp|Q8U0F3|KIME_PYRFU RecName: Full=Mevalonate kinase; Short=MK
 gi|18893790|gb|AAL81761.1| mevalonate kinase (mvk) [Pyrococcus furiosus DSM 3638]
          Length = 334

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 150/307 (48%), Gaps = 36/307 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----------- 55
           K+  SAP  ++L GEH V++G  A+  AI+ R  +   L +++ I I++           
Sbjct: 2   KVIASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELIREKKIRIEAHDIKVPGLTVS 61

Query: 56  -SLGQYCGSLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAI 109
            S  +     D        S++  AIN +     K + G  + + SQ+    GLGSSAA+
Sbjct: 62  FSENEIYFETDYGKAAEVLSYVREAINLVLEEADKKNVGIKVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
            VA   A   LL L+  KE    EI    H   L VQG SSGID   S  GG I Y+  K
Sbjct: 122 AVATIGAVSKLLGLELSKE----EIAKMGHKTELLVQGASSGIDPTVSAIGGFIFYEKGK 177

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC 225
           +  E + F+  PI + Y+G   PT ++   ++ +   Y E+ E+   I   MGK+ + + 
Sbjct: 178 F--EHLPFMELPIVVGYTGSSGPTKEL---VAMVRKRYEEMPELIVPILEAMGKVVEKAK 232

Query: 226 QAL-----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGL 280
             +     + +  + L   MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G 
Sbjct: 233 DVILSNVDKEEKFERLGVLMNINHGLLDALGVSTKKLSELVYAAR-VAGALGAKITGAGG 291

Query: 281 GDCVIAL 287
           G C+ AL
Sbjct: 292 GGCMYAL 298


>gi|242399205|ref|YP_002994629.1| Mevalonate kinase [Thermococcus sibiricus MM 739]
 gi|259494449|sp|C6A3T5|KIME_THESM RecName: Full=Mevalonate kinase; Short=MK
 gi|242265598|gb|ACS90280.1| Mevalonate kinase [Thermococcus sibiricus MM 739]
          Length = 333

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 149/303 (49%), Gaps = 29/303 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           ++  SAP  ++L GEH V++G  A+  AI+ R  +     ++  I I++   +  G    
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVKAEFNENGRIRIEAKDIRTPGLTVS 61

Query: 63  -SLDLAMFHPSF-------SFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAIT 110
            S D   F   +       S++  AIN +        G  + + SQ+    GLGSSAA+ 
Sbjct: 62  FSEDQIYFETDYGKAAEVLSYVREAINLVMEEAEKQKGVTVSITSQIPVGAGLGSSAAVA 121

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE 170
           VA   A+  L +  E +P+E+    H + L VQG SSGID   S  GG + YQ  K S E
Sbjct: 122 VATIGAVSRL-FGLELTPEEVAKLGHKVELLVQGASSGIDPTVSAIGGFLYYQ--KGSFE 178

Query: 171 KIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL- 228
            +  +  PI + Y+G    T +++ K+      Y E+ EI   I   MG+L + + + + 
Sbjct: 179 SLPVVELPIVVGYTGSSGSTKELVAKVRK---NYEEMPEIIDPILNSMGRLVEKAREVIL 235

Query: 229 ----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
               +    K L   MN   GLL+ LGVS   LS++V+  RE    + +KI+G+G G C+
Sbjct: 236 AEYDKEIKFKRLGTLMNINHGLLDALGVSTKSLSDLVYASREA-GALGAKITGAGGGGCM 294

Query: 285 IAL 287
            AL
Sbjct: 295 YAL 297


>gi|84489658|ref|YP_447890.1| putative mevalonate kinase [Methanosphaera stadtmanae DSM 3091]
 gi|84372977|gb|ABC57247.1| putative mevalonate kinase [Methanosphaera stadtmanae DSM 3091]
          Length = 322

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 149/290 (51%), Gaps = 14/290 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           KI   APG ++L GEH V++   A+  AI++ V + L  R D  I +   L  Y     L
Sbjct: 2   KIKAFAPGKIILFGEHTVVYKKPAIAVAIDRGVNVELIPRNDDNITVKLDLIDYYKKSQL 61

Query: 67  AMFHPSF----------SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                ++           +I   IN  +   GFDL V  ++    GLGSSAA+TV+   A
Sbjct: 62  VNKKLNYKIDSQKKMITDYIYEVINLFEFEKGFDLTVDIKMYLGAGLGSSAAVTVSTLKA 121

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
           + +L  +K+     I  TA  I +K+QG +S ID + S +GG+I +      + +IDF  
Sbjct: 122 V-SLYVNKQIDKKTIAQTAREIEIKIQGAASPIDTSMSTYGGII-FIDENSKLNRIDFNM 179

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
            + LI S  +  +    K +  + ++Y +   I   I+  M +++  +  AL   N +++
Sbjct: 180 KLPLIVSNCEI-SGNTGKLVESVRLKYEKYPTIVGNIFKAMEQIAIDAKVALEKGNSELI 238

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
              MN  QGLL+ +GV+ ++LS++V+K RE      SK++GSG G C+IA
Sbjct: 239 GDLMNINQGLLDAIGVNTTELSDMVYKAREYGA-KGSKLTGSGGGGCIIA 287


>gi|240103785|ref|YP_002960094.1| mevalonate kinase [Thermococcus gammatolerans EJ3]
 gi|259494448|sp|C5A7L8|KIME_THEGJ RecName: Full=Mevalonate kinase; Short=MK
 gi|239911339|gb|ACS34230.1| Mevalonate kinase (mvk) [Thermococcus gammatolerans EJ3]
          Length = 334

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 147/307 (47%), Gaps = 36/307 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           ++  SAP  ++L GEH V++G  A+  AIN R  ++    +   I I++   +  G    
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAINLRTYVWAEFNERGAIKIEAKDIRVPGLTVS 61

Query: 63  -SLDLAMFHPSF-------SFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
            S D   F   +       S++  AI  ++        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVREEADKNGRGITVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
            VA   A   LL L+   E    EI    H + L VQG SSGID   S  GG I Y+  K
Sbjct: 122 AVATIGAVSRLLGLELTNE----EIGKLGHRVELLVQGASSGIDPTVSAIGGFIHYEKGK 177

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----S 221
           +  E + F+  PI + Y+G    T +++  +     E PEI E    I   MGK+     
Sbjct: 178 F--EPLPFMELPIVVGYTGSSGSTKELVAMVRRTREEMPEIIE---PILLSMGKVVEKAK 232

Query: 222 QISCQALRNK-NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGL 280
           +I    L  K   + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G 
Sbjct: 233 EILLSDLEEKIRFERLGKLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGG 291

Query: 281 GDCVIAL 287
           G C+ AL
Sbjct: 292 GGCMYAL 298


>gi|254172712|ref|ZP_04879387.1| mevalonate kinase [Thermococcus sp. AM4]
 gi|214033641|gb|EEB74468.1| mevalonate kinase [Thermococcus sp. AM4]
          Length = 334

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 146/307 (47%), Gaps = 36/307 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           ++  SAP  ++L GEH V++G  A+  AIN R  ++        I I++   +  G    
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAINLRTYVWAEFNDRGAIRIEAKDIRVPGLTVS 61

Query: 63  -SLDLAMFHPSF-------SFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
            S D   F   +       S++  AI  +K        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVKEEADKNGRGITVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
            VA   A   LL L+   E    EI    H + L VQG SSGID   S  GG I Y+  K
Sbjct: 122 AVATIGAVSRLLGLELTNE----EIGRLGHRVELLVQGASSGIDPTVSAIGGFIHYE--K 175

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC 225
            + E + F+  PI + Y+G    T +++  +     E PEI E    I   MGK+ + + 
Sbjct: 176 GNFEHLPFMELPIVVGYTGSSGSTKELVAMVRRTREEMPEIVE---PILLSMGKIVERAR 232

Query: 226 QAL-----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGL 280
           + L          + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G 
Sbjct: 233 EILLSDLDEEVRFERLGRLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGG 291

Query: 281 GDCVIAL 287
           G C+ AL
Sbjct: 292 GGCMYAL 298


>gi|14591399|ref|NP_143478.1| mevalonate kinase [Pyrococcus horikoshii OT3]
 gi|8928178|sp|O59291|KIME_PYRHO RecName: Full=Mevalonate kinase; Short=MK
 gi|3258054|dbj|BAA30737.1| 335aa long hypothetical mevalonate kinase [Pyrococcus horikoshii
           OT3]
          Length = 335

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 99/308 (32%), Positives = 145/308 (47%), Gaps = 35/308 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----- 62
           +  SAP  ++L GEH V++G  A+  AI  R  +         I I++   +  G     
Sbjct: 5   VLASAPAKVILFGEHSVVYGKPAIASAIELRTYVRAQFNDSGNIKIEAHDIKTPGLIVSF 64

Query: 63  SLDLAMFHPSFS-----------FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITV 111
           S D   F   +             I +A+       G D+ + SQ+    GLGSSAA+ V
Sbjct: 65  SEDKIYFETDYGKAAEVLSYVRYAIELALEESDKRVGIDVSITSQIPVGAGLGSSAAVAV 124

Query: 112 AITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           A   A   LL L+  KE    EI    H + L VQG SSGID   S  GG + Y+  K+ 
Sbjct: 125 ATIGAVSRLLGLELSKE----EIAKLGHKVELLVQGASSGIDPTVSAVGGFLYYKQGKF- 179

Query: 169 IEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
            E + F+  PI + Y+G    T ++   ++ +   Y E+ E+ + I   MGKL   + + 
Sbjct: 180 -EPLPFMELPIVVGYTGSTGSTKEL---VAMVRKRYEEMPELVEPILEAMGKLVDKAKEI 235

Query: 228 LRNK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
           + +K      L  L + MN   GLL+ LGVS  KL E+V+  R    I A K++G+G G 
Sbjct: 236 ILSKLDEEEKLTKLGELMNINHGLLDALGVSTKKLGELVYAARTAGAIGA-KLTGAGGGG 294

Query: 283 CVIALGKG 290
           C+ AL  G
Sbjct: 295 CMYALAPG 302


>gi|332157850|ref|YP_004423129.1| mevalonate kinase [Pyrococcus sp. NA2]
 gi|331033313|gb|AEC51125.1| mevalonate kinase [Pyrococcus sp. NA2]
          Length = 333

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 148/308 (48%), Gaps = 35/308 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS------------ 55
           +  SAP  ++L GEH V++G  A+  AI+ R  +     ++  I I++            
Sbjct: 3   VLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVKAEFNEEGRIRIEAHDIKTPGLIVSF 62

Query: 56  SLGQYCGSLDLAMFHPSFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITV 111
           S G+     D        S++  AI  +      + G  + + SQ+    GLGSSAA+ V
Sbjct: 63  SEGKIYFETDYGKAAEVLSYVRHAIELVLEEADKNVGVSVSITSQIPVGAGLGSSAAVAV 122

Query: 112 AITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           A   A   LL L+  +E    EI    H + L VQG SSGID   S  GG + Y+  K+ 
Sbjct: 123 ATIGAVSKLLGLELSRE----EIAKLGHKVELLVQGASSGIDPTVSAIGGFLYYKQGKF- 177

Query: 169 IEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
            E + F+  PI + Y+G    T ++   ++ +   Y ++ EI   I   MGKL +I+   
Sbjct: 178 -EHLPFMELPIVVGYTGSSGSTKEL---VAMVRERYEKMPEIVAPILDSMGKLVEIARDV 233

Query: 228 LRNK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
           + +K         L + MN   GLL+ LGVS  KLSE+V+  R     + +K++G+G G 
Sbjct: 234 ITSKLDEEEKFLKLGELMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKLTGAGGGG 292

Query: 283 CVIALGKG 290
           C+ AL  G
Sbjct: 293 CMYALAPG 300


>gi|57641409|ref|YP_183887.1| mevalonate kinase [Thermococcus kodakarensis KOD1]
 gi|73920096|sp|Q5JJC6|KIME_PYRKO RecName: Full=Mevalonate kinase; Short=MK
 gi|57159733|dbj|BAD85663.1| mevalonate kinase [Thermococcus kodakarensis KOD1]
          Length = 337

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 95/310 (30%), Positives = 148/310 (47%), Gaps = 30/310 (9%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG- 62
            + ++  SAP  ++L GEH V++G  A+  AI+ R  +         I I++   +  G 
Sbjct: 2   SVKRVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVSAEFNDTGAIKIEAHDIRTPGL 61

Query: 63  ----SLDLAMFHPSFS-------FIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSS 106
               + D   F   +        ++  AI  ++        G  + + SQ+    GLGSS
Sbjct: 62  IVSFTEDSIYFESDYGKAAEVLGYVRQAIELVREEADVNGKGITVSITSQIPVGAGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           AA+ VA   A+  L    E S +E+    H + L VQG SSGID   S  GG I YQ  K
Sbjct: 122 AAVAVATIGAVSRL-LGLELSNEEVGKLGHKVELLVQGASSGIDPTVSAIGGFIHYQKGK 180

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ--- 222
           +  E + F+  P+ + Y+G    T ++   ++ +   Y E+ EI + I   MG+L +   
Sbjct: 181 F--EHLPFMELPLVVGYTGSSGSTKEL---VAMVRKNYEEMPEIFEPILNSMGRLVEKAR 235

Query: 223 --ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGL 280
             I+    R    + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G 
Sbjct: 236 EVITSDLDRELKFQTLGKLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGG 294

Query: 281 GDCVIALGKG 290
           G C+ AL  G
Sbjct: 295 GGCMYALAPG 304


>gi|315229907|ref|YP_004070343.1| mevalonate kinase [Thermococcus barophilus MP]
 gi|315182935|gb|ADT83120.1| mevalonate kinase [Thermococcus barophilus MP]
          Length = 333

 Score =  115 bits (288), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 149/309 (48%), Gaps = 35/309 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----------- 55
           ++  SAP  ++L GEH V++G  A+  AI+ R  ++    K+  I I++           
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVWAEFNKNGRIRIEAKDIKIPGLTVS 61

Query: 56  -SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQL----GLGSSAAIT 110
            S  +     D        S++  AIN +    G    V   + SQ+    GLGSSAA+ 
Sbjct: 62  FSESEIYFETDYGKAAEVLSYVREAINLVLEEAGKQKGVTVSITSQIPVGAGLGSSAAVA 121

Query: 111 VAITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY 167
           VA   A   LL L+  KE    E+    H   L VQG SSGID   S  GG + Y+  K 
Sbjct: 122 VATIGAVSKLLGLELTKE----EVAKLGHKTELLVQGASSGIDPTVSAIGGFLYYE--KG 175

Query: 168 SIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
           + E++  I  PI + Y+G    T +++ K+      + E+ +I   I   MGK+ + + +
Sbjct: 176 TFEELPAIELPIVVGYTGSSGSTKELVAKVRR---SFEEMPDIITPILNSMGKVVEKAKE 232

Query: 227 AL-----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLG 281
            +     +    ++L Q MN   GLL+ LGVS   LS++V+  RE    + +KI+G+G G
Sbjct: 233 VILADYDKEIKFQLLGQLMNINHGLLDALGVSTKSLSDLVYASRE-AGALGAKITGAGGG 291

Query: 282 DCVIALGKG 290
            C+ AL  G
Sbjct: 292 GCMYALAPG 300


>gi|212223279|ref|YP_002306515.1| mevalonate kinase [Thermococcus onnurineus NA1]
 gi|229486114|sp|B6YST1|KIME_THEON RecName: Full=Mevalonate kinase; Short=MK
 gi|212008236|gb|ACJ15618.1| mevalonate kinase [Thermococcus onnurineus NA1]
          Length = 334

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/304 (30%), Positives = 148/304 (48%), Gaps = 30/304 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           ++  SAP  ++L GEH V++G  A+  AI+ R  ++        I I++   +  G    
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVWAEFNNKGAIKIEAKDIKVPGLTVS 61

Query: 63  -SLDLAMFHPSF-------SFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
            S D   F   +       S++  AI  ++        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVREEADKNGNGVTVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
            VA   A+  L    E S +EI    H + L VQG SSGID   S  GG + Y+  K + 
Sbjct: 122 AVATIGAVSRL-LGLELSNEEIAKLGHKVELLVQGASSGIDPTVSAIGGFLHYE--KGNF 178

Query: 170 EKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
           E + F+  PI + Y+G    T ++   ++ +   Y E+ E+ + I   MGK+ + +   L
Sbjct: 179 EHLPFMELPIVVGYTGSSGSTKEL---VAMVRRNYEEMPEVIEPILVSMGKIVEKAKDVL 235

Query: 229 RNK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
            ++         L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G C
Sbjct: 236 LSELDNEVRFVQLGRLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGGGGC 294

Query: 284 VIAL 287
           + AL
Sbjct: 295 MYAL 298


>gi|14520757|ref|NP_126232.1| mevalonate kinase [Pyrococcus abyssi GE5]
 gi|8928195|sp|Q9V187|KIME_PYRAB RecName: Full=Mevalonate kinase; Short=MK
 gi|5457973|emb|CAB49463.1| mvk mevalonate kinase [Pyrococcus abyssi GE5]
          Length = 335

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 148/309 (47%), Gaps = 37/309 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----- 62
           +  SAP  ++L GEH V++G  A+  AI+ R  +         I I++   +  G     
Sbjct: 5   VLASAPAKIILFGEHSVVYGKPAIASAIDLRTYVRAEFNDSGNIKIEAHDIKTPGLIVSF 64

Query: 63  SLDLAMFHPSF-------SFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITV 111
           S D   F   +       S++  AI  +        G  + + SQ+    GLGSSAA+ V
Sbjct: 65  SEDKIYFETDYGKAAEVLSYVRHAIELVLEEADKRTGVSVSITSQIPVGAGLGSSAAVAV 124

Query: 112 AITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           A   A   LL L+  KE    EI    H + L VQG SSGID   S  GG + Y+  ++ 
Sbjct: 125 ATIGAVSKLLDLELSKE----EIAKMGHKVELLVQGASSGIDPTVSAIGGFLYYKQGEF- 179

Query: 169 IEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
            E + F+  PI + Y+G    T ++   ++ +   Y E+ E+ + I   MGKL   + + 
Sbjct: 180 -EHLPFVELPIVVGYTGSSGSTKEL---VAMVRRRYEEMPELIEPILESMGKLVDKAKEV 235

Query: 228 L------RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLG 281
           +        K LK L + MN   GLL+ LGVS  KLSE+V+  R    I A K++G+G G
Sbjct: 236 IISKLDEEEKFLK-LGELMNINHGLLDALGVSTKKLSELVYAARTAGAIGA-KLTGAGGG 293

Query: 282 DCVIALGKG 290
            C+ AL  G
Sbjct: 294 GCMYALAPG 302


>gi|322369525|ref|ZP_08044090.1| mevalonate kinase [Haladaptatus paucihalophilus DX253]
 gi|320551257|gb|EFW92906.1| mevalonate kinase [Haladaptatus paucihalophilus DX253]
          Length = 327

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 140/300 (46%), Gaps = 32/300 (10%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RL------INIDSSLGQYCGS 63
           SAPG + L GEH V++G  A+  AI +R  + +  R D RL      ++ID    +Y   
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAIERRASVTVEARDDDRLRVHAKDLSIDGFTVEYSSE 64

Query: 64  LDL--------AMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAIT 110
            +         ++      +I  AI   +     P  GFD+ V S +    GLGSSAA+T
Sbjct: 65  TNATPDVNVSESLVRAGVGYIDAAIEQARDATDTPDAGFDITVESNIPLGAGLGSSAAVT 124

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK-Y 167
           VA I AA  T +     S DEI   A+   L VQ G +S  D      GG +  +     
Sbjct: 125 VAAIDAA--TRELGVTLSSDEIADRAYKAELAVQDGEASRADTYCCATGGAVRVEGDDCR 182

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
           SIE  D   PI + + G    T +++  +  +  EY    E  + I    G + +   Q 
Sbjct: 183 SIEAPDL--PIVVGFDGGAGDTGKLVAGVRALRDEYDFAAETVENI----GDIVRQGEQV 236

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L + +L  L + MN   GLLE LGVS   L  +VW  R+    M +K++G+G G C++AL
Sbjct: 237 LADGDLDELGKLMNFNHGLLEALGVSSRSLDNMVWAARDA-GAMGAKLTGAGGGGCIVAL 295


>gi|307596392|ref|YP_003902709.1| mevalonate kinase [Vulcanisaeta distributa DSM 14429]
 gi|307551593|gb|ADN51658.1| mevalonate kinase [Vulcanisaeta distributa DSM 14429]
          Length = 330

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 87/301 (28%), Positives = 148/301 (49%), Gaps = 26/301 (8%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID------------- 54
           + V APG ++L GEH V++G  AL  AINK V +    R D  INI+             
Sbjct: 2   VTVRAPGKVILYGEHAVVYGEPALAMAINKYVYVTARARSDGKININARDLRLAGISVTI 61

Query: 55  SSLGQYCGSLDLAMFHPSFSFII----MAINHIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
           S  G      D      + S++     +A+ ++    G DL++ S++    GLG+SAA+ 
Sbjct: 62  SENGDIIARTDYGAVISALSYVKRAVELAMGYVDKKVGIDLEIRSEMPVGAGLGTSAAVA 121

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
           VA I A +  L Y  +    E+   A  +   VQG +S  D   +  GG I +  P+ + 
Sbjct: 122 VATIYAYIKELGYDIDKR--ELARLAWQVEKDVQGSASPTDTTMATFGG-IMFVKPEGNN 178

Query: 170 EKIDFIFP---IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
             ++ + P   + LI  GY    +     ++ +  +Y  + ++ + I   +G +++   +
Sbjct: 179 AVMEPVRPGTNVPLII-GYVPRVSTTKDLVAMVRRKYETMRDVIEPIIRSIGLITRKGRE 237

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           AL   +L+++   MN   GLL+ LGVS  +L+E+V+  R     + SK++G+G G C+IA
Sbjct: 238 ALERGDLELMGVLMNINHGLLDALGVSTRQLNEMVYAAR-NAGALGSKLTGAGGGGCMIA 296

Query: 287 L 287
           L
Sbjct: 297 L 297


>gi|325958575|ref|YP_004290041.1| mevalonate kinase [Methanobacterium sp. AL-21]
 gi|325330007|gb|ADZ09069.1| mevalonate kinase [Methanobacterium sp. AL-21]
          Length = 329

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 151/295 (51%), Gaps = 20/295 (6%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            ++  SAPG  +L GEH V++G  A+  A++KR  + ++ R+D L ++        G LD
Sbjct: 5   RQVTASAPGKTILFGEHAVVYGKPAIAAAVDKRAYVTISKREDHLTHVTVGDLGVSGFLD 64

Query: 66  L-----------AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           L            M      +I+ A+   K     ++ V   +    GLGSSAA+TVA  
Sbjct: 65  LKNRTIQLENGSGMQRGILEYILKALIKAKTEDSVEVDVRLDIPIGAGLGSSAAVTVATI 124

Query: 115 AALLTLQYHKEPSPDEILTT-AHAIVLKVQGISSGIDLAASIHGGLI-CYQMPKYSIE-K 171
            A  +  +++    +E +   AH + L VQG +S ID + S +GG+I   + P+  ++ +
Sbjct: 125 MAAAS--FNQITLTNETMANLAHQVELDVQGAASPIDTSLSTYGGVIYLSKQPQKLVKLE 182

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK 231
           I    PI + Y+  +  T +++K +   +   PE+  IN  I   M  ++  + QA+   
Sbjct: 183 IPHELPIVIGYTSTRGNTGELVKLVRQKKDARPEV--IN-PILDSMEAVANGARQAIIKG 239

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           + K +   MN  QGLL+ LGV+  +LS++V+  R Q   M SK++G+G G  +IA
Sbjct: 240 DHKTIGLLMNINQGLLDALGVNTEELSKMVFTARNQ-GAMGSKLTGAGGGGSMIA 293


>gi|325968145|ref|YP_004244337.1| mevalonate kinase [Vulcanisaeta moutnovskia 768-28]
 gi|323707348|gb|ADY00835.1| mevalonate kinase [Vulcanisaeta moutnovskia 768-28]
          Length = 330

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 146/304 (48%), Gaps = 32/304 (10%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID------------- 54
           I + APG ++L GEH V++G  AL  AINK + +    R D  INI+             
Sbjct: 2   ITIRAPGKVILYGEHAVVYGEPALAMAINKYLYVTARARDDNKININARDLRLAGISVTI 61

Query: 55  SSLGQYCGSLDLAMFHPSFSF----IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
           S  G      D      + S+    I +A+ ++    G DL++ S++    GLG+SAA+ 
Sbjct: 62  SEGGDVVAKTDYGAVISALSYVKRAIELAMEYLDKKVGIDLEIRSEMPVGAGLGTSAAVA 121

Query: 111 VAITAALLTLQYHKEPSPD----EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           VA       L Y KE   D    E+   A  +   VQG +S  D   +  GG I Y  P+
Sbjct: 122 VAT-----ILAYAKELGYDIDKRELSRLAWQVEKDVQGSASPTDTTMATFGG-IMYIKPE 175

Query: 167 YSIEKIDFIFP---IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
            +   ++ + P   + LI  GY    +     ++ +  +Y  +  I + I   +G +++ 
Sbjct: 176 GNNTVMEPVKPGANVPLII-GYVPRISTTKDLVAMVRRKYEIMRNIIEPIIKSIGLITKK 234

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
             +AL   +L+++   MN   GLL+ LGVS  +L+++V+  R     + SK++G+G G C
Sbjct: 235 GREALEMGDLELMGTLMNINHGLLDALGVSTRQLNDMVYAAR-HAGALGSKLTGAGGGGC 293

Query: 284 VIAL 287
           +IAL
Sbjct: 294 MIAL 297


>gi|294496197|ref|YP_003542690.1| mevalonate kinase [Methanohalophilus mahii DSM 5219]
 gi|292667196|gb|ADE37045.1| mevalonate kinase [Methanohalophilus mahii DSM 5219]
          Length = 305

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 144/284 (50%), Gaps = 21/284 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SAP  + L GEH V++  +A+  AI+ R  + +   ++ +IN  SSLG     +D  
Sbjct: 2   ITCSAPAKVYLFGEHAVVYNESAICCAISIRTRVNIEYSENIVIN--SSLGTT--GIDYE 57

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA---LLTLQYHK 124
           + HP  S ++  I    P  G  + + S +    GLGSSAA+ VA   A   LL L   K
Sbjct: 58  I-HPYVSAVVEKIRKKSPYRGVSISIESDIPVGSGLGSSAAVVVATICAFNNLLKLGMDK 116

Query: 125 EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY-SIEKIDFIFPIHLIYS 183
           E     I +  H+I  ++QG +S  D   S  GG I   M ++    + + +     ++S
Sbjct: 117 E----SIASLGHSIEKEIQGSASAADTYVSTMGGTISIPMRQHLKNPRCNLVIGNTNVFS 172

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
                T Q++ K++ ++  YPE+      I + +GK S      L N++ + L + M+  
Sbjct: 173 ----STGQLVAKVASLKTIYPEVI---TPILSTIGKASLRGESLLENEDYRALGELMDVN 225

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           QGLLE +GVS ++LS ++   R     + +KI+G+G G C++AL
Sbjct: 226 QGLLEAIGVSCNELSRLIHSSR-AAGALGAKITGAGGGGCMVAL 268


>gi|21227864|ref|NP_633786.1| mevalonate kinase [Methanosarcina mazei Go1]
 gi|20906278|gb|AAM31458.1| Mevalonate kinase [Methanosarcina mazei Go1]
          Length = 301

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 141/283 (49%), Gaps = 19/283 (6%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPG + L GEH V++G  A+  A+  R  +   L     I I S +G+    LD  
Sbjct: 2   VSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDS--ITIQSQIGRT--GLDFE 57

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S +I  +    P  G  L V S +    GLGSSAA+T+A   AL  L +    S
Sbjct: 58  K-HPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNEL-FGFGLS 115

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP---IHLIYSG 184
             EI    H I +KVQG +S  D   S  GG++   +P    E+     P   I +  +G
Sbjct: 116 LQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVT--IP----ERRKLKTPDCGIVIGDTG 169

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             + T +++  +  +   YP++ E    +   +GK+S+I  Q + + +   + + MN  Q
Sbjct: 170 VFSSTKELVANVRQLRESYPDLIE---PLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQ 226

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           GLL+ LGV+  +LS++++  R       +KI+G+G G C++AL
Sbjct: 227 GLLDALGVNILELSQLIYSAR-AAGAFGAKITGAGGGGCMVAL 268


>gi|330508373|ref|YP_004384801.1| mevalonate kinase [Methanosaeta concilii GP-6]
 gi|328929181|gb|AEB68983.1| mevalonate kinase [Methanosaeta concilii GP-6]
          Length = 317

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 145/286 (50%), Gaps = 17/286 (5%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG ++L GEH V+ G AAL  AI+ R    +     R++     L     SLDL+   
Sbjct: 5   SAPGKIILFGEHAVVSGTAALGGAIDLRARAIVQSLPGRILIETDDLSLRGFSLDLSTGE 64

Query: 71  PSFSFIIMAINHI----KPSCGFDLKVI--SQLDSQLGLGSSAAITVAITAALLTLQYHK 124
              +    A  ++    K     D++V+  S +    GLGSSA+I VA  AAL       
Sbjct: 65  IRSASAAYATRYVSAVLKELGARDVRVMIESDIPPAAGLGSSASIVVATVAAL-NGHLGL 123

Query: 125 EPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYS 183
           E S  EI   ++ I  +VQ G  S +D A + +GG   YQ      +++D + P+ ++  
Sbjct: 124 ELSQKEIAALSYRIEKEVQKGRGSPMDTALATYGG---YQRIADDNQRLD-LPPLEMVVG 179

Query: 184 GYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
             + P  T  +++K+  ++  YP++      I+  +G +S+ +   +R + LK L + M+
Sbjct: 180 YTRLPHDTFSLVEKVQLLKERYPDLV---GPIFQAIGAISERAAPLIREQRLKDLGELMD 236

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              GLLE LGV   +LSE+V+  R     + +K++G+G G C+IAL
Sbjct: 237 INHGLLEALGVGSRELSELVYAARNTGGALGAKLTGAGGGGCMIAL 282


>gi|315425792|dbj|BAJ47446.1| mevalonate kinase [Candidatus Caldiarchaeum subterraneum]
          Length = 319

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 154/292 (52%), Gaps = 14/292 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQYCGSLD 65
           ++ V APG ++L GEH V+ G+ A+V AI++ V +      D+ + +   S   +  + +
Sbjct: 4   QVKVFAPGKVILFGEHFVVSGYPAIVTAIDRGVTVTAKKTDDKFVIVSKHSAAAWNATGE 63

Query: 66  LAMFHPS-----FSFII-MAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                PS     ++ +  M ++H   SC   +++ S L S  GLGSSAA++VA+  A ++
Sbjct: 64  TITAKPSALAPLYNMVREMCLDH-GVSCTGWVEIESDLISGGGLGSSAAVSVALAKA-VS 121

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-MPKYSIEKIDFIFPI 178
           L +  + S D+++  A     +  G  SGID   S  GG I Y+ +  Y+  ++     +
Sbjct: 122 LLHEIQLSKDQLINYALKAEKEFHGRPSGIDPTISTVGGTIAYRGLGNYTAIEVGKPLDL 181

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
            +++SG K  T++++  +     E  +I     K+Y+    + +++ +AL   + + + +
Sbjct: 182 IIVFSGRKRKTSKMVDAVQRFAAEKKDIFTELVKLYS---HVYEMAKEALVEGDFQAVGR 238

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
                  LL ++GVSD+ L EIV KLR +  +  +K++G+G G CVIA+  G
Sbjct: 239 LFTLNHLLLRSVGVSDNVLEEIVRKLRNK-DVYGAKLTGAGGGGCVIAVADG 289


>gi|91774304|ref|YP_566996.1| mevalonate kinase [Methanococcoides burtonii DSM 6242]
 gi|91713319|gb|ABE53246.1| mevalonate kinase [Methanococcoides burtonii DSM 6242]
          Length = 303

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 149/302 (49%), Gaps = 20/302 (6%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SAPG + L GEH V++G  A+  A++ R    +T+     I I SSLG     +D  
Sbjct: 2   ITCSAPGKVYLFGEHAVVYGEPAICCAVDIRT--RVTVSPADTITISSSLGTT--GIDFE 57

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + HP  S ++     I    G DL++ S +    GLGSSAA+TVA   A+ TL       
Sbjct: 58  V-HPYVSAVLERFQDISSFDGVDLRISSDIPVGSGLGSSAAVTVATIKAMDTLLDLGLEL 116

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
             +I    H +   +QG +S  D      GG++     K  +E ID    I +  +   +
Sbjct: 117 D-DIAKMGHEVEQNIQGTASPTDTYVCTMGGVVLIPQRK-KLELID--CGILIGNTNIFS 172

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T +++  ++ +   +P   ++   + + +GKLS I    + +++   + + MN  QGLL
Sbjct: 173 STKELVGNVADLNERFP---DVVGPVLSSIGKLSVIGEGLVNDRDYVSVGELMNIDQGLL 229

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           + +GVS ++LS +++  RE      SKI+G+G G C++A+        P ++V+    A 
Sbjct: 230 DAIGVSCAELSSLIYAARES-GAYGSKITGAGGGGCMVAIS-------PRENVDSVAEAI 281

Query: 308 GI 309
           G+
Sbjct: 282 GM 283


>gi|327400496|ref|YP_004341335.1| mevalonate kinase [Archaeoglobus veneficus SNP6]
 gi|327316004|gb|AEA46620.1| mevalonate kinase [Archaeoglobus veneficus SNP6]
          Length = 290

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 136/255 (53%), Gaps = 19/255 (7%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG ++L GEH V++G  A+V AIN R   Y    K     I+S +     SLD    H
Sbjct: 4   SAPGKVILFGEHAVVYGRHAVVTAINLRC--YAEALKSSTFRIESPIA--TTSLDFEK-H 58

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           P  S+ I     +KP  G  +K+ S++    GLGSSAA+TVA+  A L  ++    S +E
Sbjct: 59  PYVSYAIKRFMEVKPIDGVKIKIESEIPIASGLGSSAAVTVAVLKA-LDAEFDAGLSDEE 117

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IFPIHLIYSGYKTPT 189
           +   A  + L VQG  SG D   S +GG   + +P+   + +D   F + ++ SG ++ T
Sbjct: 118 LFELARKVELDVQGRGSGTDPFVSTYGG--AWLIPER--KPLDLGEFRMLIVNSGEESIT 173

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           ++++ K++ +     E+ ++ ++I+ +   +  IS +A   +    +++ M   Q +L+ 
Sbjct: 174 SEMVAKVARLR---DELGDVVERIFDV---IDTISLKAFAGEG--EISRLMAVNQCMLKA 225

Query: 250 LGVSDSKLSEIVWKL 264
           +GVS  ++ EIV +L
Sbjct: 226 IGVSTKRIDEIVEEL 240


>gi|108761374|ref|YP_633174.1| mevalonate kinase [Myxococcus xanthus DK 1622]
 gi|108465254|gb|ABF90439.1| mevalonate kinase [Myxococcus xanthus DK 1622]
          Length = 310

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 139/280 (49%), Gaps = 18/280 (6%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G ++L+GEH V++GH AL   +++ V       K   + + S+L +   +   A F  + 
Sbjct: 14  GKVILLGEHSVVYGHPALAGPLSQGVTARAVPAKACQLALPSTLSRPQRAQLTAAF--AR 71

Query: 74  SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILT 133
           +  +     +K S   DL +       +GLGSSAA++VA  A LL     K P+P +   
Sbjct: 72  AAEVTGAPPVKVSLEADLPLA------VGLGSSAALSVAC-ARLLLQAAGKVPTPKDAAR 124

Query: 134 TAHAIVLKVQGISSGIDLAASIHGGLICY-QMP---KYSIEKIDFIFPIHLIYS--GYKT 187
            A A+  +  G  SG+D   S    L+ Y + P   K + + ++   P+H++ +  G ++
Sbjct: 125 VAWAMEQEFHGTPSGVDHTTSAAEQLVLYWRKPGAAKGTGQVVESPRPLHVVVTLAGERS 184

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           PT + +  +   +  +P   E   +++A +G++S    +A+   +L+ L  AMN  QGLL
Sbjct: 185 PTKKTVGALRERQARWPSRYE---RLFAEIGRVSSEGAKAVAAGDLEALGDAMNVNQGLL 241

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             LG+S   L E+V++LRE   + A      G G  VI L
Sbjct: 242 AALGLSSPPLEEMVYRLRELGALGAKLTGAGGDGGAVIGL 281


>gi|110668819|ref|YP_658630.1| mevalonate kinase [Haloquadratum walsbyi DSM 16790]
 gi|109626566|emb|CAJ53030.1| mevalonate kinase [Haloquadratum walsbyi DSM 16790]
          Length = 338

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/331 (26%), Positives = 144/331 (43%), Gaps = 52/331 (15%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------RLINIDSSLGQYCGS 63
           SAPG + L GEH V++G  A+  AI +R  + +  R D       R +++D    +Y G 
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAIERRATVTVERRSDDHIRVEARDLSLDGFTVEYTGD 64

Query: 64  LD--------LAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAIT 110
            +         A+   +  ++  A+   +     P  GFD+ V S +    GLGSSAA+ 
Sbjct: 65  TEYRPDVDVPTALVDAAMGYVDAAVEQARDAADMPDAGFDIIVESDIPLGAGLGSSAAVV 124

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLI------CY 162
           VA I AA  T + +      E+   A+     VQ G +S  D   S  GG++      C 
Sbjct: 125 VAGIDAA--TRELNTPLDCREVARRAYNAEYDVQDGQASRADTFCSAMGGVVYVEGDECR 182

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
           +M   ++       P  + + G    T +++  +  +  EY    +   K    +G++ +
Sbjct: 183 RMTAPNL-------PFVIGFDGGAGDTGELVAGVRRLRSEY----DFAAKTVGSIGEIVR 231

Query: 223 ISCQALRNKN---------LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMAS 273
                L+N N         L  L Q M+   GLLE LGVS   L  +VW  RE      +
Sbjct: 232 QGETLLQNANPETTPGQALLTELGQFMDFDHGLLEALGVSSRTLDNMVWAAREA-GAYGA 290

Query: 274 KISGSGLGDCVIALGKGDLNSLPYQ-SVNCH 303
           K++G+G G C++AL +        + +  CH
Sbjct: 291 KLTGAGGGGCIVALDETSETETALEYTAECH 321


>gi|2497518|sp|Q50559|KIME_METTH RecName: Full=Mevalonate kinase; Short=MK
 gi|1184118|gb|AAA87051.1| mevalonate kinase [Methanothermobacter thermautotrophicus]
          Length = 303

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 135/271 (49%), Gaps = 31/271 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           K   SAP   +L GEH V++   A+  AI++RV + ++      + I S          L
Sbjct: 2   KSSASAPAKAILFGEHAVVYSKPAIAAAIDRRVTVTVSESSSTHVTIPS----------L 51

Query: 67  AMFHPS-------FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            + H S         +I   +     +   D++V  ++ +  GLGSSAA+TVA+  AL  
Sbjct: 52  GIRHSSERPSGGILDYIGRCLELYHDASPLDIRVEMEIPAGSGLGSSAALTVALIGALD- 110

Query: 120 LQYH-KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC----YQMPKYSIEKIDF 174
            +YH ++  P E    AH + + VQG +S +D A S +GGL+      ++ ++  +  D 
Sbjct: 111 -RYHGRDHGPGETAARAHRVEVDVQGAASPLDTAISTYGGLVYLDSQRRVRQFEADLGDL 169

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
           +   HL YSG    TA+++  ++     +P+I     +I   +  ++  + + L   N +
Sbjct: 170 VIA-HLDYSG---ETARMVAGVAERFRRFPDIM---GRIMDTVESITNTAYRELLRNNTE 222

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLR 265
            L + MN  QGLL+++GVS  +LS +V++ R
Sbjct: 223 PLGELMNLNQGLLDSMGVSTRELSMMVYEAR 253


>gi|329765805|ref|ZP_08257371.1| mevalonate kinase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137648|gb|EGG41918.1| mevalonate kinase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 351

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/291 (29%), Positives = 143/291 (49%), Gaps = 26/291 (8%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM- 68
            SAPG  +L GEH V++G  A++ AINKRV +      +  I + S +G+    LDL + 
Sbjct: 41  ASAPGKAILFGEHFVVYGIKAILCAINKRVTITAEKIPENKILVKSKIGE----LDLPLN 96

Query: 69  ---------FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                      P +      I   K + G  + V S++ S +GLGSS+A  VA  AA+  
Sbjct: 97  KPISEINSPLKPFYYLANKMIEKHKQNTGIKIIVESEIPSGVGLGSSSACCVAGAAAISR 156

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH 179
           L   +E + ++IL  A      +   +SG D      GGL+ Y   K    +I      H
Sbjct: 157 L--FEESTKEKILEMAIEAERTIFQNTSGADCTVCTFGGLMEYDKSK-GFSQIQSKSNFH 213

Query: 180 LI--YSGYKTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
           L+   S  +  T +V+ K+  + E      +++ QK   L+ ++S +    L+N +L+ L
Sbjct: 214 LVIANSNIEHSTDEVVSKVRKFKEKNEKTFSDMCQKESELINRVSTM----LKNNDLEGL 269

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            ++M+  +  LE LG+S+ KL ++V    E      +KI+G+G G C+I+L
Sbjct: 270 GKSMHENEEYLEILGISNDKLRDMVKIAGEAS--FGAKITGAGGGGCIISL 318


>gi|312137118|ref|YP_004004455.1| mevalonate kinase [Methanothermus fervidus DSM 2088]
 gi|311224837|gb|ADP77693.1| mevalonate kinase [Methanothermus fervidus DSM 2088]
          Length = 316

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 150/292 (51%), Gaps = 18/292 (6%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-TLRKDRLINIDSSLGQYCGS 63
           +H +  SAP  ++L GEH V++   A+  AINKR  + +   +KD  I   + +G +  +
Sbjct: 1   MHSVA-SAPNKIILFGEHAVVYKKPAIAVAINKRAKVSIKNTKKDSTIIKCNDIGLHA-N 58

Query: 64  LDLAMFHPSF--------SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
           ++   ++  F        ++I+  +     +    + +  ++   +GLGSSAAITVA+ A
Sbjct: 59  INPKTYNIEFLEGKKGILNYILEVLKSHHDNSPIKIDISLEVPLGIGLGSSAAITVALIA 118

Query: 116 ALLTLQYHKEPSPDEILTT-AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
           AL    YH++      L+  AH I LKVQG +S +D A S +GG+I   +   +IE I  
Sbjct: 119 ALH--NYHEKVIDKSSLSKKAHEIELKVQGAASPLDTAVSTYGGMIY--LKDSNIEYIKP 174

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
                 I + Y    A   K +S ++ +  +   I   I   +G +++ + + ++    +
Sbjct: 175 NIEGSFIVA-YTPKPADTKKMVSLVKKKLEKYPNIVGNIIDTIGNVTKTAYELIKEGKFE 233

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
            + + MN   GLL+++GVS S+LS++V+  R     + SKI+G+G    +IA
Sbjct: 234 KIGELMNINHGLLDSIGVSSSELSQMVYSAR-NAGALGSKITGAGGSGSIIA 284


>gi|298674294|ref|YP_003726044.1| mevalonate kinase [Methanohalobium evestigatum Z-7303]
 gi|298287282|gb|ADI73248.1| mevalonate kinase [Methanohalobium evestigatum Z-7303]
          Length = 304

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/311 (28%), Positives = 155/311 (49%), Gaps = 21/311 (6%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SAPG + L GEH V++G  A+  AI  R   ++    +  I I+S LG+    L+  
Sbjct: 2   ITSSAPGKIYLFGEHAVVYGENAICCAIELRT--HVQAEFNDHIEINSVLGR--SGLNFE 57

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S  I  +    P  G  + + S+L    GLGSSAA+TV+   AL  L +H   S
Sbjct: 58  K-HPYVSAAIERMKEFAPVDGVKININSELPVGSGLGSSAALTVSTIQALNHL-FHCGLS 115

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYK 186
            ++I    + +   VQG +S  D   S  GG+  + +P +  +E  D    I +  +   
Sbjct: 116 LEQIADLGYNVEWDVQGNASPTDTYVSTMGGV--FMLPSRRKLELNDC--GIVIGDTKKN 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           + T +++  ++ ++  +PEI      I + +GK++     ++ N + + + + MN  QGL
Sbjct: 172 SSTKKLVTNVAELKNRFPEIV---TSILSTIGKITYCGEYSVCNGDYESIGKLMNINQGL 228

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L+++GV   +LS++++  R +    A K++G+G G C+IAL          ++V+     
Sbjct: 229 LDSIGVGSLELSQLIYSARSKGAYGA-KLTGAGGGGCMIALADAS------KTVDVSDAI 281

Query: 307 KGIDIVPITPS 317
           K    VPIT +
Sbjct: 282 KSAGGVPITTN 292


>gi|288931747|ref|YP_003435807.1| mevalonate kinase [Ferroglobus placidus DSM 10642]
 gi|288893995|gb|ADC65532.1| mevalonate kinase [Ferroglobus placidus DSM 10642]
          Length = 295

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 134/278 (48%), Gaps = 16/278 (5%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG +++ GEH V++   AL  AIN R   Y+   K   I I S  G+    LD  + H
Sbjct: 4   SAPGKVIIFGEHAVVYKRRALASAINLRC--YVKAEKKDDIEIISEYGKT--GLDFRV-H 58

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           P  S  I+    +    G  ++V S++    GLGSSAA+TVA   AL  L +    + DE
Sbjct: 59  PFISQSIVNFKEVTDFKGVRVEVRSKIPPASGLGSSAAVTVATLTALNEL-FSTSLTKDE 117

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP-T 189
           I   A  + L VQG  SG D   S  GG   +   K    K++  F    +Y   K   T
Sbjct: 118 IFELARKVELDVQGKGSGTDPFISTFGGAWIFPERK----KVNPKFTRLFVYDTKKRSIT 173

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           A+++  ++     +PE+ E   +I+  +  ++           ++ L +     Q LL  
Sbjct: 174 AEMVAGVAERREIFPEVFE---RIFDAIDAITLEGADLFEKGEVEKLEKLFFINQKLLSA 230

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +GVS  ++  +V +L E+  + A KI+G+G G C+I+L
Sbjct: 231 IGVSTPEIDSLVAEL-ERRGVFA-KITGAGGGGCLISL 266


>gi|313125993|ref|YP_004036263.1| mevalonate kinase [Halogeometricum borinquense DSM 11551]
 gi|312292358|gb|ADQ66818.1| mevalonate kinase [Halogeometricum borinquense DSM 11551]
          Length = 345

 Score = 95.9 bits (237), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 141/305 (46%), Gaps = 33/305 (10%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLG----QYCGS 63
           SAPG + L GEH V++G  A+  AI +R  + +  R+D  + +   D SL     +Y G+
Sbjct: 12  SAPGKVYLFGEHAVVYGEPAVPCAIERRATVSVETREDSRVRVSAPDLSLDGFTVEYGGN 71

Query: 64  LD--------LAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAIT 110
            D          +      +I +A+   +     P+ GFD+ V S +    GLGSSAA+ 
Sbjct: 72  GDERPDVNVSEGLVEAGIEYIDVAVEQARDAANAPNAGFDVTVESDIPLGAGLGSSAAVV 131

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYS 168
           VA I AA   L +  +  P+E+   A+    +VQ G +S  D      GG +  ++    
Sbjct: 132 VASIDAATRELGHPLD--PEELAARAYRAEYEVQDGQASRADTFCCAVGGAV--RVEGDD 187

Query: 169 IEKIDF-IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
            + ID    P  + + G    T +++  +  +  EY    +  + I  L+ +   +  +A
Sbjct: 188 CQHIDAPSLPFVVGFDGGAGDTGKLVAGVRSLRDEYDFAADTVESIGDLVRRGESVLAEA 247

Query: 228 LRNKN-----LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
               +     L  L + M+   GLLE LGVS   L  +VW  RE      +K++G+G G 
Sbjct: 248 DPTDHPPEDVLAELGRLMDFDHGLLEALGVSSRTLDNMVWAAREA-GAHGAKLTGAGGGG 306

Query: 283 CVIAL 287
           C++AL
Sbjct: 307 CIVAL 311


>gi|15678075|ref|NP_275189.1| mevalonate kinase [Methanothermobacter thermautotrophicus str.
           Delta H]
 gi|2621081|gb|AAB84553.1| mevalonate kinase [Methanothermobacter thermautotrophicus str.
           Delta H]
          Length = 303

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 134/271 (49%), Gaps = 31/271 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           K   SAP   +L GEH V++   A+  AI++RV + ++      + I S          L
Sbjct: 2   KSSASAPAKAILFGEHAVVYSKPAIAAAIDRRVTVTVSESSSTHVTIPS----------L 51

Query: 67  AMFHPS-------FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            + H S         +I   +     +   D++V  ++ +  GLGSSAA+TVA+   L  
Sbjct: 52  GIRHSSERPSGGILDYIGRCLELYHDASPLDIRVEMEIPAGSGLGSSAALTVALIGPLD- 110

Query: 120 LQYH-KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC----YQMPKYSIEKIDF 174
            +YH ++  P E    AH + + VQG +S +D A S +GGL+      ++ ++  +  D 
Sbjct: 111 -RYHGRDHGPGETAARAHRVEVDVQGAASPLDTAISTYGGLVYLDSQRRVRQFEADLGDL 169

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
           +   HL YSG    TA+++  ++     +P+I     +I   +  ++  + + L   N +
Sbjct: 170 VIA-HLDYSG---ETARMVAGVAERFRRFPDIM---GRIMDTVESITNTAYRELLRNNTE 222

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLR 265
            L + MN  QGLL+++GVS  +LS +V++ R
Sbjct: 223 PLGELMNLNQGLLDSMGVSTRELSMMVYEAR 253


>gi|304314296|ref|YP_003849443.1| mevalonate kinase [Methanothermobacter marburgensis str. Marburg]
 gi|302587755|gb|ADL58130.1| predicted mevalonate kinase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 305

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 138/282 (48%), Gaps = 52/282 (18%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG-------- 58
           K   SAP   +L GEH V++G  A+  A+++RV + L    +  + I  SLG        
Sbjct: 2   KSRASAPAKAILFGEHAVVYGKPAIAAAVDRRVTVTLGDSSENRVTI-PSLGVDFRSESS 60

Query: 59  ------QYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
                  Y G   L ++H      I              ++  ++    GLGSSAA+TVA
Sbjct: 61  PRGGILDYVGKT-LKLYHDGSPLSI--------------QIEMEIPVGSGLGSSAALTVA 105

Query: 113 ITAALLTLQYH-KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
           +  AL   +YH +E  P++    AH + L+VQG +S +D   S +GGL+ Y   + ++EK
Sbjct: 106 LIGALD--EYHGRESEPEDTAARAHRVELEVQGAASPLDTTVSTYGGLV-YLDSQRNVEK 162

Query: 172 I-----DFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
           +     D +   HL +SG    TA+++  ++ +   +P++ +       +M  +  I+ +
Sbjct: 163 VNARLHDLVI-AHLDHSG---DTAEMVAGVAELRSRFPDVMD------GIMDAVEMITMR 212

Query: 227 ALR---NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLR 265
           A R   + + + +   MN  QGLL+ +GVS  +LS +V++ R
Sbjct: 213 AYRALMSNSPEPIGDLMNINQGLLDAMGVSTGELSMMVYEAR 254


>gi|300711103|ref|YP_003736917.1| mevalonate kinase [Halalkalicoccus jeotgali B3]
 gi|299124786|gb|ADJ15125.1| mevalonate kinase [Halalkalicoccus jeotgali B3]
          Length = 327

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 86/301 (28%), Positives = 135/301 (44%), Gaps = 32/301 (10%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RL------INIDSSLGQYCG 62
            SAPG + L GEH V++G  A+  AI++R  + +  R D RL      +++D    +Y G
Sbjct: 4   ASAPGKVYLFGEHAVVYGEPAVPCAISRRARVTVERRGDSRLHVHAEDLSLDGFTVEYSG 63

Query: 63  SLDLA--------MFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAI 109
             D          +   +  ++  A++  +     P  GFD+ V S +    GLGSSAA+
Sbjct: 64  EADATPDVDVSTDLVEAAMGYVDAAVSQAREAAGVPEAGFDVTVESAIPLGAGLGSSAAV 123

Query: 110 TVA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK- 166
            VA I AA  T +   E S  EI   A+     VQ G +S  D   S  GG +  +    
Sbjct: 124 VVAGIDAA--TRELGVELSTTEIADRAYRAEYDVQEGQASRADTFCSATGGAVRVEGEDC 181

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
            +I+  D  F I   + G    T +++  +  +   Y             +G + +   +
Sbjct: 182 RAIDAPDLPFVIG--FDGGAGNTGELVAGVRELREHYS----FAANTVETVGDIVRQGER 235

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           AL   +L  L   M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++A
Sbjct: 236 ALAAGDLAELGTLMDFNHGLLSALGVSSRSLDRMVWAARD-AGAHGAKLTGAGGGGCIVA 294

Query: 287 L 287
           L
Sbjct: 295 L 295


>gi|282164309|ref|YP_003356694.1| mevalonate kinase [Methanocella paludicola SANAE]
 gi|282156623|dbj|BAI61711.1| mevalonate kinase [Methanocella paludicola SANAE]
          Length = 299

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 143/288 (49%), Gaps = 37/288 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG + L GEH V++G  A+  AI+ R  + ++ RK R ++I S+              
Sbjct: 5   SAPGKVFLFGEHAVVYGKRAIACAIDLRTTVEVS-RKSRGVHIHSAFKD----------E 53

Query: 71  PSFS-FIIMAINHIKPSC---GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
           P  + +I  A+  ++        ++ V S++    GLGSSAA+TVA   A L  ++    
Sbjct: 54  PDKNLYIKTAVKRMQKCADIRNVNIAVSSRIPVASGLGSSAAVTVATIGA-LNEEFSAGL 112

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH----LIY 182
           S  +I   A+   L+VQG +S  D   S  GG +        +  +  + PI     + +
Sbjct: 113 SKKDIAYMAYQTELEVQGAASPTDTFVSTMGGTVV-------VPDMRTLPPITCGIVVGH 165

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKNLKVLAQA 239
           +G    T++++ ++  ++ +YP++      I  +M  +  IS +    ++  + + + + 
Sbjct: 166 TGISKSTSRMVSRVRTLKEKYPDV------IDGIMDSIGDISARGEDLIKQNDYRSIGEL 219

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           MN  QGLL+ LG++  +LS  ++  R Q     +KI+G+G G C++A+
Sbjct: 220 MNVNQGLLDALGITIPELSLQIYAAR-QHGAYGAKITGAGGGGCMVAI 266


>gi|148643499|ref|YP_001274012.1| mevalonate kinase [Methanobrevibacter smithii ATCC 35061]
 gi|222445003|ref|ZP_03607518.1| hypothetical protein METSMIALI_00619 [Methanobrevibacter smithii
           DSM 2375]
 gi|261350427|ref|ZP_05975844.1| mevalonate kinase [Methanobrevibacter smithii DSM 2374]
 gi|148552516|gb|ABQ87644.1| mevalonate kinase [Methanobrevibacter smithii ATCC 35061]
 gi|222434568|gb|EEE41733.1| hypothetical protein METSMIALI_00619 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861210|gb|EFC93508.1| mevalonate kinase [Methanobrevibacter smithii DSM 2374]
          Length = 320

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 152/294 (51%), Gaps = 22/294 (7%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-DRLI------NIDSSLGQ 59
           +   SAP   +L GEH V++   A+  A+NKR  + +T  K D+ I      N ++ L  
Sbjct: 2   RALASAPAKTILFGEHSVVYDEPAIAGAVNKRAYVEITESKTDKSILKSYDLNFEAELDT 61

Query: 60  YCGSLDLAMFHPSF-SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                +L    P    +I+ A+N +       +K+ S +    GLGSSAA+TVA  AAL 
Sbjct: 62  KHKKYNLKRGKPGIIRYILEALNKVHDHSPIVMKLSSNIPIGSGLGSSAAVTVATLAALY 121

Query: 119 ---TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE--KID 173
               ++++K+     +   AH +   VQGI+S +D   S +GGL+     K  +E  K++
Sbjct: 122 RFHNIRFNKK----SLAHDAHMVEQAVQGIASPLDTLVSTYGGLVYLSRNK-KVEHFKVN 176

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
           F  P  + Y+     T +++K +  ++   P+I  IN  I A MG+L+  + QA+  ++ 
Sbjct: 177 FNAPFVVGYTNKHGNTGKMVKDVRLLKNRNPKI--INPVISA-MGQLTNYAKQAILKRDF 233

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             + + MN   G L+ LGV+  +LS +V+  RE   I  SKI+G+G G  +IAL
Sbjct: 234 DKIGELMNLNHGFLDVLGVNTLELSRMVYTARECGAI-GSKITGAGGGGSIIAL 286


>gi|257388644|ref|YP_003178417.1| mevalonate kinase [Halomicrobium mukohataei DSM 12286]
 gi|257170951|gb|ACV48710.1| mevalonate kinase [Halomicrobium mukohataei DSM 12286]
          Length = 327

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 135/308 (43%), Gaps = 34/308 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL------INIDSSLGQYC 61
           +  SAPG + L GEH V++G  A+  AI +R  + +  R + L      + +D    +Y 
Sbjct: 2   VTASAPGKVYLFGEHAVVYGEPAVPCAIERRARVTVEERDEGLRVHLDDLTLDGFTIEYS 61

Query: 62  GSLDLAMFHP----SFSFIIMAINHIKPSC------------GFDLKVISQLDSQLGLGS 105
           G    A   P    S S +   + +I  +             GF++ V S +    G+GS
Sbjct: 62  GD---ATGRPDVNVSESLVEAGVGYINEAVEQARDAADAPDAGFEISVESSIPLGAGIGS 118

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQM 164
           SAA+ V +  A  T +   E    E+   A+ +   VQ G +S  D   S  GG +  + 
Sbjct: 119 SAAVVVGVIKA-ATAELGIEIDAREVAERAYRVEHTVQDGEASRADTFCSAMGGAVRVEG 177

Query: 165 PK-YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
                IE +D   P  + Y G    T  ++  +  +  EY    +        +G + + 
Sbjct: 178 DDCRRIEGVD-TLPFVIGYDGGAGDTGALVAGVRQLRSEY----DFAADTVEAVGDIVRE 232

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
             +AL+  +L  L + M+   GLL  LGVS   L  +VW  R+    + +K++G+G   C
Sbjct: 233 GERALQAGDLSELGELMDFNHGLLSALGVSSRSLDGMVWAARD-AGALGAKLTGAGGNGC 291

Query: 284 VIALGKGD 291
           V+AL + D
Sbjct: 292 VVALDETD 299


>gi|55377012|ref|YP_134862.1| mevalonate kinase [Haloarcula marismortui ATCC 43049]
 gi|55229737|gb|AAV45156.1| mevalonate kinase [Haloarcula marismortui ATCC 43049]
          Length = 327

 Score = 89.0 bits (219), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 139/313 (44%), Gaps = 30/313 (9%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL------INIDSSLGQYC 61
           +  SAPG + L GEH V++G  A+  AI +RV +  T   + L      + +D    +Y 
Sbjct: 2   VTSSAPGKVYLFGEHAVVYGEPAVPCAIERRVHVTATEIDEGLRIHANDLQLDGFTVEYS 61

Query: 62  G------SLDLA--MFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
           G       +D+A  +      ++  A+   +     P  GF++ V   +    GLGSSAA
Sbjct: 62  GDGESHPDVDVAESLVEAGMGYVNEAVAQARDAADAPEAGFEISVEGDIPLGAGLGSSAA 121

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK- 166
           + VA   A  T +   E S  +I   A+ +   VQ G +S  D   S  GG +  +    
Sbjct: 122 LVVAAIDA-ATRELGVELSASDIADRAYQVEHAVQDGQASRADTFCSAMGGAVRVEGDDC 180

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
             +E ID   P  + Y G    T  ++  +  +  +Y    +      A +G + +    
Sbjct: 181 RRLEGID-TLPFVIGYDGGAGDTGALVAGVRDLRGKY----DFAADTVAAIGDIVREGES 235

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
            L   + + L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++A
Sbjct: 236 VLGTGDYERLGELMDFNHGLLSALGVSSRSLDSMVWAARD-ADAHGAKLTGAGGGGCIVA 294

Query: 287 LGKGD--LNSLPY 297
           L + D  L +L Y
Sbjct: 295 LDETDDALTALKY 307


>gi|296242058|ref|YP_003649545.1| mevalonate kinase [Thermosphaera aggregans DSM 11486]
 gi|296094642|gb|ADG90593.1| mevalonate kinase [Thermosphaera aggregans DSM 11486]
          Length = 307

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 158/320 (49%), Gaps = 29/320 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL-A 67
           C  APG +VL GEH V+ G  A+ FA++K   + +   +D  +NI   + +  G ++  +
Sbjct: 3   CSKAPGKIVLFGEHFVVKGAPAIGFAVSKYAKVCV---EDGSLNI---ISKQTGRVEQDS 56

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQL----GLGSSAAITVAITAALLTLQYH 123
           + + +   +I  +N I   C  D+K++  +DS++    G+GSSAA++VA+  A LT   H
Sbjct: 57  LLYRAVKRLITKVNSI-FECSEDVKIL--IDSEIPIGSGMGSSAALSVALAHAYLT---H 110

Query: 124 KEPSPDEILTT--AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL- 180
                D+ L    A+    +V    SGID   +  GG + Y+   +   ++     ++  
Sbjct: 111 CNVDFDKKLVNEIAYEAEKEVHSKPSGIDNTLATFGGFLKYRSGVFEKLEVRLGEEVYFL 170

Query: 181 -IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
            + +  +  T ++++++  +  +YPEI E    +Y     L + + ++L  ++ + + + 
Sbjct: 171 VVNTNLRRQTGKIVEEVLKLYEKYPEILE---NVYNAASALVEKALKSLEERDYESIGRL 227

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
           M    GLL T+GVS      IV KL  +   + +K+SG+G G  VI L K  L       
Sbjct: 228 MLLNHGLLWTIGVSHEVNDLIVHKLVAKG-CLGAKLSGAGKGGIVIGLVKESL----VDK 282

Query: 300 VNCHMHAKGIDIVPITPSHS 319
           +   +  +G ++  +TP + 
Sbjct: 283 IEGELRNEGFEVFRVTPDYE 302


>gi|288560177|ref|YP_003423663.1| mevalonate kinase Mvk [Methanobrevibacter ruminantium M1]
 gi|288542887|gb|ADC46771.1| mevalonate kinase Mvk [Methanobrevibacter ruminantium M1]
          Length = 327

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 138/276 (50%), Gaps = 20/276 (7%)

Query: 5   LHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVIL--------YLTLRKDRLINIDS 55
           + K+ V SAPG  +L GEH V++   A+  A+NKR  +        Y TL+   L   + 
Sbjct: 1   MRKMSVASAPGKTILFGEHSVVYDEPAIAGAVNKRASVKIQESLNNYSTLKSYDL-GFEV 59

Query: 56  SLGQYCGSLDLAMFHPSF-SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
            L    G+  L    P    +I+ A+         D+ +   L    GLGSSAA+TVA  
Sbjct: 60  ILNTRRGTYKLVKGKPGIIRYILNAMGKFHDHSNIDMTLGLNLPIGSGLGSSAAVTVATI 119

Query: 115 AALLTLQYHKEP-SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID 173
           AAL    YH  P + +++   AH +   VQGI+S +D   S +GGL+     K  I + D
Sbjct: 120 AALH--DYHGVPITKEKLAEEAHGVEQDVQGIASPLDTLVSTNGGLVYLSREK-RIVRFD 176

Query: 174 --FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK 231
                P  + ++     T +++K + +++  YPE+  IN  I + MGK++  +  A+   
Sbjct: 177 KPLDAPFVIGFTNKYGNTGKMVKHVRHLKDNYPEL--INPVI-STMGKIANEARIAILKN 233

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ 267
           ++  +A  MN  QGLL+ LGV+  +LS +++  RE 
Sbjct: 234 DIDRIADLMNLNQGLLDGLGVNTYELSRMIYTAREN 269


>gi|118576794|ref|YP_876537.1| mevalonate kinase [Cenarchaeum symbiosum A]
 gi|118195315|gb|ABK78233.1| mevalonate kinase [Cenarchaeum symbiosum A]
          Length = 309

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 137/287 (47%), Gaps = 23/287 (8%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM-- 68
           SAP  +VL+GEH V+HG  AL+ AINKRV +   +R D  I I S+LG        A+  
Sbjct: 3   SAPAKVVLLGEHFVVHGTGALLCAINKRVRVTADIRGD-TIRIRSALGDAVLGPGEALPA 61

Query: 69  ---FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
                P       AI+      G ++ V S++   +GLGSS+A  VA   AL  L     
Sbjct: 62  GHPLGPLAHLAARAISRFGHKGGLEIAVESEIPPGVGLGSSSACCVAAAGALRGLFA--- 118

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAAS--IHGGLICYQ--MPKYSIEKIDFIFPIHLI 181
             PD   + A A+  +     +     ++   +GG+I Y      +++E    +  + + 
Sbjct: 119 -DPDRADSMAAALEAERTAFGAASGADSAACTYGGIIEYDSISGHHTVEGP--LLRLAVA 175

Query: 182 YSGYKTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            SG    TA+V++K+  +      E  ++ +K+  L+ +       A+   +L+ L   M
Sbjct: 176 DSGRAHSTAEVVRKVDGFRRDNGAEFADLCKKVSGLIPRAR----AAIEGGDLEGLGSCM 231

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +  Q  L+ +GVSD  L  +V +  + P   A K++G+G G CVIAL
Sbjct: 232 SENQECLDRIGVSDGVLRSMV-RAGDGPSYGA-KVTGAGDGGCVIAL 276


>gi|20089491|ref|NP_615566.1| mevalonate kinase [Methanosarcina acetivorans C2A]
 gi|19914398|gb|AAM04046.1| mevalonate kinase [Methanosarcina acetivorans C2A]
          Length = 305

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 144/285 (50%), Gaps = 15/285 (5%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SAPG + L GEH V++G  A+  AI  R  + + L  D +I I S +G+    +D  
Sbjct: 6   ISCSAPGKIYLFGEHAVVYGETAIGCAIELRTRVRVEL-CDSII-IQSEIGRT--GIDFE 61

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S ++  ++ I P  G  LKV S++    GL SSAA+T+A   AL  + +    S
Sbjct: 62  K-HPYISAVVEKMSEIVPIDGVHLKVNSEIPVGSGLSSSAAVTIASIGALNKM-FGCGLS 119

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYK 186
            +EI    H I ++VQG +S  D   S  GG++   +P +  ++  D    I +  +G  
Sbjct: 120 LEEIAKMGHEIEIQVQGAASPTDTYVSTFGGVV--TIPDRKKLKTPD--CGIVIGDTGVF 175

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T +++  +  +   YP + E    +  ++G +S+ +    +  +   + + MN  QGL
Sbjct: 176 ASTKELVANVRKLRESYPHLIE---PLMIVIGGISKTAEPFFQTGDYSSIGKLMNVNQGL 232

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           L+ LGV+  +LS++++  R       SK +G G G C++AL   D
Sbjct: 233 LDALGVNTLELSKLIYSSR-GAGAFGSKSTGGGGGGCMVALAASD 276


>gi|115377877|ref|ZP_01465063.1| mevalonate kinase [Stigmatella aurantiaca DW4/3-1]
 gi|310823054|ref|YP_003955412.1| mevalonate kinase [Stigmatella aurantiaca DW4/3-1]
 gi|115365092|gb|EAU64141.1| mevalonate kinase [Stigmatella aurantiaca DW4/3-1]
 gi|309396126|gb|ADO73585.1| Mevalonate kinase [Stigmatella aurantiaca DW4/3-1]
          Length = 310

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 128/283 (45%), Gaps = 24/283 (8%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G ++L+GEH V++GH AL   ++  V       K   +++  +LG+              
Sbjct: 14  GKVILLGEHSVVYGHPALAGPLSYGVTARAVPAKRCYLSLPGTLGRA-----------QR 62

Query: 74  SFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           + +  A       CG     + + S+L   +GLGSS A+ VA T  LL     ++ SP+ 
Sbjct: 63  NLLTQAFQRAAVLCGSPPVKVTLESELPLSMGLGSSGALAVASTRVLLKAS-GRDDSPEA 121

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICY-QMPKYSIEKIDFI---FPIHLIYS--G 184
           +   A  +  +  G  SG+D   S    L+ Y +    S  K+  +    P+ ++ +  G
Sbjct: 122 VARLALEMEQEFHGTPSGVDHTTSAQQKLLLYKRTAGQSTGKVRILKSPRPLKMLVALVG 181

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            ++PT   +  +   +  +PE      +++  +G L+    +A+   +L+ L  AMN  Q
Sbjct: 182 DRSPTKHTVAALRARQARWPERY---TRLFKQIGTLASEGAKAVEQGDLEALGDAMNVNQ 238

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           GLL  LG+S   L E+V++LR    + A      G G  VI L
Sbjct: 239 GLLAALGLSSPPLEEMVYRLRGLGALGAKLTGAGGDGGAVIGL 281


>gi|73668945|ref|YP_304960.1| mevalonate kinase [Methanosarcina barkeri str. Fusaro]
 gi|72396107|gb|AAZ70380.1| mevalonate kinase [Methanosarcina barkeri str. Fusaro]
          Length = 301

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 132/259 (50%), Gaps = 14/259 (5%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I  SAPG + L GEH V++G  A+  AI  R  + + L  D +I I S +G+    +D  
Sbjct: 2   ISCSAPGKIYLFGEHAVVYGETAIGCAIELRTHVRVEL-CDSII-IQSEIGRT--GIDFE 57

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S  I  +  I P  G  LKV S++    GL SSAA+T+A   AL  + +    S
Sbjct: 58  K-HPYISAAIEKMREIVPIDGVHLKVNSEIPVGSGLSSSAAVTIASIGALNKM-FGCGLS 115

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYK 186
            +EI    H I ++VQG +S  D   S  GG++   +P + +++  D    I +  +G  
Sbjct: 116 LEEIAKMGHEIEIQVQGTASPTDTYVSTFGGIV--TIPDRRTLKTPD--CGIVIGDTGVF 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T +++  +  +   YP + E    +  ++G++S+ +    +  +   + + MN  QG+
Sbjct: 172 ASTKELVTNVRKLRESYPHLIE---PLMVVIGRISKTAEPFFQTGDYSSIGKLMNVNQGI 228

Query: 247 LETLGVSDSKLSEIVWKLR 265
           L+ LGV+  +LS++++  R
Sbjct: 229 LDALGVNTFELSKLIYSSR 247


>gi|116753789|ref|YP_842907.1| mevalonate kinase [Methanosaeta thermophila PT]
 gi|116665240|gb|ABK14267.1| mevalonate kinase [Methanosaeta thermophila PT]
          Length = 321

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 140/299 (46%), Gaps = 34/299 (11%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRV--------------ILYLTLRKDRL-INIDS 55
           SAPG ++L GEH V+ G  AL  AI+ R               I  L LR     ++ D 
Sbjct: 5   SAPGKVILFGEHAVVSGAPALGTAIDLRARVLVEDLPGKTEISIHGLGLRLSGFSVDSDG 64

Query: 56  SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
            +     S + A      S ++ A++         + V S++    GLGSSAAI VA  A
Sbjct: 65  RVVSLGSSDEAAAAARYVSAVVKALDVRD----VRITVSSEIPVASGLGSSAAIVVATLA 120

Query: 116 ALLTLQYHK--EPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGL--ICYQMPKYSIE 170
           A   L +H   +     I   AH I   VQ G+ S +D A + +GG   I   +    + 
Sbjct: 121 A---LSHHMGIDMEVKSIAAEAHRIEKTVQGGLGSPMDTALAAYGGYIQISDGVTPLDLP 177

Query: 171 KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN 230
           ++D +     +    +   A+V +    +   YPEI +    I+  MG +S+ +   +++
Sbjct: 178 QMDLVVGCTSVPHDTRAEVARVQE----LRSRYPEIVD---PIFKAMGVISRKAVPCIKD 230

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            +LK L + MN   GLLE +GV   +LSE+V+  R     + +K++G+G G C+IAL K
Sbjct: 231 LDLKELGRLMNINHGLLEAIGVGTRELSELVYAARGAGMALGAKLTGAGGGGCMIALPK 289


>gi|126460440|ref|YP_001056718.1| mevalonate kinase [Pyrobaculum calidifontis JCM 11548]
 gi|126250161|gb|ABO09252.1| mevalonate kinase [Pyrobaculum calidifontis JCM 11548]
          Length = 310

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 140/299 (46%), Gaps = 31/299 (10%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V AP  +   GEH V++G  A+  AI+K V  Y+   +   + +++        L  A++
Sbjct: 3   VFAPCVVKFFGEHAVVYGKPAIAAAIDKGV--YVECEEGGELRVET-----VAPLSEAVY 55

Query: 70  HPS------------FSFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVAIT 114
           +P             F+++  A+   +   G      K+ S     +GL +SAA++VA+ 
Sbjct: 56  YPERGRVEGVGVGRFFAYVDAALEVARERWGDLRATFKIKSDFPPSVGLATSAAVSVALL 115

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A  +      PSP+E+    H++ LKVQGI+S +D A S  GGL+      +  E+I  
Sbjct: 116 KAY-SQCVGARPSPEELARLGHSVELKVQGIASPMDTAVSAMGGLLKIWPSPFRAEQIGA 174

Query: 175 IFP-IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
             P  +++    +  T +++  +       P +  + + I    G++ + + + L   +L
Sbjct: 175 ELPQFYVLLLPRRGTTGEIVADVRAKLQRRPSLKAVVEAI----GEVVEEAHKCLVAGDL 230

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK-GD 291
             + + M     LL  LGV DS++ + +  LR  P +   KISG+G G  V+ L + GD
Sbjct: 231 ACVGELMEINNWLLGALGVVDSRVVQALEILR--PFVYGGKISGAGRGGAVLILPRDGD 287


>gi|289580123|ref|YP_003478589.1| mevalonate kinase [Natrialba magadii ATCC 43099]
 gi|289529676|gb|ADD04027.1| mevalonate kinase [Natrialba magadii ATCC 43099]
          Length = 328

 Score = 85.9 bits (211), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 136/300 (45%), Gaps = 32/300 (10%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLG----QYCGS 63
           SAPG + L GEH V++G  A+  AI  R  + +  R D  + +   D SL     +Y G 
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAIEVRARVGVERRDDSKLRVHADDLSLDGFTVEYGGD 64

Query: 64  LD--------LAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAIT 110
            D         ++   +  ++  AI  ++        GFD+ + S +    GLGSSAA+ 
Sbjct: 65  ADGRPDIDVSESLLVAATQYVDSAIEQVRDVTGEEDVGFDVTIESDIPLGAGLGSSAAVV 124

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK-Y 167
           VA I A    L    EP+  E+   A+     VQ G +S  D   S  GG +  +     
Sbjct: 125 VAAIDAGTRALGTTLEPA--ELAERAYRTEYDVQDGQASRADTFCSATGGAVRVEGDDCR 182

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
           S++  D   PI + + G    T +++  +  +  EY    E        +G + +   QA
Sbjct: 183 SLDAPDL--PIVIGFDGGAGETGELVAGVRGLREEY----EFAADTVETVGDVVRNGEQA 236

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   +++ L + MN   GLL  LGVS   L  +VW  R+      +K++G+G G C++AL
Sbjct: 237 LAAGDVEELGRLMNFNHGLLSALGVSSRSLDTMVWAARD-AGAYGAKLTGAGGGGCIVAL 295


>gi|330834489|ref|YP_004409217.1| mevalonate kinase [Metallosphaera cuprina Ar-4]
 gi|329566628|gb|AEB94733.1| mevalonate kinase [Metallosphaera cuprina Ar-4]
          Length = 316

 Score = 85.9 bits (211), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 132/267 (49%), Gaps = 27/267 (10%)

Query: 13  PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-DRLINIDSSLGQYCGSLDLAM--- 68
           P  L L GEH +++G  A+  AI++   + +T+++ DR I   SSL  + G++ + +   
Sbjct: 9   PLKLTLFGEHAIVYGEPAIAMAISES--MKVTVKESDRTIISSSSL--HIGNIRVNLQDM 64

Query: 69  ------FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                    + SF+I A+N+ +      + + S +D  +GLG+SAA+ V + AA     Y
Sbjct: 65  RVESDQISKALSFVIEALNYFEEKRPALINIESSVDPSVGLGTSAAVIVGVIAA-----Y 119

Query: 123 HKEPSPD----EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
            K    D    EI   +  +  KVQG+ S +D   +  GG++ +     ++E++  +  I
Sbjct: 120 SKFLGYDFTNLEIAKISRNVEKKVQGLGSRMDTFTTSLGGILYFPRGSENVERLSSLPEI 179

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
              Y      TA++L+++  ++    E NE    I  L+G + + +  AL   +++ L Q
Sbjct: 180 ASGYVKRTATTAEILRRVKTVKENGREFNE----ILKLIGLVVEDARDALDKMDVETLGQ 235

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLR 265
            M    GLL +LGV+   L E+V   R
Sbjct: 236 LMYINHGLLMSLGVTSPILDELVSTAR 262


>gi|284173345|ref|ZP_06387314.1| mevalonate kinase [Sulfolobus solfataricus 98/2]
          Length = 313

 Score = 85.9 bits (211), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 124/265 (46%), Gaps = 20/265 (7%)

Query: 13  PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH-- 70
           P  L L GEH V++   A+   I++ + + ++   D+ + I  SL      LDL      
Sbjct: 7   PLKLTLFGEHAVVYDRPAIAMTISESLKVKVS-ENDKFLIISPSLNIKGVKLDLNEMKIE 65

Query: 71  -----PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK- 124
                    ++   +N+ +      +++ S ++  +GLG+SAA+ V   AA     Y K 
Sbjct: 66  SDEAKKVLRYVFEVLNYFEMKKPVKIEINSTVEPSVGLGTSAAVIVGTVAA-----YSKY 120

Query: 125 ---EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
              + S DEI   +H I LKVQGI+S +D     +GGLI +       EKID  F +   
Sbjct: 121 LGIDLSRDEIAKISHNIELKVQGIASRMDTYTETYGGLIYFPAGGKGFEKIDTNFELTAG 180

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           Y      TA VL ++  ++    E+ E    I  ++G+++  +   +  +N + L   M 
Sbjct: 181 YIRRSMSTADVLWRVRTLKESNKEVFE---NILDVIGEITNRAKSLIVEQNFEELGLLMY 237

Query: 242 RQQGLLETLGVSDSKLSEIVWKLRE 266
              GLL +LG++  +  EIV + ++
Sbjct: 238 VNHGLLFSLGITSPEADEIVSRAKQ 262


>gi|15897316|ref|NP_341921.1| mevalonate kinase [Sulfolobus solfataricus P2]
 gi|13813529|gb|AAK40711.1| Mevalonate kinase [Sulfolobus solfataricus P2]
 gi|261601989|gb|ACX91592.1| mevalonate kinase [Sulfolobus solfataricus 98/2]
          Length = 314

 Score = 85.5 bits (210), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 126/266 (47%), Gaps = 22/266 (8%)

Query: 13  PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH-- 70
           P  L L GEH V++   A+   I++ + + ++   D+ + I  SL      LDL      
Sbjct: 8   PLKLTLFGEHAVVYDRPAIAMTISESLKVKVS-ENDKFLIISPSLNIKGVKLDLNEMKIE 66

Query: 71  -----PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK- 124
                    ++   +N+ +      +++ S ++  +GLG+SAA+ V   AA     Y K 
Sbjct: 67  SDEAKKVLRYVFEVLNYFEMKKPVKIEINSTVEPSVGLGTSAAVIVGTVAA-----YSKY 121

Query: 125 ---EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
              + S DEI   +H I LKVQGI+S +D     +GGLI +       EKID  F +   
Sbjct: 122 LGIDLSRDEIAKISHNIELKVQGIASRMDTYTETYGGLIYFPAGGKGFEKIDTNFELTAG 181

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEIN-EINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           Y      TA VL ++  ++    E N E+ + I  ++G+++  +   +  +N + L   M
Sbjct: 182 YIRRSMSTADVLWRVRTLK----ESNKEVFENILDVIGEITNRAKSLIVEQNFEELGLLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLRE 266
               GLL +LG++  +  EIV + ++
Sbjct: 238 YVNHGLLFSLGITSPEADEIVSRAKQ 263


>gi|15790225|ref|NP_280049.1| mevalonate kinase [Halobacterium sp. NRC-1]
 gi|169235954|ref|YP_001689154.1| mevalonate kinase [Halobacterium salinarum R1]
 gi|10580685|gb|AAG19529.1| mevalonate kinase [Halobacterium sp. NRC-1]
 gi|167727020|emb|CAP13806.1| mevalonate kinase [Halobacterium salinarum R1]
          Length = 330

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 139/305 (45%), Gaps = 34/305 (11%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RL------INIDSSLGQYCGS 63
           SAPG + L GEH V++G  A+  AI +R  + ++ R+D RL      ++ID    +Y G 
Sbjct: 6   SAPGKVYLFGEHAVVYGEPAVPCAIERRAHVTVSEREDSRLRVCSGDLSIDGFTVEYSGD 65

Query: 64  ---------------LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAA 108
                          +D AM +   +          P+ GFD+ + S++    GLGSSAA
Sbjct: 66  RDAGGTPDVDVPAPIVDAAMGYVDAAVEQARAAADAPTAGFDVTIDSEIPLGAGLGSSAA 125

Query: 109 ITVA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK 166
           + VA I AA  T +   E    E+   A+ +   VQ G +S  D   S  GG++  ++  
Sbjct: 126 VVVAGIDAA--TRELGVELDAREVADRAYQVEHTVQDGEASRADTFCSAMGGVV--RVSG 181

Query: 167 YSIEKIDF-IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC 225
                +D    P  + Y G    T +++  +  +  E+  + +    I    G L +   
Sbjct: 182 DDCTTLDAPALPFVIGYDGTSHDTGELVAGVRALREEFGFVADTVTAI----GDLVRRGE 237

Query: 226 QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
            AL + ++  L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G  ++
Sbjct: 238 AALADGDVATLGRLMDINHGLLSGLGVSGRTLDAMVWAARDG-GADGAKLTGAGGGGSIV 296

Query: 286 ALGKG 290
           AL  G
Sbjct: 297 ALDAG 301


>gi|161527823|ref|YP_001581649.1| mevalonate kinase [Nitrosopumilus maritimus SCM1]
 gi|160339124|gb|ABX12211.1| mevalonate kinase [Nitrosopumilus maritimus SCM1]
          Length = 313

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 140/294 (47%), Gaps = 34/294 (11%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
            SAPG ++L GEH V++G  A++ AINKR+ +      +R I+I S++G     L+L   
Sbjct: 5   ASAPGKVILFGEHFVVYGVKAILCAINKRIAVTAEKIDERKISIKSNIGH----LELEPN 60

Query: 70  HPSFSFIIMAINH-IKP------------SCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
            P     I  IN  +KP            + G  + V S++   +GLGSS+A  VA  AA
Sbjct: 61  KP-----ISEINSPLKPFYYLANKIIQDKNFGIKIDVESEIPLGVGLGSSSACCVAGAAA 115

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
           +  L   +  S +EIL  A      +   +SG D      GGL+ Y   +    KI+   
Sbjct: 116 ISNL--FENNSKEEILKLAIEAEKTIFQNTSGADCTVCTFGGLMEYD-KENGFSKIESEP 172

Query: 177 PIHLI--YSGYKTPTAQVLKKISYIEIEYPEINEIN-QKIYALMGKLSQISCQALRNKNL 233
             HL+   S  +  T  V+  +     ++ + NE    K+      L +   + L+  N+
Sbjct: 173 NFHLVIANSNVEHSTESVVAGVR----KFKKNNEAEFSKLCKDESHLIENVLELLKENNI 228

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + L + + + Q  LE +G+S++KL E++     Q     +KI+G+G G C+ AL
Sbjct: 229 RELGERVIKNQEYLERIGISNAKLREMIQ--TGQNSSFGAKITGAGGGGCIFAL 280


>gi|147921498|ref|YP_684687.1| mevalonate kinase [uncultured methanogenic archaeon RC-I]
 gi|110620083|emb|CAJ35361.1| mevalonate kinase [uncultured methanogenic archaeon RC-I]
          Length = 299

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 131/285 (45%), Gaps = 23/285 (8%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG + L GEH V++G  A+  AI+ R  + +T  + + I I S+        D    +
Sbjct: 5   SAPGKVFLFGEHAVVYGKRAIACAIDLRTTVEITSSR-QGIRIQSAF------KDEPDKN 57

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           P     +          G ++ V S++    GLGSSAA     T A L  +Y    S DE
Sbjct: 58  PYIRVALKKFQQCAAVDGINISVSSKIPVASGLGSSAA-VTIATIAALNDEYQTNLSLDE 116

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH----LIYSGYK 186
           I    H   L+VQG +S  D   S  GG +     K        + PI     + Y+G  
Sbjct: 117 IAAMGHQTELEVQGAASPTDTFVSTMGGTVIVPDKKK-------LPPITCGVVVGYTGIS 169

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T++++ ++  ++  YPEI +    I   +G +S    + +   +   + + MN  QGL
Sbjct: 170 KSTSRMVSRVRTLKERYPEIID---GIMDCIGNMSTRGEELVAKNDYVSIGELMNVNQGL 226

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           L+ +GVS  +LS  V   R       +KI+G+G G C++AL + D
Sbjct: 227 LDAIGVSIPELSLQVNAAR-SCGAYGAKITGAGGGGCMVALCEPD 270


>gi|227827986|ref|YP_002829766.1| mevalonate kinase [Sulfolobus islandicus M.14.25]
 gi|227830723|ref|YP_002832503.1| mevalonate kinase [Sulfolobus islandicus L.S.2.15]
 gi|229579617|ref|YP_002838016.1| mevalonate kinase [Sulfolobus islandicus Y.G.57.14]
 gi|229581717|ref|YP_002840116.1| mevalonate kinase [Sulfolobus islandicus Y.N.15.51]
 gi|229585255|ref|YP_002843757.1| mevalonate kinase [Sulfolobus islandicus M.16.27]
 gi|238620214|ref|YP_002915040.1| mevalonate kinase [Sulfolobus islandicus M.16.4]
 gi|284998236|ref|YP_003420004.1| mevalonate kinase [Sulfolobus islandicus L.D.8.5]
 gi|227457171|gb|ACP35858.1| mevalonate kinase [Sulfolobus islandicus L.S.2.15]
 gi|227459782|gb|ACP38468.1| mevalonate kinase [Sulfolobus islandicus M.14.25]
 gi|228010332|gb|ACP46094.1| mevalonate kinase [Sulfolobus islandicus Y.G.57.14]
 gi|228012433|gb|ACP48194.1| mevalonate kinase [Sulfolobus islandicus Y.N.15.51]
 gi|228020305|gb|ACP55712.1| mevalonate kinase [Sulfolobus islandicus M.16.27]
 gi|238381284|gb|ACR42372.1| mevalonate kinase [Sulfolobus islandicus M.16.4]
 gi|284446132|gb|ADB87634.1| mevalonate kinase [Sulfolobus islandicus L.D.8.5]
 gi|323475076|gb|ADX85682.1| mevalonate kinase [Sulfolobus islandicus REY15A]
 gi|323477808|gb|ADX83046.1| mevalonate kinase [Sulfolobus islandicus HVE10/4]
          Length = 314

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 128/272 (47%), Gaps = 22/272 (8%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           ++    P  L L GEH V++   A+   I++ + + ++   DR + I  SL      LDL
Sbjct: 2   RVEAKVPLKLTLFGEHAVVYDRPAIAMTISESLKVRVS-ESDRFLIISPSLNIRGVKLDL 60

Query: 67  AMFH-------PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                          ++   +N+ +      +++ S ++  +GLG+SAA+ V   AA   
Sbjct: 61  NEMKIESDEAKKVLRYVFEVLNYFEMKKPVKIEIDSTVEPSVGLGTSAAVIVGTVAA--- 117

Query: 120 LQYHK----EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
             Y K    + + DEI   +H I LKVQGI+S +D     +GGLI +       E+ID  
Sbjct: 118 --YSKYLGIDLNRDEIAKISHDIELKVQGIASRMDTYTETYGGLIYFLPGGEGFERIDTN 175

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEIN-EINQKIYALMGKLSQISCQALRNKNLK 234
           F +   Y      TA VL ++  ++    E+N E+   I  ++G+++  +   +  +N +
Sbjct: 176 FELTAGYIRRSMSTADVLWRVRKLK----ELNKEVFDNILDVIGEITNRAKSLIIEQNYE 231

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLRE 266
            L   M    GLL +LG++  +  EIV + ++
Sbjct: 232 ELGLLMYVNHGLLFSLGITSPEADEIVSRAKQ 263


>gi|124485504|ref|YP_001030120.1| mevalonate kinase [Methanocorpusculum labreanum Z]
 gi|124363045|gb|ABN06853.1| mevalonate kinase [Methanocorpusculum labreanum Z]
          Length = 290

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 99/326 (30%), Positives = 144/326 (44%), Gaps = 57/326 (17%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG ++L GEH V++G  A+  AI  RV   +T+R  R                     
Sbjct: 5   SAPGKVILFGEHSVVYGKPAIAMAIKPRV--QVTVRHSRYYQ-----------------K 45

Query: 71  PSFSFI--IMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL---LTLQYHKE 125
           P+  +I     +  +K S    + V SQL S  GLGSSAA+TVA   A+     L Y +E
Sbjct: 46  PNSPYISECFRLTDVKGS----VYVRSQLPSASGLGSSAAVTVATLFAINDEFELGYTRE 101

Query: 126 PSPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL-IYS 183
               E+   A  +    QG  +S  D   S  GGL+  +      EK   + P +L I  
Sbjct: 102 ----EVGDLAFEVEKATQGGRASATDTYVSTFGGLVFIR----GSEKRRLLPPQNLSIVI 153

Query: 184 GYKT---PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-KNLKVLAQA 239
           G       TA++++K++ +    P I         +M  +  ++ +A+ N +N K L   
Sbjct: 154 GNSLISHNTAEMVEKVAELRRTSPVIAN------GIMDAIGGVTMEAMHNLENPKELGVL 207

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL-GKGDLNSLPYQ 298
           MNR   LL+ LGV    LS++V   R       +K+SG+G G C+ AL  KG  N +   
Sbjct: 208 MNRNHALLDALGVGHPVLSQLVLAAR-NAGAYGAKLSGAGGGGCIWALCSKGSRNRVAGA 266

Query: 299 SVNCHMHAKGIDIVPITPSHSTSLYR 324
             +C       D  PIT S  T   R
Sbjct: 267 IEDC-------DARPITTSIDTEGAR 285


>gi|76802067|ref|YP_327075.1| mevalonate kinase [Natronomonas pharaonis DSM 2160]
 gi|76557932|emb|CAI49516.1| mevalonate kinase [Natronomonas pharaonis DSM 2160]
          Length = 329

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 140/303 (46%), Gaps = 33/303 (10%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL-----------GQ 59
           SAPG + L GEH V++G  A+  AI +R  + +  R D  + + ++            G+
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAIQRRARVTVEERDDDRLQVQANDLTLDGFTVTWGGE 64

Query: 60  YCGSLDLAMFHP----SFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAIT 110
                D+ +  P    +  +I  AI     +     CGFD+ V S +    GLGSSAA+ 
Sbjct: 65  TNDRPDVDVPAPLVEAAMGYIDGAIEQALDAVDVEECGFDITVESDIPLGAGLGSSAAVV 124

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYS 168
           VA I AA+  L    E     +   A+ +  +VQ G +S  D   S  GG +  ++    
Sbjct: 125 VAGIDAAVREL--GGELDAQAVAERAYEVEYEVQSGEASRADTFCSAVGGAV--RVRGDD 180

Query: 169 IEKIDFI--FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
             ++D +   P  + Y G    T +++  +  +  EY    +  + I    G + +    
Sbjct: 181 CRRLDDVPTLPFVVGYDGGTGDTGELVAGVRELREEYDFAADTVESI----GDIVRKGEA 236

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           AL+  +++ + + M+   GLL  LGVS   L  +VW  RE    + +K++G+G G C++A
Sbjct: 237 ALQRGDIEEVGRLMDFNHGLLSALGVSARSLDTMVWAARE-ADALGAKLTGAGGGGCIVA 295

Query: 287 LGK 289
           L +
Sbjct: 296 LDR 298


>gi|256811284|ref|YP_003128653.1| mevalonate kinase [Methanocaldococcus fervens AG86]
 gi|256794484|gb|ACV25153.1| mevalonate kinase [Methanocaldococcus fervens AG86]
          Length = 311

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 141/301 (46%), Gaps = 42/301 (13%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI----NIDSSLGQYCGSLD 65
           V  P  ++L GEH V++G+ A+  AI+    + +    D++I    +++ SL       D
Sbjct: 3   VKTPSKVILFGEHAVVYGYRAISMAIDLTSTVEIKENSDKIILNLNDLNKSLK--LNLKD 60

Query: 66  LAMFHPS----FSFIIMAIN------HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
           L    P+    F + + AI       +I+P  GF+L + S +    GLGSSA+IT+    
Sbjct: 61  LKEIEPNNFGDFKYCLCAIKETMDYLNIEPKKGFELNISSNIPISCGLGSSASITIGTIK 120

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
           A+    Y+K    DEI     ++  K+QG +S  D +   + G++  +  K+   + DF 
Sbjct: 121 AIGKF-YNKPLKDDEIAKLGFSVEKKIQGKASVTDTSTITYKGILEIKNNKFRKIREDFE 179

Query: 176 FPIH-----LIY-SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
             +      ++Y    K  TA+++ +++ IE +     EI++ I             AL+
Sbjct: 180 EFLKSCKFLIVYVEKRKKKTAELVNEVAKIENKDEIFKEIDKVIE-----------NALK 228

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIV---WKLREQPHIMASKISGSGLGDCVIA 286
             N +   + M +   LL+ L +S  K+ ++V    KL        +K++G+G G CVI 
Sbjct: 229 TYNKEEFGKCMAKNHDLLKKLNISTPKIDKVVDIGNKLG-----FGAKLTGAGGGGCVII 283

Query: 287 L 287
           L
Sbjct: 284 L 284


>gi|225711296|gb|ACO11494.1| Mevalonate kinase [Caligus rogercresseyi]
          Length = 363

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 130/292 (44%), Gaps = 45/292 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG---QYCGSL 64
           + VSAP  L+L GEHGV++   A+  +++ R  + +  R  RL+     +G   +  G  
Sbjct: 7   VEVSAPSKLILHGEHGVVYDKLAVAGSLDLRTRMTILRRSKRLVVDFPDIGVLKESWGPK 66

Query: 65  DLAMFHPSFSFIIMAINHIKPSC------------------------GFDLKVISQLDSQ 100
           DL       S I   I  + P                          G  + V S +   
Sbjct: 67  DLEPLFEEESRIEDIIPKLLPDSRDPIQIASLKCFFYLYKRILGRFLGLYISVESDIPIG 126

Query: 101 LGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKV-QGISSGIDLAASIHGGL 159
            GLGSSAA++V + A LLT+  HK  S  E+++    +  K+  G  SGID + S HGGL
Sbjct: 127 AGLGSSAALSVCLAAGLLTMNGHKNASDPEVISKYAFLSEKILHGSPSGIDNSVSAHGGL 186

Query: 160 ICYQMPKYSIEKIDFIFPIH--LIYSGYKTPTAQVLKKI--------SYIEIEYPEINEI 209
           I ++  K S++++   F I   L+ SG    T ++L+ +          IE     INEI
Sbjct: 187 IAFK--KGSLKQLVAPFDIRVLLVESGVSRNTKKILEGVRERLSSSPKVIESLLQGINEI 244

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIV 261
           ++    L+  L +   +     +   L   ++R   LL  LGVS  +L EI+
Sbjct: 245 SEDFIELIKDLGEPLPE-----DFVALEDLIHRNHSLLRALGVSHPRLEEII 291


>gi|146304365|ref|YP_001191681.1| mevalonate kinase [Metallosphaera sedula DSM 5348]
 gi|145702615|gb|ABP95757.1| mevalonate kinase [Metallosphaera sedula DSM 5348]
          Length = 316

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 129/272 (47%), Gaps = 21/272 (7%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           + ++    P  L L GEH V++G  A+  AI++ + + +T   DR +   SSL      +
Sbjct: 1   MRRVEAIVPLKLTLFGEHAVVYGEPAIAMAISETMKVTVT-ESDRTVISSSSLNIGNIKV 59

Query: 65  DLAMFH-------PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           DL            + SF + A+N+        + + S +D  +GLG+SAA+ V + +A 
Sbjct: 60  DLRDMRVESEQTGKALSFALEALNYFDEKKPALISIESSVDPSVGLGTSAAVIVGVVSA- 118

Query: 118 LTLQYHKEPSPD----EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID 173
               Y K    D    EI   +  I  KVQG+ S +D   +  GG++ +      +E+++
Sbjct: 119 ----YSKFLGYDMTNLEIAKVSRHIEKKVQGLGSRMDTFTTSLGGVLYFPRNSEDVERVN 174

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
               I   Y    + TA++L+++  ++ +  E ++    I  L+GKL   +   +  +++
Sbjct: 175 SSLNISGGYIRRISSTAEILRRVKAVKDKSREFDD----ILHLIGKLVDEARWGIEREDM 230

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLR 265
           + + Q M    GLL +LGV+   + E+V   R
Sbjct: 231 ETVGQLMYINHGLLMSLGVTSPAIDELVSTAR 262


>gi|297526601|ref|YP_003668625.1| mevalonate kinase [Staphylothermus hellenicus DSM 12710]
 gi|297255517|gb|ADI31726.1| mevalonate kinase [Staphylothermus hellenicus DSM 12710]
          Length = 318

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 138/291 (47%), Gaps = 21/291 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAIN---KRVILYLTLRKDRLINI----DSSLGQY 60
           IC +AP  ++L GEH V+ G  A+V A+N   K  I+ L   K  LI+     ++ L + 
Sbjct: 2   ICSAAPAKVILFGEHFVVKGKPAIVTAVNLYAKTCIMELESGKHLLISKQLRQETDLDKE 61

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                LA F   +  I      I+   GF   + S +    G+GSSAA  V+ T +LL  
Sbjct: 62  HVPEQLAQFKRIYEIIYEKYGVIR---GFKAIIDSDIPVSSGMGSSAATAVSFTHSLLRF 118

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
               E   +++   A+     V G  SGID   S  GG+I Y+  +  +EK++  +P +L
Sbjct: 119 -LGVEFKLEDVNNIAYEAEKLVHGKPSGIDNTVSTFGGIIYYK--RGYMEKLNVKWPQNL 175

Query: 181 ----IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
               + SG K  T +V+  +  +E  Y    EI + IY    +L   +   + +     L
Sbjct: 176 SLVVVDSGIKRNTGKVVMDV--LE-RYERHEEIMKHIYVAAEQLVNKAKNLILSSRFYDL 232

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            + ++  Q LLE++GVS  +   I++ + E    + +KISG+G G  V  L
Sbjct: 233 GELISINQSLLESIGVSIFETDRIIYAMIESGG-LGAKISGAGRGGIVYGL 282


>gi|159041536|ref|YP_001540788.1| mevalonate kinase [Caldivirga maquilingensis IC-167]
 gi|157920371|gb|ABW01798.1| mevalonate kinase [Caldivirga maquilingensis IC-167]
          Length = 336

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 148/307 (48%), Gaps = 32/307 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT---------LRKD---RLINID 54
           K+  +APG + L GEH V++G  A+  AINK + + +          L KD   + + I 
Sbjct: 7   KVTATAPGVVKLFGEHAVVYGRPAIAMAINKGIKVTVEEGGGDSLTILAKDLAVKGVAIR 66

Query: 55  SSLGQYCGS-LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQL-DSQLGLGSS------ 106
            +     GS +D +      S+ + A+  +    G DL+ I  + +SQL +G+       
Sbjct: 67  VTGNSIEGSVIDDSQLSRLASYALTALRIMTEKYGGDLRGIRVIIESQLPIGAGLATSAA 126

Query: 107 -AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP 165
            +    A  A L+ ++  KE    +I    H++ L VQG +S +D A S  GG + Y  P
Sbjct: 127 VSVAAAAAYARLINVKLSKE----DIAKIGHSVELTVQGAASPMDTATSSMGG-VMYIKP 181

Query: 166 KYSIEKID--FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
              + K+      P+ + Y   +  T +++K++  +  ++P + E    I   +G +   
Sbjct: 182 GVELRKLSTSLKMPLVVGYVERELTTGELVKRVKALYNKHPRVVE---GIIDSIGAIVDE 238

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
           +  AL   +   L + MN  QGLLE LGVS+ +LS I++  R +   + +K+SG G G  
Sbjct: 239 AVTALSGGDYVALGELMNINQGLLEALGVSNHRLSNIIYMAR-KAGALGAKLSGGGGGGA 297

Query: 284 VIALGKG 290
           +IAL  G
Sbjct: 298 MIALAPG 304


>gi|257871002|ref|ZP_05650655.1| mevalonate kinase [Enterococcus gallinarum EG2]
 gi|257805166|gb|EEV33988.1| mevalonate kinase [Enterococcus gallinarum EG2]
          Length = 310

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 125/282 (44%), Gaps = 18/282 (6%)

Query: 12  APGSLVLMGEHGVLHGHAALVF---AINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
           A G ++LMGEH V++G  A+ F        V +  +L  D   N       Y G L+ A 
Sbjct: 8   ATGKIILMGEHSVVYGEPAIAFPFAGAKVHVTITASLTNDLTSNY------YHGPLEEAP 61

Query: 69  FH-PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
            H  +   ++  +     +  F + ++S + S+ G+GSSAA+ VA+T A    Q HKE  
Sbjct: 62  SHLKNVKELLHRLQQDHQTGPFSVSIVSTIPSERGMGSSAAVAVALTRAFFDWQ-HKELK 120

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            + +L           G  SGID AA+  G    Y      I          L+   +G 
Sbjct: 121 KERLLDYVDFSEKIAHGNPSGID-AAATSGNEAIYFTKGQPITSFPLTIDGFLLVADTGI 179

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           K  T   +K ++++   +        +  + +G L++ + +A+ +  L  L QAM     
Sbjct: 180 KGQTRTAVKSVAHL---FETQKHQTSQAISRLGSLAKTAKEAILHNQLTQLGQAMTHAHE 236

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            L  LGVS+  L ++V  L        +K++G G G C+IAL
Sbjct: 237 TLRQLGVSNQNLDDLV-SLALANGAFGAKLTGGGRGGCMIAL 277


>gi|40890012|pdb|1VIS|A Chain A, Crystal Structure Of Mevalonate Kinase
          Length = 324

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 144/299 (48%), Gaps = 37/299 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLI----NIDSSLGQYCGSL 64
           +  P  ++L GEH V++G+ A+  AI+    I     ++D +I    +++ SLG      
Sbjct: 5   IETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLN-- 62

Query: 65  DLAMFHPS----FSFIIMAINH------IKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           ++   +P+    F + + AI +      I+P  GF + + S++    GLGSSA+IT+   
Sbjct: 63  EIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTI 122

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A+    Y+KE   DEI    + +  ++QG +S  D +   + G++  +  K+   K +F
Sbjct: 123 KAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEF 181

Query: 175 IFPIH-----LIYS-GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
              +      ++Y+   K  TA+++ +++ IE +     EI++ I            +AL
Sbjct: 182 EEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVID-----------EAL 230

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + KN +   + M +   LL+ L +S  KL  IV           +K++G+G G CVI L
Sbjct: 231 KIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVD--IGNRFGFGAKLTGAGGGGCVIIL 287


>gi|20150886|pdb|1KKH|A Chain A, Crystal Structure Of The Methanococcus Jannaschii
           Mevalonate Kinase
          Length = 317

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 144/299 (48%), Gaps = 37/299 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLI----NIDSSLGQYCGSL 64
           +  P  ++L GEH V++G+ A+  AI+    I     ++D +I    +++ SLG      
Sbjct: 8   IETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLN-- 65

Query: 65  DLAMFHPS----FSFIIMAINH------IKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           ++   +P+    F + + AI +      I+P  GF + + S++    GLGSSA+IT+   
Sbjct: 66  EIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTI 125

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A+    Y+KE   DEI    + +  ++QG +S  D +   + G++  +  K+   K +F
Sbjct: 126 KAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEF 184

Query: 175 IFPIH-----LIYS-GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
              +      ++Y+   K  TA+++ +++ IE +     EI++ I            +AL
Sbjct: 185 EEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVID-----------EAL 233

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + KN +   + M +   LL+ L +S  KL  IV           +K++G+G G CVI L
Sbjct: 234 KIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVD--IGNRFGFGAKLTGAGGGGCVIIL 290


>gi|257053113|ref|YP_003130946.1| mevalonate kinase [Halorhabdus utahensis DSM 12940]
 gi|256691876|gb|ACV12213.1| mevalonate kinase [Halorhabdus utahensis DSM 12940]
          Length = 330

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 126/307 (41%), Gaps = 31/307 (10%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS----------- 56
           +  SAPG + L GEH V++G  A+  AI +R  +  T R D  + +D+            
Sbjct: 2   VTSSAPGKVYLFGEHAVVYGEPAVPCAIERRASVTATRRDDEALRVDAGDLTLDGFTVEY 61

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAINHI---------KPSCGFDLKVISQLDSQLGLGSSA 107
            G   G  D+ +  P     +  +N           +P  GFD+ + S +    GLGSS 
Sbjct: 62  SGGTDGRPDVDVEQPLLEAAMGYVNEAVEQARDATGRPEAGFDVHIDSAIPLGAGLGSS- 120

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPK 166
           A  V       T +       +EI   A+ +   VQ G +S  D   S  GG +  ++  
Sbjct: 121 AAVVVAAIDAATRELGVTLDSEEIADRAYQVEHAVQDGEASRADTFCSAMGGAV--RVEG 178

Query: 167 YSIEKIDFI--FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQIS 224
               +++ +   P  + Y G    T  ++  +  +  EY    +        +G + +  
Sbjct: 179 DDCRRLEAVPNLPFVIGYDGGSGDTGALVSGVRGLRAEY----DFAADTVEAIGDVVRRG 234

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
             AL   +L  L + M+   GLL  LGVS   L  +VW          +K++G+G G C+
Sbjct: 235 EDALAAADLDELGRLMDFNHGLLSALGVSSRSLDAMVWAA-RDADARGAKLTGAGGGGCI 293

Query: 285 IALGKGD 291
           +AL   D
Sbjct: 294 VALDDTD 300


>gi|126465130|ref|YP_001040239.1| mevalonate kinase [Staphylothermus marinus F1]
 gi|126013953|gb|ABN69331.1| mevalonate kinase [Staphylothermus marinus F1]
          Length = 324

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 140/291 (48%), Gaps = 21/291 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAIN---KRVILYLTLRKDRLIN----IDSSLGQY 60
           IC +AP  ++L GEH V+    A+V A+N   K  I  L   K  LI+    +++ + + 
Sbjct: 2   ICSAAPAKVILFGEHFVVKDKPAIVTAVNLYAKTCITELESEKHLLISKQLRLETDIDKD 61

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                LA F   +  I    +    + GF   + S +    G+GSSAA  V+ T +LL  
Sbjct: 62  RVPEQLAQFKHIYEII---NDKYGITRGFKAFIDSDIPVSSGMGSSAATAVSFTYSLLRF 118

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
               E   ++I   A+     V G  SGID   S +GG+I Y+  +  +EK++  +P +L
Sbjct: 119 -LGVEFELEDINNIAYEAEKLVHGKPSGIDNTVSTYGGIIYYK--RGYMEKLNVKWPQNL 175

Query: 181 ----IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
               + SG K  T +V+  +  +E  Y    EI + IY    +L   +   + +     L
Sbjct: 176 SLVVVDSGIKRNTGKVVMDV--LE-RYERHKEIMKHIYDAAEQLVNKARNLILSGRFYDL 232

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            + ++  QGLLE++GVS  +  +I++ + E    + +KISG+G G  V  L
Sbjct: 233 GELISINQGLLESIGVSIYETDKIIYAMIENG-ALGAKISGAGRGGIVYGL 282


>gi|15669275|ref|NP_248080.1| mevalonate kinase [Methanocaldococcus jannaschii DSM 2661]
 gi|2497517|sp|Q58487|KIME_METJA RecName: Full=Mevalonate kinase; Short=MK
 gi|1591731|gb|AAB99088.1| mevalonate kinase [Methanocaldococcus jannaschii DSM 2661]
          Length = 312

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 144/299 (48%), Gaps = 37/299 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLI----NIDSSLGQYCGSL 64
           +  P  ++L GEH V++G+ A+  AI+    I     ++D +I    +++ SLG      
Sbjct: 3   IETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLN-- 60

Query: 65  DLAMFHPS----FSFIIMAINH------IKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           ++   +P+    F + + AI +      I+P  GF + + S++    GLGSSA+IT+   
Sbjct: 61  EIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIGTI 120

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A+    Y+KE   DEI    + +  ++QG +S  D +   + G++  +  K+   K +F
Sbjct: 121 KAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFRKIKGEF 179

Query: 175 IFPIH-----LIYS-GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
              +      ++Y+   K  TA+++ +++ IE +     EI++ I            +AL
Sbjct: 180 EEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVID-----------EAL 228

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + KN +   + M +   LL+ L +S  KL  IV           +K++G+G G CVI L
Sbjct: 229 KIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVD--IGNRFGFGAKLTGAGGGGCVIIL 285


>gi|156937551|ref|YP_001435347.1| mevalonate kinase [Ignicoccus hospitalis KIN4/I]
 gi|156566535|gb|ABU81940.1| mevalonate kinase [Ignicoccus hospitalis KIN4/I]
          Length = 321

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 89/335 (26%), Positives = 162/335 (48%), Gaps = 37/335 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI--------NIDSSLGQ 59
           +   AP  + L GEH V++G  A+VF++   + + L+L  D ++        ++D  + +
Sbjct: 3   VSARAPTKVTLFGEHSVVYGKPAIVFSMPIYINVKLSLSDDLMVITGPVSLRSVDLVISK 62

Query: 60  ---YCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                G L         S+++ A+  I    G  +++ S +    G+G+SAA+TV   AA
Sbjct: 63  DKIEVGDLVRKQMEKYVSYVVEALQTIGVE-GARVEIESPMPVGAGVGTSAAVTVGTIAA 121

Query: 117 LLTLQY---HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEK 171
              L+    +KE     I   A  +  KVQG +S +D  AS  GG++  +     + IE+
Sbjct: 122 ACALKRCGLNKEG----IAKLAWEVEKKVQGKASPMDTFASALGGVLWIEKEDSGWKIER 177

Query: 172 --IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
             +D +  +  I+   KT TA+++++++ ++++    +EI + I  LMGK+++ + +AL 
Sbjct: 178 LSVDQLPLVVGIFEKRKT-TAELVREVA-LKVQR---SEIYKDIIELMGKIAREAREALI 232

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
             +LK L + M     +LE LG+   ++S  +    E      +K SG+G G  V+AL +
Sbjct: 233 KGDLKELGELMKLNNAMLEALGLVTKEVSNAI-HAAELAGAYGAKASGAGSGGAVVALAE 291

Query: 290 GDLNSLPYQSVNCHMHAKGIDIVPI--TPSHSTSL 322
                   ++V   + A G   V I   PS    L
Sbjct: 292 ------DVKAVRAALLASGAKKVFIVENPSRGVEL 320


>gi|145591803|ref|YP_001153805.1| mevalonate kinase [Pyrobaculum arsenaticum DSM 13514]
 gi|145283571|gb|ABP51153.1| mevalonate kinase [Pyrobaculum arsenaticum DSM 13514]
          Length = 315

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 147/320 (45%), Gaps = 26/320 (8%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI--NIDSSLGQYCGSL 64
           K  + APG + L GEH V++G  A+  AI+K V +   +  DRL+   +  + G     L
Sbjct: 2   KKSIFAPGVVKLFGEHAVVYGKPAIAAAIDKGVYID-CVSSDRLVVETVGITTGLRFSPL 60

Query: 65  D--LAMFHPS--FSFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVAITAAL 117
           D  +  F     F+++  A+   +   G       + S L    G  +SAA++V I  A 
Sbjct: 61  DRRVEAFGAEKFFAYVETALRLAQERWGDLAAKFTIRSDLPPSAGAATSAAVSVGILKA- 119

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IF 176
             L    +   +E     H + L+VQGI+S +D AA  +GG++      +  E +   + 
Sbjct: 120 YALCAGADVGDEEAAKLGHKVELEVQGIASPMDTAAVTYGGVLKILTNPFRAEPLKIQLP 179

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
           P +++       T +++K +  +  +      + + I    GK+ + +   LR  +L+ +
Sbjct: 180 PFYIVLLPRLGTTGEIVKDVRALLGKRKSATWVIEAI----GKVVEEAEGCLRAGDLECV 235

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK-GDLNS- 294
            + M+    LL  LGV D ++ +++  L+  P I   KISG+G G  VI + K GD+ S 
Sbjct: 236 GELMDINNWLLGALGVVDGRVVDLLGMLK--PFIYGGKISGAGRGGIVILIPKEGDVVSR 293

Query: 295 ------LPYQSVNCHMHAKG 308
                  PY  V+ +    G
Sbjct: 294 ILKGLGYPYYKVSVYPKGAG 313


>gi|260663062|ref|ZP_05863955.1| phosphomevalonate kinase [Lactobacillus fermentum 28-3-CHN]
 gi|260552683|gb|EEX25683.1| phosphomevalonate kinase [Lactobacillus fermentum 28-3-CHN]
          Length = 369

 Score = 79.3 bits (194), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 161/345 (46%), Gaps = 72/345 (20%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINI------DSSLGQY 60
           I   APG L + GE+ V+ +G+ A++ A+N+ V   +T  KD +  I      D+SL Q+
Sbjct: 2   ITAKAPGKLYIAGEYAVVENGYPAILVALNQFVTCTITEAKDEVGQIISRQYHDNSL-QW 60

Query: 61  CGSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDSQ----LGLGS 105
               D  +       FS+I+ AIN        +    G +++++ SQLDSQ     GLGS
Sbjct: 61  RRRGDQMVVDKRDNPFSYILSAINVTEEFARSLNQRLGIYNIRIDSQLDSQSGKKYGLGS 120

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ- 163
           SAA+TVA   AL   +Y++ P   E++    +I    VQG  S  D+AAS++GG I Y+ 
Sbjct: 121 SAAVTVATVKAL--CEYYQLPVNKEMIFKLSSIAHFDVQGNGSLGDVAASVYGGWIAYRS 178

Query: 164 ----------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYI 199
                                  P   IE +D    + L+  ++G    T++++ KIS  
Sbjct: 179 FDRQWLSEQRHYLDLPALLSLPWPDLKIELLDAPANLALLIGWTGKPASTSRLVDKISLF 238

Query: 200 EI----EYPEINEINQKIYALM------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           +     EY    + ++     M      G L +I  +   N+NL  L +  +R    +ET
Sbjct: 239 KAKQQDEYHRFLDRSKACIHRMIDGFHTGDLDKIKAEIRYNRNL--LQELAHRSGVQIET 296

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC-VIAL-GKGDL 292
             +   KL +I      +    A+K SG+G GDC ++A+ G  DL
Sbjct: 297 PLL--KKLCQIA-----EEFGGAAKTSGAGGGDCGIVAIDGHADL 334


>gi|119871981|ref|YP_929988.1| mevalonate kinase [Pyrobaculum islandicum DSM 4184]
 gi|119673389|gb|ABL87645.1| mevalonate kinase [Pyrobaculum islandicum DSM 4184]
          Length = 314

 Score = 79.3 bits (194), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 140/298 (46%), Gaps = 26/298 (8%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC------ 61
           + V APG + L GEH V++G  A+   I++ V +    + DRLI    S+G         
Sbjct: 2   VKVFAPGVVKLFGEHAVVYGKPAIATTIDRGVFIECE-KSDRLI--IESIGTPSTLVYLP 58

Query: 62  --GSLDLAMFHPSFSFIIMAINHIKPSCG-----FDLKVISQLDSQLGLGSSAAITVAIT 114
             G L+       F+++  A+   +   G     F +K  S+L   +G  +SAA++V I 
Sbjct: 59  EEGRLEALGAERFFAYVNTALKIARERWGKLKARFSIK--SELPPSIGAATSAAVSVGIL 116

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A  +L  + E S +E+    H + L VQGI+S +D  A   GG++      + +EK+D 
Sbjct: 117 KAY-SLCANVEVSKEELAKLGHQVELNVQGIASPMDTTAVAIGGVLKIWAHPFRVEKLDV 175

Query: 175 IFP-IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
             P  +++    +  T +++  +  +     +     Q +   +G++ + +   LR  +L
Sbjct: 176 SLPQFYIVVLPRRGTTGEIVADVKAL----LDRRRSAQSVINAIGEVVEEAEGCLRRGDL 231

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             + + M     LL  LGV D+++  ++  L+    +   KISG+G G  V+ L K +
Sbjct: 232 NCVGELMILNNWLLGALGVVDNRVMTLLDLLK--TFVYGGKISGAGRGGVVLILPKDE 287


>gi|70608067|ref|YP_256937.1| mevalonate kinase [Sulfolobus acidocaldarius DSM 639]
 gi|68568715|gb|AAY81644.1| mevalonate kinase [Sulfolobus acidocaldarius DSM 639]
          Length = 314

 Score = 79.0 bits (193), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 124/268 (46%), Gaps = 24/268 (8%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR---KDRLINIDSSLGQYCGSLDLA 67
           S P  L L GEH V++G  A+ + I++    YL +R    +R     ++L      +DL 
Sbjct: 6   SVPLKLTLFGEHAVVYGRPAIAYTISE----YLKIRIKESERFYVTSNTLELTGVKVDLH 61

Query: 68  MFHPS-------FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
            +           ++I   IN+        + + S +D  +GLG+SA + V + +A  TL
Sbjct: 62  EYKVENENVKRVLAYITETINYFGAEKKVSIDIESPVDPSVGLGTSAGVVVGMVSAYSTL 121

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
             HK  S ++I   +H I L+VQG++S +D      GG I  +     +EK+D       
Sbjct: 122 LGHK-LSREQIAKISHEIELRVQGLASIMDTHTETFGGFILVKKGGKEVEKLDANMNFSS 180

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ---ALRNKNLKVLA 237
            Y      TA +LK++  ++   P++ E      +++  + Q++ +   A+   +   L 
Sbjct: 181 GYFRRIATTADMLKRVKKLKESKPQLFE------SVLNVIEQVTTEAKNAIAKNDEDELG 234

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLR 265
           + M    GLL ++G++   + +IV   R
Sbjct: 235 ELMYINHGLLFSIGITVPVIDQIVSTAR 262


>gi|184155670|ref|YP_001844010.1| phosphomevalonate kinase [Lactobacillus fermentum IFO 3956]
 gi|227514850|ref|ZP_03944899.1| phosphomevalonate kinase [Lactobacillus fermentum ATCC 14931]
 gi|183227014|dbj|BAG27530.1| phosphomevalonate kinase [Lactobacillus fermentum IFO 3956]
 gi|227086782|gb|EEI22094.1| phosphomevalonate kinase [Lactobacillus fermentum ATCC 14931]
          Length = 369

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 161/345 (46%), Gaps = 72/345 (20%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINI------DSSLGQY 60
           I   APG L + GE+ V+ +G+ A++ A+N+ V   +T  KD +  I      D+SL Q+
Sbjct: 2   ITAKAPGKLYIAGEYAVVENGYPAILVALNQFVTCTITEAKDEVGQIISRQYHDNSL-QW 60

Query: 61  CGSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDSQ----LGLGS 105
               D  +       FS+I+ AIN        +    G +++++ SQLDSQ     GLGS
Sbjct: 61  RRRGDQMVVDKRDNPFSYILSAINVTEEFARSLNQRLGIYNIRIDSQLDSQSGKKYGLGS 120

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ- 163
           SAA+TVA   AL   +Y++ P   E++    +I    VQG  S  D+AAS++GG I Y+ 
Sbjct: 121 SAAVTVATVKAL--CEYYQLPVNKEMIFKLSSIAHFDVQGNGSLGDVAASVYGGWIAYRS 178

Query: 164 ----------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYI 199
                                  P   IE +D    + L+  ++G    T++++ KIS  
Sbjct: 179 FDRQWLSEQRHYLDLPALLSLPWPDLKIEPLDAPANLALLIGWTGKPASTSRLVDKISLF 238

Query: 200 EI----EYPEINEINQKIYALM------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           +     EY    + ++     M      G L +I  +   N+NL  L +  +R    +ET
Sbjct: 239 KAKQQDEYHRFLDRSKACIHRMIDGFHTGDLDKIKEEIRYNRNL--LQELAHRSGVQIET 296

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC-VIAL-GKGDL 292
             +   KL +I      +    A+K SG+G GDC ++A+ G  DL
Sbjct: 297 PLL--KKLCQIA-----EEFGGAAKTSGAGGGDCGIVAIDGHADL 334


>gi|170290680|ref|YP_001737496.1| mevalonate kinase [Candidatus Korarchaeum cryptofilum OPF8]
 gi|170174760|gb|ACB07813.1| mevalonate kinase [Candidatus Korarchaeum cryptofilum OPF8]
          Length = 312

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 143/289 (49%), Gaps = 17/289 (5%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC-GS-- 63
           ++  SAP    L+GEH VL+G  AL  +++KR  +  +   +  I I+S LG Y  GS  
Sbjct: 2   RVRASAPSQAFLLGEHAVLYGSPALALSVDKRSHVEASPLPEGEIMIESELGVYKEGSSY 61

Query: 64  -LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
             DL         +    N      G  L++ S++ +  G+ SSA++  AI+ ++  L +
Sbjct: 62  NEDLVKLAEGVKELF---NKYGIRSGVHLRIRSEVPASSGMASSASVAAAISKSIDAL-F 117

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF---IFPIH 179
           +   S  E+L   +     + G +S    A ++ GG+I  +     +          P+ 
Sbjct: 118 NLGMSESELLDAVYTFERIIHGRASKTGPACAVLGGVIWVEWSDGEMRATSLGHREVPVA 177

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-INQKIYALMGKLSQISCQALRNKNLKVLAQ 238
           +  +G  + T ++++++S +   +PE++E I + I  L+ K      +AL + + + L  
Sbjct: 178 IACTGEPSRTKEMVERVSKLREAFPEVHEGIVRTISDLVFK----GREALESGDFRTLGS 233

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            MN  QGLL +LGVS   +  I+W+ R +   + +K+SG+G G CV+ L
Sbjct: 234 LMNINQGLLYSLGVSSFAIERIIWEARMK-GALGAKLSGAGGGGCVVIL 281


>gi|222480241|ref|YP_002566478.1| mevalonate kinase [Halorubrum lacusprofundi ATCC 49239]
 gi|222453143|gb|ACM57408.1| mevalonate kinase [Halorubrum lacusprofundi ATCC 49239]
          Length = 338

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 139/315 (44%), Gaps = 36/315 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLG----QY 60
           +C  APG + L GEH V++G  A+  AI +R  +    R D  + +   D SL     +Y
Sbjct: 3   VC-EAPGKVYLFGEHAVVYGEPAVPAAIERRATVTAEPRSDDHVRVEAEDLSLNGFTVEY 61

Query: 61  CGSL----DLAMFHP----SFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSA 107
            G      D+ +  P    +  ++  A+         P  GFD+ V S +    GLGSSA
Sbjct: 62  AGGTGDRPDVDVPAPLVEAAMGYVDAAVRQARDAADAPDAGFDITVESDIPLGAGLGSSA 121

Query: 108 AITVA-ITAALLTLQYHKEP-SPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQM 164
           A+ VA I AA   L    EP    E+   A+    +VQ G +S  D   S  GG +  ++
Sbjct: 122 AVVVAGIDAATRAL---GEPLDRRELADRAYHAEYEVQDGQASRADTFCSTMGGAV--RI 176

Query: 165 PKYSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
                E I+    P  + + G    T +++  +  +  EY    +  + I  ++    ++
Sbjct: 177 EGDDCEPIEAPNLPFVVGFDGGAGDTGELVAGVGELREEYGFAADTVESIGDVVRTGEKL 236

Query: 224 SCQALRNKN-----LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGS 278
              A+   +     L  L + M+   GLL  LGVS   L  +VW  R+      +K++G+
Sbjct: 237 LADAVSEADPSPELLAELGELMDFNHGLLSALGVSARSLDAMVWAARDA-GAHGAKLTGA 295

Query: 279 GLGDCVIALGKGDLN 293
           G G C++AL   D +
Sbjct: 296 GGGGCIVALDASDAS 310


>gi|70994538|ref|XP_752047.1| mevalonate kinase [Aspergillus fumigatus Af293]
 gi|66849681|gb|EAL90009.1| mevalonate kinase [Aspergillus fumigatus Af293]
          Length = 538

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 160/377 (42%), Gaps = 80/377 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG AA+  AI+ R  +L  TL K         R I +D +    
Sbjct: 94  VSAPGKVIVYGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITMNFRDIGLDHTWN-- 151

Query: 61  CGSLDLAMFH-PS---FSF---------IIMAI----NHIKPSCGFDLKVISQLDSQL-- 101
              L   +FH PS   F +         ++ AI    + + P    D++ I +  +    
Sbjct: 152 IDELPWDVFHHPSKKKFYYDLVTSLDPELVAAIQPHADAVSPDKPEDVRKIHRRSASAFL 211

Query: 102 --------------------------GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
                                     GLGSSA++ V ++AA LL ++    P PD+    
Sbjct: 212 YLFLSLGSSQNPGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRTLAGPHPDQPPDE 271

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FP 177
           A   + ++            G  SG+D   S  G  + ++   YS        ++F   P
Sbjct: 272 AEVQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVVFRREDYSKPPTVTPLLNFPELP 331

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ +     TA  + K+  ++ EYP + +     I+Q   A   K+ +IS   +  + 
Sbjct: 332 LLLVDTRQSRSTAVEVAKVGKLKDEYPVVTDSILEAIDQVTLAAQQKIQEISTNGISYRT 391

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ L   +    G L +LGVS  +L E + +L +   I  +K++G+G G C I L + D+
Sbjct: 392 LEDLGTLIRINHGFLVSLGVSHPRL-ERIRELVDYADIGWTKLTGAGGGGCAITLLRPDI 450

Query: 293 NSLPYQSVNCHMHAKGI 309
                + +   + A+G 
Sbjct: 451 KEEAVRELEEKLSAEGF 467


>gi|332686203|ref|YP_004455977.1| mevalonate kinase [Melissococcus plutonius ATCC 35311]
 gi|332370212|dbj|BAK21168.1| mevalonate kinase [Melissococcus plutonius ATCC 35311]
          Length = 315

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 132/284 (46%), Gaps = 10/284 (3%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A G ++LMGEH V++G  A+     + +++  ++  +  L+N     G      D     
Sbjct: 11  ATGKIILMGEHSVIYGKPAIALPFQQVKIMAEISPNEQMLLNCSYYSGMLSSVPDQLKNI 70

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
                 ++   H K    F + + S + S+ G+GSSAA  VA+  A      +   S +E
Sbjct: 71  RKLVEKLLVFLH-KTDHKFQITIKSTIPSERGMGSSAATAVALVRAFFDYFSYTPSSSEE 129

Query: 131 ILTTAHAIVLKVQGISSGIDLAA--SIHGGLICYQMPKYSIE-KIDFIFPIHLIYSGYKT 187
           +L              SGID AA  S+H      + P   IE K+   + I +  +G K 
Sbjct: 130 LLNLVSFSEKIAHCNPSGIDAAATSSVHPLYFMKEQPIQPIELKLTNAYLI-VADTGIKG 188

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T + +K ++ +   +    +   K + ++G+L++ + QA+      +L + MN+ Q +L
Sbjct: 189 QTREAVKAVACL---FDSKKQATMKKFQILGELTEQAKQAMTKNQASLLGKIMNQAQEVL 245

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           +TLGVS+  +  ++ ++        +K++GSG G CVI L   +
Sbjct: 246 KTLGVSNKPIDNLI-EIAHNNGATGAKLTGSGRGGCVITLSNNE 288


>gi|159125039|gb|EDP50156.1| mevalonate kinase [Aspergillus fumigatus A1163]
          Length = 538

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 160/377 (42%), Gaps = 80/377 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG AA+  AI+ R  +L  TL K         R I +D +    
Sbjct: 94  VSAPGKVIVYGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITMNFRDIGLDHTWN-- 151

Query: 61  CGSLDLAMFH-PS---FSF---------IIMAI----NHIKPSCGFDLKVISQLDSQL-- 101
              L   +FH PS   F +         ++ AI    + + P    D++ I +  +    
Sbjct: 152 IDELPWDVFHHPSKKKFYYDLVTSLDPELVAAIQPHADAVSPDKPEDVRKIHRRSASAFL 211

Query: 102 --------------------------GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
                                     GLGSSA++ V ++AA LL ++    P PD+    
Sbjct: 212 YLFLSLGSSQNPGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRTLAGPHPDQPPDE 271

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FP 177
           A   + ++            G  SG+D   S  G  + ++   YS        ++F   P
Sbjct: 272 AEVQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVVFRREDYSKPPTVTPLLNFPELP 331

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ +     TA  + K+  ++ EYP + +     I+Q   A   K+ +IS   +  + 
Sbjct: 332 LLLVDTRQSRSTAVEVAKVGKLKDEYPVVTDSILEAIDQVTLAAQQKIQEISTNGISYRT 391

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ L   +    G L +LGVS  +L E + +L +   I  +K++G+G G C I L + D+
Sbjct: 392 LEDLGTLIRINHGFLVSLGVSHPRL-ERIRELVDYADIGWTKLTGAGGGGCAITLLRPDI 450

Query: 293 NSLPYQSVNCHMHAKGI 309
                + +   + A+G 
Sbjct: 451 KEEAVRELEEKLSAEGF 467


>gi|15922513|ref|NP_378182.1| hypothetical protein ST2185 [Sulfolobus tokodaii str. 7]
 gi|15623303|dbj|BAB67291.1| 312aa long conserved hypothetical protein [Sulfolobus tokodaii str.
           7]
          Length = 312

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 132/285 (46%), Gaps = 33/285 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR----------KDRL------I 51
           I V  P  L L GEH V++   A+ + I++    +LTLR           D L      +
Sbjct: 2   IEVKVPLKLTLFGEHAVVYERPAIAYTISE----FLTLRFKESDKFYIKSDNLQIKGVRV 57

Query: 52  NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITV 111
           NID         ++        S+II  IN+ +     ++++ S ++  +GLG+SA + V
Sbjct: 58  NIDEF------KIENENIKRVLSYIIEGINYFEAKKPVEIEIESPVEPSVGLGTSAGVVV 111

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
             T A  +     E S +EI   +H+I LKVQG+ S +D      GG I  +  K+  EK
Sbjct: 112 G-TVAGYSSYLGIELSKEEIAKISHSIELKVQGLGSRMDTYTETFGGFIYIEKDKF--EK 168

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK 231
           +         Y    T TA++LK++  I+    +  E+   I   + +++  + +AL++ 
Sbjct: 169 LSSNLSFSAGYFRRVTTTAEMLKRVKQIK---EKKRELFDSILDTIAEITIEAKKALQDN 225

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
           +   + + M    GLL +LG++  ++ E +   R   ++   KIS
Sbjct: 226 DEDSIGELMYINHGLLFSLGITVPQIDEFISTTR-MANVKGCKIS 269


>gi|11499870|ref|NP_071114.1| mevalonate kinase (mvk) [Archaeoglobus fulgidus DSM 4304]
 gi|8928130|sp|O27995|KIME_ARCFU RecName: Full=Mevalonate kinase; Short=MK
 gi|2648230|gb|AAB88965.1| mevalonate kinase (mvk) [Archaeoglobus fulgidus DSM 4304]
          Length = 284

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 143/284 (50%), Gaps = 19/284 (6%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPG ++L GEH V++G  A+V AIN R    +++RK     I SSLG+    LD  
Sbjct: 1   MIASAPGKIILFGEHAVVYGRHAVVSAINLRC--RVSVRKSDRFLIRSSLGE--SGLDYQ 56

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP     +     ++   G ++++ S++    GLGSSAA  +  T A L  ++  +  
Sbjct: 57  R-HPYVVQAVKRFGELRNIPGAEIEIESEIPIGSGLGSSAA-VIVATIAALNAEFDGDMD 114

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
            + I   A  + + VQG +SGID   S  GG   +  P+    K++  F   +I  G ++
Sbjct: 115 KEAIFQMAKQVEIDVQGRASGIDPFISTFGG--SWLFPER--RKVEMPFKFFVINFGSRS 170

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            TA+++ K++ +   +PE+      +  +   +  IS +A    + + L + +   Q LL
Sbjct: 171 -TAEMVAKVAELRERHPEV------VDKIFDAIDAISLEASDVGSAERLEELIAINQSLL 223

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             +GVS+ ++   + +L      + +KI+G+G G C+  L KG+
Sbjct: 224 RAIGVSNPEIDRTIAELERMG--LNAKITGAGGGGCIFGLFKGE 265


>gi|268325873|emb|CBH39461.1| mevalonate kinase [uncultured archaeon]
          Length = 352

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 147/312 (47%), Gaps = 34/312 (10%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID-SSLGQYCGSLDL 66
           I  S P   +L GEH V++   AL  AIN+R+ + ++ + +   ++  +++  +   L+L
Sbjct: 4   IRASVPAKAILFGEHFVVYDKRALATAINRRLEVVVSSKAESGYHVKIANIPTFGLQLNL 63

Query: 67  --------AMFHPSFSFIIMAINHIKPSC------------GFDLKVISQLDSQLGLGSS 106
                   A  +  +     AI ++K +             G +L++ S++    GLGSS
Sbjct: 64  EHEKVGREAYPYKDYDNASKAIAYVKETIDYLEKNYEIGGEGVELEISSEIPLSAGLGSS 123

Query: 107 AAITVAITAALLTLQYHKEPSPDE-ILTTAHAIVLKVQGISSGIDLAASIHGGLICY--- 162
           AA  VA  AAL   +Y    +  E I   AH++   VQG +S +D A S +GG +     
Sbjct: 124 AATCVATIAAL--KEYFGVATDLEGIRKDAHSVEKAVQGNASPVDTAVSTYGGYVLVENA 181

Query: 163 QMPKYSIEKIDFI------FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYAL 216
           ++ +  + ++D I       P+ +        + +  + +  ++      ++I + I+  
Sbjct: 182 EVKRLPLAELDLIVGTIGSIPLSMDIEKTAEISLKTKRIVEAVKARRESFSDIFEHIFDA 241

Query: 217 MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
             +L+  + +AL  ++   L   MN   GLL+ +GV   +LSE+V K  ++   + +K++
Sbjct: 242 ADELTAQALRALEREDFATLGTLMNVNHGLLDAIGVVPRRLSELV-KRSQESGALGAKVT 300

Query: 277 GSGLGDCVIALG 288
           G+G  D +  +G
Sbjct: 301 GAGGLDAMGGVG 312


>gi|28378416|ref|NP_785308.1| mevalonate kinase [Lactobacillus plantarum WCFS1]
 gi|254556625|ref|YP_003063042.1| mevalonate kinase [Lactobacillus plantarum JDM1]
 gi|300767359|ref|ZP_07077271.1| mevalonate kinase [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308180571|ref|YP_003924699.1| mevalonate kinase [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|28271252|emb|CAD64156.1| mevalonate kinase [Lactobacillus plantarum WCFS1]
 gi|254045552|gb|ACT62345.1| mevalonate kinase [Lactobacillus plantarum JDM1]
 gi|300495178|gb|EFK30334.1| mevalonate kinase [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308046062|gb|ADN98605.1| mevalonate kinase [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 312

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 136/283 (48%), Gaps = 25/283 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++L+GEHGV++G  A+   I+   +  +  R+D    + S    + G  D  M   +   
Sbjct: 13  IILIGEHGVVYGQPAIALPISTIQMQAIIHRRDAAQTVKSRY--FNG--DFKMMSANLGG 68

Query: 76  IIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           I   I  +      P  GFD+ + S + S+ G+GSSAA  VA+T A     + +  S  E
Sbjct: 69  IQTLIRTLLARFDAPEQGFDIHITSDIPSERGMGSSAAAAVAVTRAFYDF-FDRPLSHQE 127

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L TA+       G  SG+D+A +        + P + ++  +  FPI +   GY     
Sbjct: 128 LLATANVAESYTHGQPSGLDVATA------SAKSPVWFVKGREN-FPIPVKLPGYLVIAD 180

Query: 191 QVLKKISYIEIE------YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             +K  + + +         E   I  +I  L G+L++ +  AL + ++  LA A+N  Q
Sbjct: 181 TGIKSQTKVAVATVRNLLMVEGATIQARIDDL-GRLTRQTRTALEDGDMGALATALNGAQ 239

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++GVS   L +++   R Q   +A+K++GSG G C+IAL
Sbjct: 240 DDLRSMGVSHPALEQLLAVAR-QNGALAAKLTGSGQGGCLIAL 281


>gi|119500972|ref|XP_001267243.1| mevalonate kinase [Neosartorya fischeri NRRL 181]
 gi|119415408|gb|EAW25346.1| mevalonate kinase [Neosartorya fischeri NRRL 181]
          Length = 538

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 160/377 (42%), Gaps = 80/377 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG AA+  AI+ R  +L  TL K         R I +D +    
Sbjct: 94  VSAPGKVIVYGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITMNFRDIGLDHTWN-- 151

Query: 61  CGSLDLAMFH-PS---FSF---------IIMAI----NHIKPSCGFDLKVISQLDSQL-- 101
              L   +FH PS   F +         ++ AI    + + P    D++ I +  +    
Sbjct: 152 IDELPWDVFHHPSKKKFYYDLVTSLDPELVAAIQPHADAVSPEKPEDVRKIHRRSASAFL 211

Query: 102 --------------------------GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
                                     GLGSSA++ V ++AA LL ++    P PD+    
Sbjct: 212 YLFLSLGSSQNPGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRTLAGPHPDQPPDE 271

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FP 177
           A   + ++            G  SG+D   S  G  + ++   YS        ++F   P
Sbjct: 272 AEVQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVVFRREDYSKPPTVTPLLNFPELP 331

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ +     TA  + K+  ++ E+P + +     I+Q   A   K+ +IS   +  + 
Sbjct: 332 LLLVDTRQSRSTAVEVAKVGKLKDEHPVVADSILEAIDQVTLAAQQKIQEISTNGISERT 391

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ L   +    G L +LGVS  +L E + +L +   I  +K++G+G G C I L + D 
Sbjct: 392 LEDLGTLIRINHGFLVSLGVSHPRL-ERIRELVDYADIGWTKLTGAGGGGCAITLLRPDT 450

Query: 293 NSLPYQSVNCHMHAKGI 309
                + +   ++A+G 
Sbjct: 451 KEEAVRELEEKLNAEGF 467


>gi|171693619|ref|XP_001911734.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946758|emb|CAP73562.1| unnamed protein product [Podospora anserina S mat+]
          Length = 528

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 154/358 (43%), Gaps = 82/358 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKDR------LINIDSSLGQY 60
             VSAPG +++ GEH V+HG AA+  +I  R  L +T L K R        +ID      
Sbjct: 77  FMVSAPGKVIVFGEHAVVHGKAAIAASIALRSYLLVTSLSKSRKTVTLKFPDIDFDHSWR 136

Query: 61  CGSLDLAMFH-PS-----FSFI-------IMAIN----HIKPSCGFDLKVISQ------- 96
              L  A+F  PS     +S +       + AI      + P    D++ + Q       
Sbjct: 137 IDELPWAIFQQPSKKKYYYSLVTEIDQELVAAIQPYLADVSPDKPADVRKVHQNSAGSFL 196

Query: 97  -----LDSQ----------------LGLGSSAAITVAITAA-LLTLQYHKEPSPDE---- 130
                L SQ                 GLGSSA I V ++AA LL L+    P PD+    
Sbjct: 197 YMFLSLGSQSFPACQYTLRSTIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHPDQPPEE 256

Query: 131 -------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE---KIDFIFP-IH 179
                  I   A+   + + G  SG+D   S  G  + +Q   YS     K  + FP + 
Sbjct: 257 ARMQIERINRWAYVYEMFIHGNPSGVDNTVSTQGKAVMFQRTDYSKAPDVKPLWDFPELP 316

Query: 180 LIYSGYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL--------R 229
           L+    +TP  TA  + K+  ++  +P   ++   I   + K++Q S + +        +
Sbjct: 317 LLLVDTRTPKSTAHEVAKVGRLKDTHP---KLVGSILDAIDKVTQTSAELIAEDDFSTEK 373

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             +L+ + + MN   GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 374 EDSLRRVGELMNINHGLLVSLGVSHPRL-ERVRELVDHQGIGWTKLTGAGGGGCSITL 430


>gi|268323167|emb|CBH36755.1| mevalonate kinase [uncultured archaeon]
          Length = 351

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 145/305 (47%), Gaps = 36/305 (11%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID-SSLGQYCGSL 64
            K+ VS P  ++L GEH V++G  AL  AIN+R+ + ++ R++   ++   ++  +   L
Sbjct: 3   KKVRVSVPAKVILFGEHFVVYGKRALATAINQRLAVNVSDREEDGYHVKIENIPTFGLEL 62

Query: 65  DL------AMFHPSFSFIIMAINHIKPSCGF------------DLKVISQLDSQLGLGSS 106
           DL      A  +  +     A+ ++K S G+            ++++ S++    GLGSS
Sbjct: 63  DLEGGARRAYPYKDYGSATKAVAYVKESIGYLEERYGLSGGGVEIEIKSEIPLSAGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---Q 163
           AA  VA  AAL    +      + I   A+ + L +QG +S ID A S +GG +     +
Sbjct: 123 AATCVATIAALKEY-FGLSGDLEAIRNDAYHVELTIQGAASPIDTAISTYGGYVLIERNE 181

Query: 164 MPKYSIEKIDFI------FPIHLIYSGYKTPTAQVLKK---ISYIEIEYPEINEINQKIY 214
           + +  +  +D I       P+++   G K  +   LK    +  ++      + I   I+
Sbjct: 182 VKRLPLAGLDLIVGCIGSIPLNM---GTKKASEIGLKTKRVVEEVKKRKENFSAIFDYIF 238

Query: 215 ALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASK 274
               +++  + +A+  K+   L   M    GLL+ +GV   +LSE+V K+ +    + +K
Sbjct: 239 DAADEITAQAIKAIEAKDFVNLGALMYINHGLLDAIGVVPGRLSELV-KVSQALGALGAK 297

Query: 275 ISGSG 279
           ++G+G
Sbjct: 298 VTGAG 302


>gi|191638031|ref|YP_001987197.1| Phosphomevalonate kinase [Lactobacillus casei BL23]
 gi|227535428|ref|ZP_03965477.1| phosphomevalonate kinase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|301066141|ref|YP_003788164.1| phosphomevalonate kinase [Lactobacillus casei str. Zhang]
 gi|190712333|emb|CAQ66339.1| Phosphomevalonate kinase [Lactobacillus casei BL23]
 gi|227186911|gb|EEI66978.1| phosphomevalonate kinase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|300438548|gb|ADK18314.1| Phosphomevalonate kinase [Lactobacillus casei str. Zhang]
 gi|327382113|gb|AEA53589.1| Phosphomevalonate kinase [Lactobacillus casei LC2W]
 gi|327385255|gb|AEA56729.1| Phosphomevalonate kinase [Lactobacillus casei BD-II]
          Length = 357

 Score = 76.3 bits (186), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 148/333 (44%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 2   ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 61

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 62  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELDKPLALYKLYIDSQLDAKDGKKYGLGS 119

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-- 163
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y+  
Sbjct: 120 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 178

Query: 164 ---------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                                 P+ SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 179 DKAWLAAARNQMSLADLINTDWPELSIELLTAPADMQLLVGWTGSPASTSQLVDKITLAK 238

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++      + A    L ++     RN++L  +   + R + LL+ L       +  
Sbjct: 239 AKKPQL--YRDFLTASRETLEKL-IDGFRNRSLSSIQAGIRRNRELLDELAHFSGVAIQT 295

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V +L EQ    A+K SG+G GDC I L
Sbjct: 296 PALRQLV-ELAEQAG-GAAKSSGAGGGDCGIVL 326


>gi|119719800|ref|YP_920295.1| mevalonate kinase [Thermofilum pendens Hrk 5]
 gi|119524920|gb|ABL78292.1| mevalonate kinase [Thermofilum pendens Hrk 5]
          Length = 322

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 135/286 (47%), Gaps = 14/286 (4%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRV-ILYLTLRKDRLINIDSSLG---QYCGSLDL 66
           SAP  ++L GEH V+ G  A+  AI+ R  +       D ++    +LG   +Y  +   
Sbjct: 7   SAPAKVILFGEHFVVEGQPAIAAAISLRAHVTVEPADTDGILVYSKNLGLLEEYRFAERG 66

Query: 67  AMFHPSFSFII---MAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
           A      S  I    A+  +    G  + V S++    G+GSSAA+ VA T A     + 
Sbjct: 67  AWSGKMLSIAIAAYTAMESLGRKSGVKVTVDSEIPPGSGMGSSAAVAVATTHATFR-AFG 125

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
           +EP   E+   A      V G  SGID   + +GG+I Y+  +  I     +  + L+  
Sbjct: 126 EEPDLKEVSRIAFEAEKVVHGKPSGIDNTVATYGGVIAYRKGEGFIPLKAELNGVRLVLA 185

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            SG    T +++K++  ++  YP + E    +Y   G+L   + + L   + + L + MN
Sbjct: 186 DSGVPRNTGEMVKRVLELKNTYPSVLE---PLYHAAGRLVVEAARRLEEGDYESLGRLMN 242

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              G L  +GVS  +L ++V+  R +   + SK++G+G G  ++AL
Sbjct: 243 VNHGFLSAIGVSTLELEKLVYTAR-RAGALGSKLTGAGGGGFIVAL 287


>gi|261402466|ref|YP_003246690.1| mevalonate kinase [Methanocaldococcus vulcanius M7]
 gi|261369459|gb|ACX72208.1| mevalonate kinase [Methanocaldococcus vulcanius M7]
          Length = 315

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 139/300 (46%), Gaps = 36/300 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDL 66
           +  P  ++L GEH V++G+ A+  AIN    + +  ++  ++ +   D +  Q      +
Sbjct: 3   IKTPSKVILFGEHAVVYGYRAVSIAINLMSTVEIVKKEGNMVRLNLLDLNKAQNFDLDSI 62

Query: 67  AMFHPS-------FSFIIMAINH------IKPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
              +PS       F + + AI +      I P+ GF+L + S++    GLGSSA+IT+  
Sbjct: 63  YNLNPSTYNKFDDFKYCLCAIKNTLNYCKINPNFGFELNISSKIPVSCGLGSSASITIGT 122

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI---E 170
             A+    Y KE   + I    + +  ++QG +S  D +   + G++  +  K+     E
Sbjct: 123 IKAISKF-YEKELDNENIANIGYLVEKEIQGKASITDTSTITYKGILEIKNNKFKKIKGE 181

Query: 171 KIDFI--FPIHLIYS-GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
             DF+      ++Y+   K  TA+++ +++ IE +     EI++ I            +A
Sbjct: 182 FEDFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIN-----------EA 230

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L+  N +   + M +   LL+ L +S  KL  IV           +K++G+G G CVI L
Sbjct: 231 LKTNNKEDFGKLMAKNHNLLKKLNISTPKLDRIVDIGNRLG--FGAKLTGAGGGGCVIIL 288


>gi|116494593|ref|YP_806327.1| phosphomevalonate kinase [Lactobacillus casei ATCC 334]
 gi|239631803|ref|ZP_04674834.1| phosphomevalonate kinase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|116104743|gb|ABJ69885.1| phosphomevalonate kinase [Lactobacillus casei ATCC 334]
 gi|239526268|gb|EEQ65269.1| phosphomevalonate kinase [Lactobacillus paracasei subsp. paracasei
           8700:2]
          Length = 357

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/333 (28%), Positives = 147/333 (44%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 2   ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 61

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 62  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELDKPLALYKLYIDSQLDAKDGKKYGLGS 119

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-- 163
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y+  
Sbjct: 120 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 178

Query: 164 ---------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                                 P  SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 179 DKAWLAAARNQMSLADLINTDWPDLSIELLTAPADMQLLVGWTGSPASTSQLVDKITLAK 238

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++      + A    L ++     RN++L  +   + R + LL+ L       +  
Sbjct: 239 AKKPQL--YRDFLTASRETLEKL-IDGFRNRSLSSIQAGIRRNRELLDELAHFSGVAIQT 295

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V +L EQ    A+K SG+G GDC I L
Sbjct: 296 PALRQLV-ELAEQAG-GAAKSSGAGGGDCGIVL 326


>gi|258566616|ref|XP_002584052.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237905498|gb|EEP79899.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 494

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 156/383 (40%), Gaps = 80/383 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKDRL--------INIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+   I+ R  +L  TL K R         IN+D +    
Sbjct: 51  VSAPGKVIVFGEHAVVHGKQAMAAVISLRSYLLVTTLSKSRRTVTLNFRDINLDHTWD-- 108

Query: 61  CGSLDLAMFH-PS---FSFIIMA-------------INHIKPSCGFDLKVISQLDSQL-- 101
             SL   +FH PS   F +  +              I+++ P    D++ + Q  +    
Sbjct: 109 IDSLPWDLFHHPSKKKFYYDRVTCLDPDLLEALQPHISNVSPDQPPDVRKVHQGSANAFL 168

Query: 102 --------------------------GLGSSAAITVAITAALL-TLQYHKEPSPDEILTT 134
                                     GLGSSA++ V ++AALL  ++    P PD+    
Sbjct: 169 YLYLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDE 228

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FP 177
           +   + ++            G  SG+D   S  G  + ++   YS     +  +DF   P
Sbjct: 229 SEVQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVVPILDFPELP 288

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+  ++  +P I E     I+Q   +    LS        ++ 
Sbjct: 289 LLLVNSRQPRSTATEVAKVGALKEAHPAITEALLDGIDQVTSSAYEFLSSKRFSKDSSEA 348

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L  L        GLL +LGVS  +L E V +L +   I  SK++G+G G C I L   + 
Sbjct: 349 LDYLGTLFRINHGLLVSLGVSHPRL-ERVRELVDHNGIGWSKLTGAGGGGCTITLVGANR 407

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            S   + +   +  +G D+   T
Sbjct: 408 QSAALKRLEAQLAEEGYDLFETT 430


>gi|292656879|ref|YP_003536776.1| mevalonate kinase [Haloferax volcanii DS2]
 gi|291370856|gb|ADE03083.1| mevalonate kinase [Haloferax volcanii DS2]
          Length = 367

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 136/306 (44%), Gaps = 34/306 (11%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD---RLINIDSSLG----QYCGS 63
           SAPG + L GEH V++G  A+  A+ +R  + ++ R D   R+   D SL     +Y GS
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAVERRATVTVSARDDDHVRVRAEDLSLNGFTVEYRGS 64

Query: 64  -------------LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
                        ++ AM +   +          P  GFD+ V S +    GLGSSAA+ 
Sbjct: 65  TRDRPDVDVPAPLVEAAMGYIDAAVDQARDAADAPDAGFDITVESDIPLGAGLGSSAAVV 124

Query: 111 VA-ITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYS 168
           VA I AA   L    EP   E+   A+    +VQ G +S  D   S  GG +  ++    
Sbjct: 125 VAGIDAATRELGLELEPR--ELAERAYQAEHEVQDGQASRADTFCSAMGGAV--RVEGDD 180

Query: 169 IEKIDF-IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
              ID    P  + + G    T  ++  +  +  EY    +    +  ++ +  ++  +A
Sbjct: 181 CRTIDAPPLPFVIGFDGGAGDTGALVSGVRALREEYDFAADTVSTVGDIVRRGEELLAEA 240

Query: 228 LRNKN------LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLG 281
             + +      L  L + M+   GLLE LGVS   L  +VW  RE      +K++G+G G
Sbjct: 241 DPDADDPPEELLSELGRFMDFNHGLLEALGVSSRSLDSMVWAAREA-GAYGAKLTGAGGG 299

Query: 282 DCVIAL 287
            C+++L
Sbjct: 300 GCIVSL 305


>gi|18313828|ref|NP_560495.1| mevalonate kinase [Pyrobaculum aerophilum str. IM2]
 gi|18161390|gb|AAL64677.1| mevalonate kinase [Pyrobaculum aerophilum str. IM2]
          Length = 314

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 137/290 (47%), Gaps = 20/290 (6%)

Query: 13  PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID-----SSLGQYCGS--LD 65
           P ++ L GEH V++G  A+  AINK V  Y+   K   ++I+     S+L  Y G   ++
Sbjct: 7   PAAVKLFGEHAVVYGKPAISAAINKGV--YVECEKSDKLSIETAGYPSALRFYPGEGRVE 64

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL---TLQY 122
                  F++I  A+   +   G  L     + S+L  G+ AA + A++  LL    L  
Sbjct: 65  AVGAERFFAYINAALRLAEEKWG-GLAARFYIKSELPPGAGAATSAAVSIGLLKAYALCA 123

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IFPIHLI 181
             +    E+    H + L+VQGI+S +D      GG++  +   +S++K++  + P ++ 
Sbjct: 124 GGDVEGIELAKMGHRVELEVQGIASPMDSTTVTLGGVLKIKTNPFSVDKLNANLPPFYIA 183

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           +      T ++++ +  +     E       +   +G++ + + Q L N++L+ + + M 
Sbjct: 184 FLPRFETTGEIVRGVKAL----LERRRSAAFVIEAIGRVVEEAEQCLLNRDLECVGELMG 239

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
               LL  LGV D +   ++   R  P I   KISG+G G  VI L + +
Sbjct: 240 INNWLLGALGVVDERAINLLNAAR--PFIYGGKISGAGRGGAVILLPRSE 287


>gi|149918166|ref|ZP_01906658.1| mevalonate kinase [Plesiocystis pacifica SIR-1]
 gi|149820926|gb|EDM80333.1| mevalonate kinase [Plesiocystis pacifica SIR-1]
          Length = 320

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 131/281 (46%), Gaps = 16/281 (5%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF---- 69
           G ++L+GEH V++GH AL   +++ +IL       R   ++ S+  +   LDL +     
Sbjct: 13  GKIILLGEHSVVYGHPALAAGLSRGLILRARPLDGRGGAMELSIPAW--DLDLRLTADSE 70

Query: 70  HPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           HP     +  + +   P  G+ ++  +++ ++ GLGSSAA++VA+  A L L      + 
Sbjct: 71  HPVARACLEVLAYCDGPVTGWRIEGEAKIPARAGLGSSAALSVAL--ARLALPEADARTV 128

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYK 186
           + ++  + A      G  SGID   +  GG+I +   +  +E +    P+HL+   SG  
Sbjct: 129 ETVVAASMAGERVFHGDPSGIDSEVAARGGVIAFARGE-GVEAVRLRSPLHLVVVPSGIP 187

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T  ++  +      +P++ E    +   +G L      AL   +   LA+ +     L
Sbjct: 188 RQTGVLVAGVRARRDRFPQVIE---PVLEALGALVVRGRAALEAGDTAALAELIAVAHEL 244

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L  LGVS   L  +      +   + +K++G+G G C+ AL
Sbjct: 245 LGALGVSRPPLDALAAHAVGE-GALGAKLTGAGGGGCLFAL 284


>gi|320160996|ref|YP_004174220.1| mevalonate kinase [Anaerolinea thermophila UNI-1]
 gi|319994849|dbj|BAJ63620.1| mevalonate kinase [Anaerolinea thermophila UNI-1]
          Length = 313

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 135/299 (45%), Gaps = 27/299 (9%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAIN----KRVILYLTLRKDRLINIDSSLGQYCGS 63
           I  +APG ++L GEH V++G+ A+   +N    K +IL +   K   + I++        
Sbjct: 4   IFATAPGKIILFGEHAVVYGYPAIAVPVNQVRAKVLILPIPANKPDEVYIEAPDIHLNSH 63

Query: 64  LDLAMFHPSFSFI------IMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           L+   F      +      I+ ++++ P     +++ S +    GLGS AA++VA+  AL
Sbjct: 64  LNQLAFKDPLRIVIEEVQNILRLSYLPP---MRIRITSTIPVAAGLGSGAAVSVALARAL 120

Query: 118 LTLQYHKEPSPDE-ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFI 175
               Y   P PDE I   A        G  SGID     +   + +Q  K Y +  ++  
Sbjct: 121 --ANYLGHPLPDETICQIAFRAEHSYHGTPSGIDNTVITYNQPLFFQKGKPYELLGVEKP 178

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKN 232
           F I +  +G  +PT +V+ ++     + PE      K  AL  K+ QI   A   + + N
Sbjct: 179 FFIVIGNTGIASPTGEVVAEVRKNREQNPE------KYNALFEKIGQIVLYARKLIEHGN 232

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           +  L   +     LL+ +GVS  +L +I+ +         +K+SG G G  +IAL   +
Sbjct: 233 VVDLGSMLTENHCLLKEMGVSCKEL-DILVETAIHAGAYGAKLSGGGKGGNMIALASSE 290


>gi|20094429|ref|NP_614276.1| mevalonate kinase [Methanopyrus kandleri AV19]
 gi|19887513|gb|AAM02206.1| Mevalonate kinase [Methanopyrus kandleri AV19]
          Length = 328

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 128/282 (45%), Gaps = 37/282 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL--------- 57
           +I V AP   +L GEH V++G+ A+  A++  V +      D    +++ L         
Sbjct: 2   RISVKAPLKAILAGEHAVVYGYPAVAVALDTYVRVTAEPGDDSF-RVETELSCEGNVRAE 60

Query: 58  ----GQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFD-----LKVISQLDSQLGLGSSAA 108
               G   G    ++ H   +++  A+   K S  FD     L+++S+     GLG+SAA
Sbjct: 61  ITRDGNVKGFRSESL-HEELTYVATAVR--KASEEFDAPPSNLRILSEAPPASGLGTSAA 117

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           +T A+   L  +      S +EI      + L+VQG +S  D     +GG +     + S
Sbjct: 118 VTAAVLLGLAEVS-GVNVSREEIRRLVREVELEVQGKASWTDATVVTYGGFV-----RVS 171

Query: 169 IEKIDFIFPIH---LIYSGYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
             + + I P     L+ +  + P  T +++++++    E  E  +I   +  L+G+L   
Sbjct: 172 GREFELIEPERNPVLVVAHSQEPSRTGEMVRRVA----ELRERLDIVDGVMELIGELVDD 227

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLR 265
              ALR+ +L+ + + MN   GLL  L VS   L EIV   R
Sbjct: 228 LEAALRDGDLRTVGELMNANHGLLAALNVSTRALEEIVHVFR 269


>gi|325568465|ref|ZP_08144832.1| mevalonate kinase [Enterococcus casseliflavus ATCC 12755]
 gi|325158234|gb|EGC70387.1| mevalonate kinase [Enterococcus casseliflavus ATCC 12755]
          Length = 322

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 137/282 (48%), Gaps = 14/282 (4%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A G ++LMGEH V++G  A+ F     +V + +T  +   + I S    Y G L+    H
Sbjct: 20  ATGKIILMGEHSVVYGEPAIAFPFAGAKVQVEITANETSTL-ISS---YYHGLLEEVPSH 75

Query: 71  -PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
             +   ++  +     +  F   ++S + S+ G+GSSAA+ VA+T A       K+ + +
Sbjct: 76  LKNVKDLLHRLQQDFHTGPFATSIVSTIPSERGMGSSAAVAVALTRAFFDW-IKKDFTKE 134

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKT 187
           E++T  +       G  SGID AA+  G    Y +  + I         +L+   +G K 
Sbjct: 135 ELMTYVNFSEKIAHGNPSGID-AAAASGTDAIYFIKGHPITSFPLTIDGYLLVADTGIKG 193

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T + +K ++++   +    ++  +    +G  ++ + +A+    L+VL ++MN     L
Sbjct: 194 QTREAVKSVAHL---FETSKQLASQAIQRLGIETKKAKEAIIANQLEVLGESMNNAHQAL 250

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           + LGVS+ +L ++V  L        +K++G G G C+IAL K
Sbjct: 251 QQLGVSNQQLDQLV-SLALAHGAYGAKLTGGGRGGCMIALTK 291


>gi|156842079|ref|XP_001644409.1| hypothetical protein Kpol_1064p33 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115051|gb|EDO16551.1| hypothetical protein Kpol_1064p33 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 421

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 120/255 (47%), Gaps = 36/255 (14%)

Query: 62  GSLDLAM-FHPSFSFIIM------AINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           GSL  ++ FH +F FI +       +NH+K    F LK  S L    GLGSSA+I+VA++
Sbjct: 104 GSLKESLHFHAAFCFIYLYVCLCPNVNHVK----FSLK--STLPIGAGLGSSASISVALS 157

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLK---------VQGISSGIDLAASIHGGLICYQMP 165
            A+  L  H + +  E LT+A    +          + G  SGID A + +G  + ++  
Sbjct: 158 LAMAKLGGHIKST--ESLTSADKKYINSWSFIGEKCIHGTPSGIDNAVATYGNAVLFKKE 215

Query: 166 KYSIEKIDFI-----FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL 220
                   FI      P+ L Y+     T  ++  +  +  +YP    I + I   MG L
Sbjct: 216 DNGSTNFQFIDNFPKIPMILTYTRIPRSTKVLVSNVRELVEKYP---SIFKPILQSMGHL 272

Query: 221 SQISCQALRN---KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
           +      LRN   KN   L + +    GLL +LGVS   L EI+  L +   + ++K++G
Sbjct: 273 ANDGADILRNLNDKNYNDLLELVRVNHGLLVSLGVSHPGL-EIIKSLSDTMDLGSTKLTG 331

Query: 278 SGLGDCVIALGKGDL 292
           +G G C + + K D+
Sbjct: 332 AGGGGCSLTILKKDV 346


>gi|320100507|ref|YP_004176099.1| mevalonate kinase [Desulfurococcus mucosus DSM 2162]
 gi|319752859|gb|ADV64617.1| mevalonate kinase [Desulfurococcus mucosus DSM 2162]
          Length = 317

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 148/328 (45%), Gaps = 45/328 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT--LRKDRLINIDSSLGQYCGSLDL 66
           C  APG ++L GEH V+ G+ A+  A+     LY +  + K         LG    S  L
Sbjct: 3   CSIAPGKVILFGEHFVVEGYPAIGLAVG----LYASTCVEKGEFKIYSRQLGPIDPSSPL 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVI--SQLDSQLGLGSSAAITVAITAALL---TLQ 121
           A   P    +  A      +CG D  +   S +    G+GSSAA+ V++T +LL      
Sbjct: 59  A--KPFLRVLEEAAREF--NCGRDYTIYIDSGIPVGAGMGSSAAVNVSLTHSLLHACGAG 114

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP--IH 179
           + +E    ++   A+   ++V G  SGID   + +GGL+ Y+  + S +++D + P  + 
Sbjct: 115 FTRE----DVSRIAYMGEVEVHGKPSGIDNTLATYGGLVYYK--RGSFKRLDTLLPEGVE 168

Query: 180 LIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           L+   +G K  T  V++ +  +E +   +  +   +Y   G+L + +  ALR +++  L 
Sbjct: 169 LVVADTGVKRDTGVVVRDV--LE-KRRRLGRLGGILYEAAGELVEEALAALRERDVVRLG 225

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIM------ASKISGSGLGDCVIALGKGD 291
           + M    GLL ++G S        W      H M       +K+SG+G G  VI L +  
Sbjct: 226 ELMTVNHGLLFSMGAS-------AWVNDYLVHRMLGLGAYGAKLSGAGRGGIVIGLAE-- 276

Query: 292 LNSLPYQSVNCHMHAKGIDIVPITPSHS 319
                 Q++   +  +G+    + P + 
Sbjct: 277 --PARAQAIVEELEREGVKAYRVKPDYE 302


>gi|290890628|ref|ZP_06553699.1| hypothetical protein AWRIB429_1089 [Oenococcus oeni AWRIB429]
 gi|290479756|gb|EFD88409.1| hypothetical protein AWRIB429_1089 [Oenococcus oeni AWRIB429]
          Length = 306

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 135/284 (47%), Gaps = 32/284 (11%)

Query: 18  LMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL---GQYCGSLDLAMFHPS-- 72
           L+GEH V++G+ A++       +L LT  K  +I+ D+++     + GS+    +  S  
Sbjct: 14  LLGEHSVVYGYPAII-----APLLSLT-NKAEIIDSDTTVIETDNFSGSMYQLNYRFSGI 67

Query: 73  FSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL---LTLQYHKEPSP 128
           ++ ++  +N  + P   F L + S + S+ GLGSSAA  V+I  A       QY  E   
Sbjct: 68  YNLLVELLNFFESPDLTFKLHIKSNIPSKKGLGSSAAYAVSIVKAFCDYFDYQYTDE--- 124

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFIFPIHLIYSGYKT 187
            E+   A     K  G SSG D  A +  G I +   K  +I K+D    I +  SG   
Sbjct: 125 -EVFKFAQIAENKNHGKSSGGDTYAVMAEGPIFFDSNKDATILKLDTQAYIIIADSGTAG 183

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYA----LMGKLSQISCQALRNKNLKVLAQAMNRQ 243
            T+Q ++ ++       +  E N  +Y      MG+++    + +   +LK   Q MN  
Sbjct: 184 LTSQAVQLVA-------DNYEKNPTVYGGYLKRMGEIADKGREEIIADDLKDFGQLMNEN 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           Q LL  LGVS   L  ++ K+  +   + +K++G GLG  ++AL
Sbjct: 237 QLLLSKLGVSTPYLERLI-KITLKHGALGAKLTGGGLGGSIVAL 279


>gi|67526823|ref|XP_661473.1| hypothetical protein AN3869.2 [Aspergillus nidulans FGSC A4]
 gi|40739944|gb|EAA59134.1| hypothetical protein AN3869.2 [Aspergillus nidulans FGSC A4]
 gi|259481565|tpe|CBF75203.1| TPA: mevalonate kinase (AFU_orthologue; AFUA_4G07780) [Aspergillus
           nidulans FGSC A4]
          Length = 735

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 153/381 (40%), Gaps = 76/381 (19%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINI---DSSLGQYCG-- 62
           VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R I +   D++L       
Sbjct: 293 VSAPGKVIVYGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITLNFRDTNLNHTWDID 352

Query: 63  SLDLAMFH-PS----------------FSFIIMAINHIKPSCGFDLKVISQLDSQL---- 101
            L   +FH PS                +  I   +  I P    +++ I +  +      
Sbjct: 353 QLPWDLFHHPSKKKYYYDLVTTLDQELYDAIQPHVEDISPDAPEEMRKIHKRSASAFLYL 412

Query: 102 ------------------------GLGSSAAITVAITAALLT-LQYHKEPSPDEILTTAH 136
                                   GLGSSA++ V ++AALL  ++    P PD+    A 
Sbjct: 413 FLSLGSPQSAGAIYTLRSTIPIGAGLGSSASVCVCMSAALLVQIRTLAGPHPDQPPDEAE 472

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS----IEKIDFI--FPIH 179
             + ++            G  SG+D   S  G  + ++   YS    +  +      P+ 
Sbjct: 473 VQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTSLPTFPELPLL 532

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLK 234
           L+ +     TA  + K+  +  E+P + E     I+    +    + + + + L  K L+
Sbjct: 533 LVDTRQGRSTAVEVAKVGALRKEWPVVTESILDAIDNVTASAEKVIREPNPEGLSEKTLQ 592

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            L   +    G L +LGVS  +L  I  +L +   I  +K++G+G G C I L + DLN 
Sbjct: 593 QLGTLIRINHGFLVSLGVSHPRLERIR-ELVDYADIGWTKLTGAGGGGCAITLLRPDLND 651

Query: 295 LPYQSVNCHMHAKGIDIVPIT 315
              + +   +  +   I   T
Sbjct: 652 DSLRQLKSQLQDENFGIYETT 672


>gi|269123885|ref|YP_003306462.1| mevalonate kinase [Streptobacillus moniliformis DSM 12112]
 gi|268315211|gb|ACZ01585.1| mevalonate kinase [Streptobacillus moniliformis DSM 12112]
          Length = 276

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 134/285 (47%), Gaps = 46/285 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A G ++L GEH V++G  A+   +             + + I++ +       +    + 
Sbjct: 2   AYGKVILFGEHSVVYGKNAIALLL-------------KSVKIEADI-----VYEYVFENE 43

Query: 72  SFSFI---IMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              FI   I+  ++IK      +K+ S + S  GLGSSAA+ V+I  A       +    
Sbjct: 44  HVKFIKKNIIEKSNIKDRVY--IKIKSTIPSSRGLGSSAALAVSIAMAF----KKRYNIS 97

Query: 129 DEILTTAHAIVLKVQ----GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYS- 183
           DEI+ T   IV + +    G  SGIDLA   +   + +   K  I+ IDF     L+ S 
Sbjct: 98  DEIVKT---IVFEAEKWAHGNPSGIDLAVIFNNQNVLFN-KKEGIKNIDFHLNAKLVISD 153

Query: 184 -GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            G +  T    K +S +   Y +     +K    +GK++  +  AL+N +LK++   MN 
Sbjct: 154 SGIRGNTK---KAVSMVAKNYNKF----EKYIEDLGKITDDAIIALKNSDLKMVGNLMNL 206

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q  L+ + +S+  + E++   +E    + SKI+G+GLG C+I+L
Sbjct: 207 AQNNLKLMNLSNDMIDELINVSKENS--LGSKITGAGLGGCIISL 249


>gi|299783378|gb|ADJ41376.1| Phosphomevalonate kinase [Lactobacillus fermentum CECT 5716]
          Length = 260

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 96/179 (53%), Gaps = 26/179 (14%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINI------DSSLGQY 60
           I   APG L + GE+ V+ +G+ A++ A+N+ V   +T  KD +  I      D+SL Q+
Sbjct: 2   ITAKAPGKLYIAGEYAVVENGYPAILVALNQFVTCTITEAKDEVGQIISRQYHDNSL-QW 60

Query: 61  CGSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDSQ----LGLGS 105
               D  +       FS+I+ AIN        +    G +++++ SQLDSQ     GLGS
Sbjct: 61  RRRGDQMVVDKRDNPFSYILSAINVTEEFARSLNQRLGIYNIRIDSQLDSQSGKKYGLGS 120

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           SAA+TVA   AL   +Y++ P   E++    +I    VQG  S  D+AAS++GG I Y+
Sbjct: 121 SAAVTVATVKAL--CEYYQLPVNKEMIFKLSSIAHFDVQGNGSLGDVAASVYGGWIAYR 177


>gi|229542022|ref|ZP_04431082.1| mevalonate kinase [Bacillus coagulans 36D1]
 gi|229326442|gb|EEN92117.1| mevalonate kinase [Bacillus coagulans 36D1]
          Length = 314

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 130/286 (45%), Gaps = 17/286 (5%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA--M 68
           +A G L+L GEH V++G  A+    +   I    ++K   ++ID     Y G+LD A   
Sbjct: 12  TAHGKLILAGEHAVVYGQPAIALPFDHVKIETAVIQKQGPLSIDCRF--YKGALDKAPER 69

Query: 69  FHPSFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
            H   + +   +  + KP+    +K+ S +    GLGSSAA+ VAI   L    + K+ +
Sbjct: 70  LHGIRACVKEILRTLKKPAENLAIKLESTIPIGRGLGSSAAVAVAIVRGLYAF-FEKQLT 128

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             E+            G  SGID+ A I    I ++  K +   + F  P +L+   SG 
Sbjct: 129 KMELERFVQIAENFAHGNPSGIDMMAVISNDPIWFEKGK-AARPLPFSLPFYLVVADSGR 187

Query: 186 KTPTAQVLKKISYIEIEYPEINE--INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
              TA  +  I       P+  E  IN+     +G++   + +AL  K+   L +  N  
Sbjct: 188 VHNTAMAVGSIREKSGSDPKTVESAINR-----LGEIVHEAGRALIEKDGLHLGRLFNEA 242

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
              L  LGVSD  L+ +    R     + +K++G+G G C+I+L +
Sbjct: 243 HAQLSVLGVSDEGLNALCAAAR-SAGALGAKLTGAGRGGCIISLAE 287


>gi|328958131|ref|YP_004375517.1| mevalonate kinase [Carnobacterium sp. 17-4]
 gi|328674455|gb|AEB30501.1| mevalonate kinase [Carnobacterium sp. 17-4]
          Length = 314

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 127/288 (44%), Gaps = 27/288 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A G ++LMGEH V++G  A+        I       + L+ +D     Y G L  A  H 
Sbjct: 12  ANGKIILMGEHSVVYGEPAIAIPFPATHIHATITPIEGLVQLDCVY--YQGDLASAPQHL 69

Query: 72  S--FSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
               + +   +N +K     F L + S +  + G+GSSAA+ +A   A+    Y   P  
Sbjct: 70  ENLIAVVESTVNELKQELTNFKLTIESTIPVERGMGSSAAVAIATVRAV--FNYFSVPLT 127

Query: 129 DE-ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGY-- 185
           DE +LT A+       G  SG+D A      +   + P Y I+   F+ P +L  S Y  
Sbjct: 128 DEKLLTLANISETIAHGNPSGLDAA------MTSGRHPLYYIKGKPFV-PFNLSLSAYLI 180

Query: 186 ------KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
                 K  T   +  I+ +  E  E       I+ L G L++ +  A+ + N   L   
Sbjct: 181 VADTGLKGQTRDAVASIAQLNKENTETTM--DAIHHL-GDLARQAKFAIESANPVTLGLV 237

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           MN     L +LGVS+ +L+ +V   R     + +K++G G G C+IAL
Sbjct: 238 MNDAHETLSSLGVSNERLNHLVSTARTN-EALGAKLTGGGRGGCMIAL 284


>gi|284803255|ref|YP_003415120.1| hypothetical protein LM5578_3012 [Listeria monocytogenes 08-5578]
 gi|284996396|ref|YP_003418164.1| hypothetical protein LM5923_2961 [Listeria monocytogenes 08-5923]
 gi|284058817|gb|ADB69758.1| hypothetical protein LM5578_3012 [Listeria monocytogenes 08-5578]
 gi|284061863|gb|ADB72802.1| hypothetical protein LM5923_2961 [Listeria monocytogenes 08-5923]
          Length = 313

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 126/280 (45%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +  I    S   + G LD     P F  
Sbjct: 1   MILCGEHAVVYGEPAISVPFTQAVV---TTNVETSIKTKFSSAFFSGDLDDM---PDFLA 54

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 55  GIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 113

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 114 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 171

Query: 191 QVLKKISYIEIEYPEIN-EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  +++ Y E   EI + I+ L     +I      + +   +  AMN+ Q  LET
Sbjct: 172 ETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 231

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ K+        +K++G G G C+IA+ K
Sbjct: 232 LTVSDSSLEKLI-KVARSNGADGAKLTGGGRGGCIIAVAK 270


>gi|118586912|ref|ZP_01544345.1| mevalonate kinase [Oenococcus oeni ATCC BAA-1163]
 gi|118432639|gb|EAV39372.1| mevalonate kinase [Oenococcus oeni ATCC BAA-1163]
          Length = 306

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 133/284 (46%), Gaps = 32/284 (11%)

Query: 18  LMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS---SLGQYCGSLDLAMFHPS-- 72
           L+GEH V++G+ A++       +L LT  K  +I+ D+       + GS+    +  S  
Sbjct: 14  LLGEHSVVYGYPAII-----APLLSLT-NKAEIIDSDTIVIETDNFSGSMYQLNYRFSGI 67

Query: 73  FSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL---LTLQYHKEPSP 128
           ++ ++  +N  + P   F L V S + S+ GLGSSAA  V+I  A       QY  E   
Sbjct: 68  YNLLVELLNFFESPDLTFKLHVKSNIPSKKGLGSSAAYAVSIVKAFCDYFDYQYTDE--- 124

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFIFPIHLIYSGYKT 187
            E+   A     K  G SSG D  A +  G I +   K  +I K+D    I +  SG   
Sbjct: 125 -EVFKFAQIAENKNHGKSSGGDTYAVMAEGPIFFDSNKDATILKLDTQAYIIIADSGTAG 183

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYA----LMGKLSQISCQALRNKNLKVLAQAMNRQ 243
            T+Q ++ ++       +  E N  +Y      MG+++    + +   +LK   Q MN  
Sbjct: 184 LTSQAVQLVA-------DNYEKNPTVYGGYLKRMGEIADKGREEIIADDLKDFGQLMNEN 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           Q LL  LGVS   L  ++ K+  +   + +K++G GLG  ++AL
Sbjct: 237 QLLLSKLGVSTPYLERLI-KIALKHGALGAKLTGGGLGGSIVAL 279


>gi|257867122|ref|ZP_05646775.1| mevalonate kinase [Enterococcus casseliflavus EC30]
 gi|257873457|ref|ZP_05653110.1| mevalonate kinase [Enterococcus casseliflavus EC10]
 gi|257877201|ref|ZP_05656854.1| mevalonate kinase [Enterococcus casseliflavus EC20]
 gi|257801178|gb|EEV30108.1| mevalonate kinase [Enterococcus casseliflavus EC30]
 gi|257807621|gb|EEV36443.1| mevalonate kinase [Enterococcus casseliflavus EC10]
 gi|257811367|gb|EEV40187.1| mevalonate kinase [Enterococcus casseliflavus EC20]
          Length = 314

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 136/282 (48%), Gaps = 14/282 (4%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A G ++LMGEH V++G  A+ F     +V + +T  +   + I S    Y G L+    H
Sbjct: 12  ATGKIILMGEHSVVYGEPAIAFPFAGAKVQVEITANETNTL-ISS---YYHGLLEEVPSH 67

Query: 71  -PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
             +   ++  +     +  F   ++S + S+ G+GSSAA+ VA+T A       K+ + +
Sbjct: 68  LKNVKDLLHRLQQDFHTGPFATSIVSTIPSERGMGSSAAVAVALTRAFFDW-IKKDFTKE 126

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKT 187
           E++T  +       G  SGID AA+  G    Y +  + I         +L+   +G K 
Sbjct: 127 ELMTYVNFSEKIAHGNPSGID-AAAASGTDAIYFIKGHPITSFPLTIDGYLLVADTGIKG 185

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T + +K ++++   +    ++  +    +G  ++ + +A+    L++L ++MN     L
Sbjct: 186 QTREAVKSVAHL---FETSKQLASQAIQRLGIETKRAKEAIIANQLEILGESMNNAHQAL 242

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           + LGVS+ +L ++V           +K++G G G C+IAL K
Sbjct: 243 QQLGVSNQQLDQLVSSALAHG-AYGAKLTGGGRGGCMIALTK 283


>gi|289619064|emb|CBI54332.1| unnamed protein product [Sordaria macrospora]
          Length = 529

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 92/357 (25%), Positives = 152/357 (42%), Gaps = 80/357 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-TLRK--------------DRLIN 52
             VSAPG +++ GEH V+HG AA+  AI+ R  L + TL K              D   N
Sbjct: 81  FMVSAPGKVIVFGEHAVVHGKAAIAAAISLRSYLLVNTLSKSKRTVTLKFPDIEFDHSWN 140

Query: 53  IDS---------SLGQYCGSL-----------------DLAMFHP------------SFS 74
           ID             +Y  SL                 D+++  P            SF 
Sbjct: 141 IDELPWKIFQQPGKKKYYYSLVTEIDQELVDAVQPFLADVSIDKPADIRKVHQNSAGSFL 200

Query: 75  FIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEIL 132
           ++ +++     P C + L+  S +    GLGSSA I V ++AA LL L+    P PD+  
Sbjct: 201 YMFLSLGSQSFPGCQYTLR--STIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHPDQPP 258

Query: 133 TTAHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKY----SIEKI-DF-I 175
             A   + ++            G  SG+D   S  G  + +Q   Y    S+  + DF  
Sbjct: 259 EEARLQIERINRWAFVYEMFIHGNPSGVDNTVSTQGKAVVFQRTDYNQPPSVRPLWDFPK 318

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPE-----INEINQKIYALMGKLSQISCQALRN 230
            P+ L+ +     TA  + K++ ++ ++P+     +  I+Q  ++    + +        
Sbjct: 319 LPLLLVDTRTAKSTAHEVAKVATLKKKHPQLVGTILTAIDQVTHSSAQLIEEQGFNTEDE 378

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           ++L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 379 ESLSKVGEMMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITL 434


>gi|16802058|ref|NP_463543.1| hypothetical protein lmo0010 [Listeria monocytogenes EGD-e]
 gi|47097293|ref|ZP_00234851.1| mevalonate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|224503066|ref|ZP_03671373.1| hypothetical protein LmonFR_11186 [Listeria monocytogenes FSL
           R2-561]
 gi|254827435|ref|ZP_05232122.1| mevalonate kinase [Listeria monocytogenes FSL N3-165]
 gi|254830697|ref|ZP_05235352.1| hypothetical protein Lmon1_05034 [Listeria monocytogenes 10403S]
 gi|254899675|ref|ZP_05259599.1| hypothetical protein LmonJ_07676 [Listeria monocytogenes J0161]
 gi|254913122|ref|ZP_05263134.1| mevalonate kinase [Listeria monocytogenes J2818]
 gi|254937503|ref|ZP_05269200.1| mevalonate kinase [Listeria monocytogenes F6900]
 gi|255025417|ref|ZP_05297403.1| hypothetical protein LmonocytFSL_02139 [Listeria monocytogenes FSL
           J2-003]
 gi|16409369|emb|CAC98225.1| lmo0010 [Listeria monocytogenes EGD-e]
 gi|21328239|gb|AAM48486.1| putative mevalonate kinase [Listeria monocytogenes]
 gi|47014338|gb|EAL05313.1| mevalonate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|258599812|gb|EEW13137.1| mevalonate kinase [Listeria monocytogenes FSL N3-165]
 gi|258610104|gb|EEW22712.1| mevalonate kinase [Listeria monocytogenes F6900]
 gi|293591123|gb|EFF99457.1| mevalonate kinase [Listeria monocytogenes J2818]
          Length = 322

 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 126/280 (45%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +  I    S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVETSIKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEIN-EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  +++ Y E   EI + I+ L     +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ K+        +K++G G G C+IA+ K
Sbjct: 241 LTVSDSSLEKLI-KVARSNGADGAKLTGGGRGGCIIAVAK 279


>gi|116206428|ref|XP_001229023.1| hypothetical protein CHGG_02507 [Chaetomium globosum CBS 148.51]
 gi|88183104|gb|EAQ90572.1| hypothetical protein CHGG_02507 [Chaetomium globosum CBS 148.51]
          Length = 532

 Score = 72.8 bits (177), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 100/386 (25%), Positives = 158/386 (40%), Gaps = 86/386 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRK--------------DRLINID 54
           VSAPG +++ GEH V+HG AA+  AI+ R  +L  TL K              D   NID
Sbjct: 88  VSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLLVTTLSKSKRTVTLKFPDIDFDHCWNID 147

Query: 55  S---------SLGQYCGSL--------------DLAMFHP---------------SFSFI 76
                     S  +Y  SL               LA   P               SF ++
Sbjct: 148 ELPWATFQQPSKKKYYYSLVTELDPELVAAIQPFLANVSPDKPAGIRKVHQNSAGSFLYM 207

Query: 77  IMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDE---- 130
            +++     P C + L+  S +    GLGSSA I V ++AA LL L+    P PD+    
Sbjct: 208 FLSLGSQSFPGCQYTLR--STIPIGAGLGSSATIAVCMSAALLLQLRTLAGPHPDQPADE 265

Query: 131 -------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY----SIEKI-DFI-FP 177
                  I   A+   + + G  SG+D   +  G  + +Q   Y    S+  + DF   P
Sbjct: 266 ARMQIERINRWAYVYEMFIHGNPSGVDNTVATQGKAVVFQRTDYGKPPSVRPLWDFPELP 325

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           + L+ +     TA  + K+  ++  +P    +   I   M K++  S + L  +     +
Sbjct: 326 LLLVDTRVPKSTAHEVAKVGKLKNTHP---VLVGSILDAMDKVADASAEVLTEEGFDTQS 382

Query: 238 QA--------MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +A        M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L K
Sbjct: 383 EASLARVGELMTVNHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCCITLLK 441

Query: 290 GDLNSLPYQSVNCHMHAKGIDIVPIT 315
             +     + +   +  +G +    T
Sbjct: 442 PGVERKKLRKLQAQLDEEGFEKFETT 467


>gi|116491120|ref|YP_810664.1| mevalonate kinase [Oenococcus oeni PSU-1]
 gi|116091845|gb|ABJ56999.1| mevalonate kinase [Oenococcus oeni PSU-1]
          Length = 306

 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 135/284 (47%), Gaps = 32/284 (11%)

Query: 18  LMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL---GQYCGSLDLAMFHPS-- 72
           L+GEH V++G+ A++       +L LT  K  +I+ D+++     + GS+    +  S  
Sbjct: 14  LLGEHSVVYGYPAII-----APLLSLT-NKAEIIDSDTTVIETDNFSGSMYQLNYRFSGI 67

Query: 73  FSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL---LTLQYHKEPSP 128
           ++ ++  +N  + P   F L V S + S+ GLGSSAA  V+I  A       QY  E   
Sbjct: 68  YNLLVELLNFFESPDLTFKLHVKSNIPSKKGLGSSAAYAVSIVKAFCDYFDYQYTDE--- 124

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFIFPIHLIYSGYKT 187
            E+   A     K  G SSG D  A +  G I +   K  +I K++    I +  SG   
Sbjct: 125 -EVFKFAQIAENKNHGKSSGGDTYAVMAEGPIFFDSNKDATILKLNTQAYIIIADSGTAG 183

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYA----LMGKLSQISCQALRNKNLKVLAQAMNRQ 243
            T+Q ++ ++       +  E N  +Y      MG+++    + +   +LK   Q MN  
Sbjct: 184 LTSQAVQLVA-------DNYEKNPTVYGGYLKRMGEIADKGREEIIADDLKDFGQLMNEN 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           Q LL  LGVS   L  ++ K+  +   + +K++G GLG  ++AL
Sbjct: 237 QLLLSKLGVSTPYLERLI-KITLKHGALGAKLTGGGLGGSIVAL 279


>gi|255030187|ref|ZP_05302138.1| hypothetical protein LmonL_15876 [Listeria monocytogenes LO28]
          Length = 299

 Score = 72.4 bits (176), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 126/280 (45%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +  I    S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVETSIKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEIN-EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  +++ Y E   EI + I+ L     +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ K+        +K++G G G C+IA+ K
Sbjct: 241 LTVSDSSLEKLI-KVARSNGADGAKLTGGGRGGCIIAVAK 279


>gi|81428519|ref|YP_395519.1| mevalonate kinase [Lactobacillus sakei subsp. sakei 23K]
 gi|78610161|emb|CAI55210.1| Mevalonate kinase [Lactobacillus sakei subsp. sakei 23K]
          Length = 315

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 135/293 (46%), Gaps = 29/293 (9%)

Query: 16  LVLMGEHGVLHGHAAL---VFAINK--RVILYLTLRKDRLIN-------IDSSLGQYCGS 63
           ++L+GEH V++G  A+   +FA+    RV    TL  + LIN       +  ++GQ  G 
Sbjct: 12  IILIGEHAVVYGQPAIALPIFAVQTTVRVTAQPTL-SEPLINSPYYSGLLSQAIGQMQGI 70

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
             L           +          F+L + S+L ++ G+GSSAA  +AI  AL T  YH
Sbjct: 71  RRL--------IEQLWQQLDDQQTAFELTIESELPAERGMGSSAATAIAIIRALFTF-YH 121

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
           +E +  ++L  A      + G  SGID AA+       + +    ++ +      +L+  
Sbjct: 122 QELNQRDLLKLAALSENMIHGNPSGID-AATTGATTPLWFVKGQPLQPLPIDLQGYLVIA 180

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            SG K  T   +K +    +  P   E  Q +   +G+LSQ     +    L  L Q ++
Sbjct: 181 DSGQKGQTGPAVKSVQNQMMSNP---ERTQPLITHIGELSQAVATNIAQNQLTALGQNLS 237

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
             Q  L  LGVS+S++  ++ +   Q   + +K++G G G C+IAL K   N+
Sbjct: 238 LAQDDLRALGVSNSRIDALI-ETANQAGSLGTKLTGGGRGGCIIALAKTQTNA 289


>gi|219852948|ref|YP_002467380.1| mevalonate kinase [Methanosphaerula palustris E1-9c]
 gi|219547207|gb|ACL17657.1| mevalonate kinase [Methanosphaerula palustris E1-9c]
          Length = 289

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 139/293 (47%), Gaps = 54/293 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPG + L GEH V++G   L  AI  RV  ++T+RK+R                  
Sbjct: 2   VTWSAPGKVFLFGEHAVVYGKPGLAMAIKPRV--FVTVRKNR------------------ 41

Query: 68  MFHPSFS--------FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
             HP+ +        F  M +          + V SQ+ S  GLGSSAA+TVA  +A + 
Sbjct: 42  --HPTPAKSPYIDGCFKAMGVTG-------SVYVNSQMPSSSGLGSSAAVTVATLSA-IN 91

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLIC---YQMPKYSIEKIDFI 175
            ++  + + +EI  TA+ I   VQ G +S  D   S  GG++        K   + ++ +
Sbjct: 92  DEFDLDRTREEIALTAYQIERAVQKGRASPTDTYVSTIGGMVLITGQSRRKIPPQNLNLV 151

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-KNLK 234
               L+       TA++++ ++  + ++P++      +  +M  +  ++  A+RN  N +
Sbjct: 152 VGNTLVSHS----TAKMVELVAEGQRKFPDV------MNPVMEAMGALTLSAVRNLSNPR 201

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            L Q MN  + LLE LGV    LS++V   R       +K++G+G G C+IAL
Sbjct: 202 QLGQLMNINEALLEVLGVGHPTLSKLVIASRNA-GAFGAKLTGAGGGGCMIAL 253


>gi|19113749|ref|NP_592837.1| mevalonate kinase Erg12 (predicted) [Schizosaccharomyces pombe
           972h-]
 gi|1170661|sp|Q09780|KIME_SCHPO RecName: Full=Putative mevalonate kinase; Short=MK
 gi|1008996|emb|CAA91104.1| mevalonate kinase Erg12 (predicted) [Schizosaccharomyces pombe]
 gi|2967444|dbj|BAA25169.1| putative mevalonate kinase [Schizosaccharomyces pombe]
          Length = 404

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 145/336 (43%), Gaps = 63/336 (18%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-------------VILYLTLRKDRLINIDS- 55
           VS+PG  +L GEH V++G  AL  A++ R             VI+   +  +R  N+ S 
Sbjct: 7   VSSPGKTILFGEHAVVYGATALAAAVSLRSYCKLQTTNNNEIVIVMSDIGTERRWNLQSL 66

Query: 56  -----------------------SLGQYCGSLDLAMFHPSFSFIIMAINHIK-PSCGFDL 91
                                   LG+   + +  + H +    +     +  PS G  L
Sbjct: 67  PWQHVTVENVQHPASSPNLDLLQGLGELLKNEENGLIHSAMLCTLYLFTSLSSPSQGCTL 126

Query: 92  KVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVL----------K 141
            + SQ+    GLGSSA I+V +  +LL    + EP     L    A+ L           
Sbjct: 127 TISSQVPLGAGLGSSATISVVVATSLLLAFGNIEPPSSNSLQNNKALALIEAWSFLGECC 186

Query: 142 VQGISSGIDLAASIHGGLICYQMPKYSIEKI-DFIFP---IHLIYSGYKTP--TAQVLKK 195
           + G  SGID A + +GGLI ++        + +F+ P   + ++ +  K P  T ++++ 
Sbjct: 187 IHGTPSGIDNAVATNGGLIAFRKATAHQSAMKEFLKPKDTLSVMITDTKQPKSTKKLVQG 246

Query: 196 ISYIEIEYPEINEINQKIYALMG----KLSQISCQALRNKNLKVLAQAMNRQQGLLETLG 251
           +  ++   P +  I+  I A+ G     +  ++ ++ +N + K L + +   Q LLE LG
Sbjct: 247 VFELKERLPTV--IDSIIDAIDGISKSAVLALTSESDKNSSAKKLGEFIVLNQKLLECLG 304

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           VS   +  +   L+    I  +K++G+G G C I L
Sbjct: 305 VSHYSIDRV---LQATKSIGWTKLTGAGGGGCTITL 337


>gi|167042944|gb|ABZ07658.1| putative GHMP kinase ATP-binding protein [uncultured marine
           crenarchaeote HF4000_ANIW137N18]
          Length = 267

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 119/235 (50%), Gaps = 22/235 (9%)

Query: 69  FHPSFSFIIMA---INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
           F P   F+ +A   IN  +   G ++ + S +   +GLGSS+A  VA  A++  L   KE
Sbjct: 22  FRP---FVYLANKIINSDQNVSGLEITIDSDIPIGVGLGSSSACCVAAVASICGL--FKE 76

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGY 185
            S +EIL  +      +   +SG D A   +GG+I  + P  SIEKID  F ++L+ +  
Sbjct: 77  LSSEEILGMSIEAEKTIFPDTSGADCAVCTYGGMI--EHP--SIEKIDNTFDLNLLIANS 132

Query: 186 KTP--TAQVLKKISYIEIEYPEINEIN-QKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
             P  T   ++K++    ++ E +E    ++  L  KL      A++N +       M+ 
Sbjct: 133 MIPHNTKNSVEKVN----KFKENDEERFSQLCDLETKLIDEVITAMKNNDATTFGLKMSE 188

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD-LNSLP 296
            Q  LE + VS+  L  ++  L+E    + +KI+G+G G C+IAL K + ++ +P
Sbjct: 189 NQKYLEEIQVSNDTLRGMISSLKEIS--LGTKITGAGDGGCIIALVKNENMDKVP 241


>gi|39978123|ref|XP_370449.1| hypothetical protein MGG_06946 [Magnaporthe oryzae 70-15]
 gi|145013479|gb|EDJ98120.1| hypothetical protein MGG_06946 [Magnaporthe oryzae 70-15]
          Length = 494

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 158/365 (43%), Gaps = 86/365 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------N 52
             VSAPG +++ GEH V++G  A+  AIN R  L +T   +  R I             N
Sbjct: 47  FMVSAPGKVIVFGEHSVVYGKKAVAAAINLRSYLLVTALSKSKRTITLRFPDIDLIHTWN 106

Query: 53  ID----SSLGQ---------YCGSLD---LAMFHP----------------------SFS 74
           ID    S+  Q            SLD   +    P                      +F 
Sbjct: 107 IDDLPWSTFSQPSKKKYYYDLVTSLDPDLMDAIQPHLEPVSSDAPDAQRKVHMSAAAAFL 166

Query: 75  FIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL----TLQ-YHKEPSP 128
           ++ M++ +H  P   + L+  S +    GLGSSA+I+  ++AALL    TL   H +  P
Sbjct: 167 YLFMSLGSHAFPGGIYTLR--STIPIGAGLGSSASISACLSAALLLQIRTLSGPHPDQPP 224

Query: 129 DE-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI-----DFI- 175
           DE       I   A    + + G  SG+D   S  G  + +Q   Y+   +     DF  
Sbjct: 225 DEARVQVERINRWAFVAEMCIHGNPSGVDNTVSTQGKAVVFQRLDYARPPVVTPMWDFPE 284

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKN--- 232
            P+ ++ +     T   ++K++ +   +P+I  +N  I   M KL+Q +   L +++   
Sbjct: 285 LPLLVVDTKQAKSTKYEVEKVAKLRETHPKI--VNS-ILDSMDKLTQAATDVLTDEDFDN 341

Query: 233 -----LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
                L+ + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 342 EDVESLQKVGELMGMNHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITL 400

Query: 288 GKGDL 292
            + D+
Sbjct: 401 MRPDV 405


>gi|85014471|ref|XP_955731.1| mevalonate kinase [Encephalitozoon cuniculi GB-M1]
 gi|19171425|emb|CAD27150.1| MEVALONATE KINASE [Encephalitozoon cuniculi GB-M1]
          Length = 276

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 143/297 (48%), Gaps = 47/297 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---DRLINIDSSLGQYCGSLDLAM 68
           +P  ++L GEHGVL G   L  AI+  V  YL ++    ++ I ID++       +DL  
Sbjct: 7   SPLKVILFGEHGVLSGGRCLAVAID--VYGYLAMKSSSINKAIIIDTN----GNCVDL-- 58

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
                   I    +  P  GFD  +  +     GLG+SAAI+       L + Y K   P
Sbjct: 59  --------IEKYKYAIP--GFDAILFLETPLGCGLGTSAAIS-------LLMSYGKARGP 101

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ---MPKYSIEKIDFIFPIHLIYSGY 185
           + +L  A+A+     G SSG+D++    GGLI ++   + K S++ +   F I +  S  
Sbjct: 102 N-MLREAYAMENTFHGKSSGVDVSTCYSGGLISFKEGVVEKLSVDHLS-QFKILIFNSQI 159

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-RNKNLKVLAQAMNRQQ 244
              T   ++           + E+N+++Y  +GK+S+ +   L R   L  L + + + Q
Sbjct: 160 SKNTEAAVR-----------LGELNRELYDEIGKVSEEAYWLLQREFTLPELYKLIRKSQ 208

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN 301
            LL+ LGV   ++ ++V K+R+    + +KI+G+G G  ++ + K       ++SV+
Sbjct: 209 DLLDRLGVCPDEMRKVVSKMRKLG--IEAKITGAGCGGHLVTVVKKGQQIPGWRSVS 263


>gi|85102580|ref|XP_961360.1| hypothetical protein NCU03633 [Neurospora crassa OR74A]
 gi|12718384|emb|CAC28692.1| related to MEVALONATE KINASE [Neurospora crassa]
 gi|28922904|gb|EAA32124.1| hypothetical protein NCU03633 [Neurospora crassa OR74A]
 gi|206597121|dbj|BAG71665.1| mevalonate kinase [Neurospora crassa]
          Length = 528

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 93/360 (25%), Positives = 154/360 (42%), Gaps = 86/360 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-TLRKDRLI--------------N 52
             VSAPG +++ GEH V+HG AA+  AI+ R  L + TL K +                N
Sbjct: 80  FMVSAPGKVIVFGEHAVVHGKAAIAAAISLRSYLLVNTLSKSKRTVTLKFPDIDFNHSWN 139

Query: 53  IDS---------SLGQYCGSL-----------------DLAMFHP------------SFS 74
           ID             +Y  SL                 D+++  P            SF 
Sbjct: 140 IDELPWKIFQQPGKKKYYYSLVTEIDQELVDAVQPFLADVSIDKPADIRKVHQNSAGSFL 199

Query: 75  FIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEIL 132
           ++ +++     P C + L+  S +    GLGSSA I V ++AA LL L+    P PD+  
Sbjct: 200 YMFLSLGSQSFPGCQYTLR--STIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHPDQPP 257

Query: 133 TTAHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKY----SIEKI-DFI- 175
             A   + ++            G  SG+D   S  G  + +Q   Y    S+  + DF  
Sbjct: 258 EEARLQIERINRWAFVYEMFIHGNPSGVDNTVSTQGKAVVFQRTDYNQPPSVRPLWDFPK 317

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK---- 231
            P+ L+ +     TA  + K++ ++ ++P++      I   + +++Q S Q +  +    
Sbjct: 318 LPLLLVDTRTAKSTAHEVAKVATLKKKHPQLVGT---ILTAIDQVTQSSAQLIEEQGFNT 374

Query: 232 ----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               +L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 375 EDEESLSKVGEMMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITL 433


>gi|259503453|ref|ZP_05746355.1| phosphomevalonate kinase [Lactobacillus antri DSM 16041]
 gi|259168531|gb|EEW53026.1| phosphomevalonate kinase [Lactobacillus antri DSM 16041]
          Length = 377

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 89/346 (25%), Positives = 154/346 (44%), Gaps = 68/346 (19%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINIDSS-------LGQ 59
           I   APG L + GE+ V+ +G+ A++ A+++ V   +      +  I S        L +
Sbjct: 9   ITEKAPGKLYIAGEYAVVENGYPAVLVALDQFVTCTIKESAREMGQIFSQQYHNNQLLWR 68

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDSQ----LGLGSS 106
             G  + +      FS+I+ AI   +            +DL++ SQLDSQ     GLGSS
Sbjct: 69  RMGDQMVVDKRDNPFSYILSAIKVTEEYARQFERELRIYDLQIDSQLDSQNGRKYGLGSS 128

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--- 163
           AA+TVA   AL    Y+   S DEI   A     +VQG  S  D+AAS++GG I Y    
Sbjct: 129 AAVTVATVKALCRF-YNLPVSKDEIFKLAAIAHFEVQGNGSLGDVAASVYGGWISYHSFD 187

Query: 164 --------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIEI 201
                                P   IE +     + L+  ++G    T+Q++ KIS  + 
Sbjct: 188 RQWLAQQRQYLDIKSLVDLPWPDLQIESLHAPKNLQLLIGWTGKPASTSQLVDKISLFKA 247

Query: 202 -EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSD------ 254
            +  + +   ++  A + ++     +    ++L+ + Q +   + LL+ LG +       
Sbjct: 248 RQQDDYHRFLEESKACIQRM----VEGFHQQDLERIKQEIRYNRDLLKQLGTNSGVDIET 303

Query: 255 ---SKLSEIVWKLREQPHIMASKISGSGLGDC-VIALGK-GDLNSL 295
              ++L +I      +    A+K SG+G GDC ++A+ +  D N++
Sbjct: 304 PVLNRLCQIA-----EQFGGAAKTSGAGGGDCGIVAIDQNADFNAV 344


>gi|23097680|ref|NP_691146.1| mevalonate kinase [Oceanobacillus iheyensis HTE831]
 gi|22775903|dbj|BAC12181.1| mevalonate kinase [Oceanobacillus iheyensis HTE831]
          Length = 322

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 143/291 (49%), Gaps = 27/291 (9%)

Query: 16  LVLMGEHGVLHGHAALVFAIN----KRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           L+L+GEH V+HG  A+         + VI Y+       + +DSS   Y G L  A   P
Sbjct: 21  LILIGEHAVVHGQPAIAIPFPLIGVETVIEYVP----GTVKVDSSF--YHGPLHHA---P 71

Query: 72  SF-----SFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
            +     + +   + +++ P+    +++ S +    GLGSSA++ +++  +L      + 
Sbjct: 72  DYLQGIANCVDETLAYLEIPNEDLLIRINSSIPPGKGLGSSASVAISVIRSLFDYA-DRS 130

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--S 183
            + +E+L  A+       G  SG+D   +I   L  +    + ++ I+    +H I   S
Sbjct: 131 YTTEELLRLANVAETYAHGDPSGLD-TLTITSNLPVWFEKDHPVDYIELGEDLHFIVADS 189

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
           G    T   ++ ++ +    P+   I+ KI   +G+L+  +  AL   + + L Q +N  
Sbjct: 190 GRVGDTRTSVESVAQLLRMAPK--RIHAKI-ERIGELTHHAKDALEKASKQFLGQLLNEA 246

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
           Q  LE LGVSD+ L++++   RE+   + +K++G G G C+IAL + +++S
Sbjct: 247 QKELEALGVSDAGLNKLIHLAREEG-ALGAKLTGGGNGGCIIALAQNEVHS 296


>gi|134045303|ref|YP_001096789.1| mevalonate kinase [Methanococcus maripaludis C5]
 gi|132662928|gb|ABO34574.1| mevalonate kinase [Methanococcus maripaludis C5]
          Length = 317

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 41/275 (14%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLG---QYCG 62
           +  P  ++L GEH V+ G+ A+  A++ +    +    D     L++++       +   
Sbjct: 4   IKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTISIDLVDLNEIFEITPELIK 63

Query: 63  SLDLAMFHPSFSFIIMAIN-------------HIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           +L+++ F P+  ++I A+               IKP   F LK+ S++    GLGSSA++
Sbjct: 64  NLEISNFSPALKYVICAVKSVIFYLSEFKDLKEIKP---FKLKLYSEIPLSCGLGSSASV 120

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLI-----CYQ- 163
            V +  ++    Y  E   DE +  A+++  +VQG +S  D A    GG+I      Y+ 
Sbjct: 121 VVTVIRSISNF-YGIELDNDETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGEYKP 179

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
           MPK   E I     + +        TA+++  +S    ++PE  +I ++I  ++ K+ Q+
Sbjct: 180 MPKDLEEFIKTCKFLVVNVEERTRKTAELVHDVS----KHPEKEQIFEEIGNIIQKVRQV 235

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLS 258
           + +A        L + MN    LL   G+S  KL 
Sbjct: 236 TEKA-------ELGKLMNENHELLRKFGISTEKLD 263


>gi|199598322|ref|ZP_03211742.1| Phosphomevalonate kinase [Lactobacillus rhamnosus HN001]
 gi|258508056|ref|YP_003170807.1| phosphomevalonate kinase [Lactobacillus rhamnosus GG]
 gi|199590775|gb|EDY98861.1| Phosphomevalonate kinase [Lactobacillus rhamnosus HN001]
 gi|257147983|emb|CAR86956.1| Phosphomevalonate kinase [Lactobacillus rhamnosus GG]
 gi|259649378|dbj|BAI41540.1| phosphomevalonate kinase [Lactobacillus rhamnosus GG]
          Length = 357

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 2   ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 61

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 62  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELNKPLALYKLYIDSQLDAKDGKKYGLGS 119

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--- 162
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y   
Sbjct: 120 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 178

Query: 163 --------------------QMPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                               + P+ SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 179 DKAWLAAARNQMSLSALINAEWPELSIELLTAPADMQLLIGWTGSPASTSQLVDKITLAK 238

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++   +  + A    L ++     R  +L  +   + R + LL+ L       +  
Sbjct: 239 AKKPQL--YHDFLTASRETLEKL-IDGFREHSLSHIQAGIRRNRELLDELAHFSGVAIQT 295

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V  L EQ    A+K SG+G GDC I L
Sbjct: 296 PALRQLV-TLAEQAD-GAAKSSGAGGGDCGIVL 326


>gi|332797172|ref|YP_004458672.1| GHMP kinase [Acidianus hospitalis W1]
 gi|332694907|gb|AEE94374.1| GHMP kinase [Acidianus hospitalis W1]
          Length = 316

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 152/338 (44%), Gaps = 57/338 (16%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +SAPG ++ +G + V+ G  + V AINKRV    T   D+LI  +++ G +        +
Sbjct: 2   ISAPGKVLWIGSYAVVFGGLSHVIAINKRVKCEAT-PSDKLI-FETTYGTF--------Y 51

Query: 70  HPSFSFIIMAINHIKPSCG----FDLKVISQLDSQL-----GLGSSAAITVAITAALLTL 120
                 I   +N IK   G      +++ +  D Q+     GLGSS+A TV +TA L   
Sbjct: 52  EKGNELIESVVNVIKNHLGDIPRLKIRLFNDEDFQINGKKTGLGSSSAATVTLTACLYK- 110

Query: 121 QYHKEPSPDEI-LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-----KYSIEKIDF 174
           Q       DEI L    A  ++ +GI SG D+AA+++G +I  +        + IE++  
Sbjct: 111 QIKGRIDTDEIHLLAQEANFIRQKGIGSGFDIAAAVYGSIIYKRFTDLNKRDWKIERLRL 170

Query: 175 --IFPIHLIYSGYKTPTAQVLKKISYIE-------IEY-PEINEINQKIYAL--MGKLSQ 222
              + + L ++G  + T  ++K   +IE       IE+  EIN  N     L  +GK+ +
Sbjct: 171 GNKYDMILGFTGRSSETVNLVK--MFIEKKDDEKFIEFLREINIENDTAIKLLKLGKVDE 228

Query: 223 ISCQA-LRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQPHIMASKISGSGL 280
            S  A L    L V+A+         + +GV   S+  + + K+ E      S + G+G 
Sbjct: 229 ASQHAKLARDLLNVVAE---------DVIGVKLQSEEDKKLIKIAEDNGAYISLLPGAGG 279

Query: 281 GDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
           GD + ALG+          V      KG+ ++ I    
Sbjct: 280 GDVIFALGEN------LDEVRKKWKEKGLKLIEIKEDD 311


>gi|254167610|ref|ZP_04874461.1| mevalonate kinase [Aciduliprofundum boonei T469]
 gi|289596997|ref|YP_003483693.1| mevalonate kinase [Aciduliprofundum boonei T469]
 gi|197623419|gb|EDY35983.1| mevalonate kinase [Aciduliprofundum boonei T469]
 gi|289534784|gb|ADD09131.1| mevalonate kinase [Aciduliprofundum boonei T469]
          Length = 309

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 125/267 (46%), Gaps = 33/267 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
            SAP  ++L GEH V++G  A+  AIN R   Y+ ++K     ++             M 
Sbjct: 3   TSAPAKVILFGEHAVVYGEPAIAVAINLRT--YVKIKKSEEYRVNG----------YPMS 50

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
               S+I  AI         D++  S++ S  G+GSSA+ITVA+  ALL ++   E   +
Sbjct: 51  DKYHSYIKNAIKLCWDGEPLDIQTKSEVPSASGMGSSASITVAMLTALLAMK--DELKEE 108

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHG-GLICYQMPK----YSIEKIDFIFPIHLI--- 181
           +I      +  + QG +S ID +   HG G++ ++  K    + +EK +  + IH I   
Sbjct: 109 KIAKLGFEVEYRTQGSASPIDTSTVTHGKGILVHREKKDHFLWKVEKGELKWYIHHIEVP 168

Query: 182 -------YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
                  +SG K  T  ++ K+      +   N   + +   +GK++  + + L++++ +
Sbjct: 169 SLKLVVGFSGIKGSTKDMVNKVR----RFYNWNSFARDVIRDIGKITMEAIEPLQDEDYE 224

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIV 261
            + + MN    LL  LGV+   L  ++
Sbjct: 225 RIGELMNEDNKLLTILGVNHPMLKRMI 251


>gi|171186102|ref|YP_001795021.1| mevalonate kinase [Thermoproteus neutrophilus V24Sta]
 gi|170935314|gb|ACB40575.1| mevalonate kinase [Thermoproteus neutrophilus V24Sta]
          Length = 314

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 18/288 (6%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL----INIDSSLGQYCGSLD 65
           V APG + L GEH V++G  A+   I+K V +   +R +RL    +   +S+    G   
Sbjct: 4   VFAPGVIKLFGEHAVVYGKPAIAATIDKGVHVE-CVRGERLEVVTVAPPASVRYIPGERR 62

Query: 66  LAMF--HPSFSFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
              F     F+++  A+   +   G       + S L   +G  +SAA+ V +  A    
Sbjct: 63  FDAFGLERFFAYVDAALRVGEERWGSVSARFTITSDLPPSVGAATSAAVAVGLLKAYAAC 122

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP-IH 179
               +   +E+    H + L+VQGI+S +D AA   GG++      +  E+++   P ++
Sbjct: 123 A-GVDVGGEELAKLGHRVELEVQGIASPMDTAAVSIGGVLKIWASPFRAERLEVQLPQLY 181

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +     +  T +++  +  +    P    +   I A++ +     C  LR  +L  L + 
Sbjct: 182 VAVLPRRGTTGEIVADVRALLGRRPSARAVLDAIGAVVDEAE--VC--LRQGDLVCLGEL 237

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           M     LL  LGV DS+   ++  LR  P I   KISG+G G  V+ L
Sbjct: 238 MYINNWLLGALGVVDSRAVSLLETLR--PFIYGGKISGAGRGGVVLLL 283


>gi|329768010|ref|ZP_08259521.1| mevalonate kinase [Gemella haemolysans M341]
 gi|328838495|gb|EGF88103.1| mevalonate kinase [Gemella haemolysans M341]
          Length = 268

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 126/289 (43%), Gaps = 47/289 (16%)

Query: 17  VLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFI 76
           +  GEH V++G+  +   + +  +       D +   D  L                SFI
Sbjct: 7   IFFGEHAVVYGYKGITIPLPQMNVEVTLEETDTIQQRDEIL----------------SFI 50

Query: 77  IMAINHIKPSCGFDLKVISQLDSQL----GLGSSAAITVAITAALLTLQYHKEPSPDEIL 132
                    SCG D K    + S +    GLGSSAA+++AI  A       K P+  EI 
Sbjct: 51  -------ADSCGIDNKTKINITSTIPVGRGLGSSAALSIAIARA------KKLPNVREIA 97

Query: 133 TTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--IYSGYKTPTA 190
                 +    G  SGID+   +    + +   K    +++F    +L  I +G    T 
Sbjct: 98  NKCEKFI---HGNPSGIDVNQVLSDTPLLFS-KKDGASELNFNLNSYLLIIDTGVVGITK 153

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
           + LK I+   +EY       +K    +G ++ +  + L+NKN+ ++ Q M +   LL  L
Sbjct: 154 ETLKHIADNYVEY-------EKYITELGGITNLVIEPLKNKNIDLVGQYMYKAHDLLRKL 206

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
           GVS +   E+V ++ +  + + +K++G G G C I+L K   N+L  Q+
Sbjct: 207 GVSHASNDEVV-EICKNNNAIGAKLTGGGAGGCCISLSKTKENALEIQN 254


>gi|46123069|ref|XP_386088.1| hypothetical protein FG05912.1 [Gibberella zeae PH-1]
          Length = 508

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 161/378 (42%), Gaps = 86/378 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINI---DSSLGQYCGSL 64
           VSAPG +++ GEH V+HG AA+  AI+ R  L++T   +  R +++   D  L       
Sbjct: 63  VSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFADIGLVHTWNIE 122

Query: 65  DL---AMFHPS-----FSFI----------------IMAINHIK---------------- 84
           DL   A   PS     +S +                +++ NH +                
Sbjct: 123 DLPWEAFQQPSKKKSYYSLVTELDPDLVAAIQPHIEVVSPNHPEEIRRVHHSSVSAFLYL 182

Query: 85  ---------PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
                    P C + L+  S +    GLGSSA+++V + +A LL L+    P PD+    
Sbjct: 183 FLSLGSPSFPPCLYTLR--STIPIGAGLGSSASVSVCLASALLLQLRTLSGPHPDQPADE 240

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FP 177
           A   V ++            G  SG+D   +  G  + +Q   YS         DF   P
Sbjct: 241 ARLQVERINRWAFVSEMCIHGNPSGVDNTVATQGKAVVFQRTDYSKPPNVRPLWDFPELP 300

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN------- 230
           + L+ +     TA  + K++ ++  +P++  +N  I   M K++  + + +         
Sbjct: 301 LLLVDTRQAKSTAHEVAKVAKLKQTHPKL--VNS-ILDAMDKVTDAASELIEETSFDNGS 357

Query: 231 -KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            ++L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L +
Sbjct: 358 VEDLSKVGELMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITLLR 416

Query: 290 GDLNSLPYQSVNCHMHAK 307
            D+ +   Q +   +  +
Sbjct: 417 PDVPAEKLQKLEERLETE 434


>gi|304384906|ref|ZP_07367252.1| mevalonate kinase [Pediococcus acidilactici DSM 20284]
 gi|304329100|gb|EFL96320.1| mevalonate kinase [Pediococcus acidilactici DSM 20284]
          Length = 306

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 136/292 (46%), Gaps = 22/292 (7%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAIN--KRVILYLTLRKDRLINIDSSLGQYCG 62
           + ++  ++   ++LMGEH V++   A+   I   K  +   ++  D  I I S   +Y  
Sbjct: 1   MKEVIKTSNAKIILMGEHSVVYNQPAIALPIRNVKTTVKIQSIPGD--IQIRS---RYFN 55

Query: 63  SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
              L   H +   I   IN       KP  G  L + SQ+ ++ G+GSSA+  VAI  A+
Sbjct: 56  GF-LNDIHSNLLGIKQLINQTLTTLGKPHYGLLLDIDSQIPAERGMGSSASTAVAIVRAM 114

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
               + +  + +++L T +     + G  SG+D A +     I ++    +I+ +   F 
Sbjct: 115 YAF-FDRPLTKNKLLKTVNISEKIIHGNPSGLDSATASADRPIWFKRDG-TIKALPINFN 172

Query: 178 IHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
            +L+   SG K  T + +  +         I+  ++ +   +G+L+  +  AL++ +   
Sbjct: 173 GYLVISDSGIKGKTGEAVNIVK----NKLRIDNDSRLLIEKLGELTSQTATALKDDDSLA 228

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   MN  Q  L  LGVS   + +++ +   Q   + SK++G GLG CVI+L
Sbjct: 229 LGDIMNNAQACLRQLGVSHPAVEKLI-QAANQSGALGSKLTGGGLGGCVISL 279


>gi|229551902|ref|ZP_04440627.1| phosphomevalonate kinase [Lactobacillus rhamnosus LMS2-1]
 gi|229314719|gb|EEN80692.1| phosphomevalonate kinase [Lactobacillus rhamnosus LMS2-1]
          Length = 368

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 13  ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 72

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 73  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELNKPLALYKLYIDSQLDAKDGKKYGLGS 130

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--- 162
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y   
Sbjct: 131 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 189

Query: 163 --------------------QMPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                               + P+ SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 190 DKAWLAAARNQMSLSALINAEWPELSIELLTAPADMQLLIGWTGSPASTSQLVDKITLAK 249

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++   +  + A    L ++     R  +L  +   + R + LL+ L       +  
Sbjct: 250 AKKPQL--YHDFLTASRETLEKL-INGFREHSLSHIQAGIRRNRELLDELAHFSGVAIQT 306

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V  L EQ    A+K SG+G GDC I L
Sbjct: 307 PALRQLV-TLAEQAG-GAAKSSGAGGGDCGIVL 337


>gi|198433052|ref|XP_002131873.1| PREDICTED: similar to Mevalonate kinase (MK) [Ciona intestinalis]
          Length = 375

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 159/368 (43%), Gaps = 75/368 (20%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRV---------------ILYLTLRKD- 48
           + K+ VSAPG ++L GEH V+HG  A+  A++ R+               ++ L++R D 
Sbjct: 1   MKKVKVSAPGKIILHGEHAVVHGKRAIACAVDGRITVETTKTDETSLKFKMVALSMRNDI 60

Query: 49  --RLINID--SSLGQYCGSLDLAMFHPSF--------------SFIIMAINHIK---PSC 87
             +L +I+  +S  ++    +L     SF              +  I    ++K    S 
Sbjct: 61  HIKLTDIENLASSSKFNNEANLETNIKSFVEKNFENENKLLQIALTIFLFGYLKIFSKSN 120

Query: 88  GF---DLKVISQ-LDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI--------LTTA 135
            F   +++V SQ L    GLGSSAAI VA+  A L +    +P+ +++        L   
Sbjct: 121 NFLCLNIEVKSQNLPIGAGLGSSAAINVAMATAFLVMADQIQPTGNDMLLNEESLTLINE 180

Query: 136 HAIVLK--VQGISSGIDLAASIHGGLICYQ----MPKYSIEKIDFIFPIHLIYSGYKTPT 189
           HA +++  V G  SGID + + +GG   +Q        +  ++ F+     +    K   
Sbjct: 181 HAYLMEKIVHGNPSGIDNSVATYGGAASFQAGVITRLKNFPELRFLVTDTKVSRNTKALV 240

Query: 190 AQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           + V +K+S    +YPE        I+EI +    L+   ++      + K+L      + 
Sbjct: 241 SAVQEKLS----QYPETTGHILYAIDEICKTAEKLLANWNETENSQNQLKDL------LK 290

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN 301
               LL ++GV  +KL +I           A K++G+G G C I L     ++   +S+ 
Sbjct: 291 INHHLLNSIGVGHAKLDKI--HQLSNDFGFACKLTGAGGGGCAITLIDEGTDAQRVESLK 348

Query: 302 CHMHAKGI 309
             +H  G 
Sbjct: 349 QELHDNGF 356


>gi|150402505|ref|YP_001329799.1| mevalonate kinase [Methanococcus maripaludis C7]
 gi|150033535|gb|ABR65648.1| mevalonate kinase [Methanococcus maripaludis C7]
          Length = 317

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 129/276 (46%), Gaps = 41/276 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLG---QYC 61
            +  P  ++L GEH V+ G+ A+  A++ +    +    D     L++++       +  
Sbjct: 3   TIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTISIDLVDLNEIFEITPELI 62

Query: 62  GSLDLAMFHPSFSFIIMA-------------INHIKPSCGFDLKVISQLDSQLGLGSSAA 108
            +L+++ F P+  +++ A             +  IKP   F LK+ S++    GLGSSA+
Sbjct: 63  KNLEISNFSPALKYVLCAAKSTIYYLSEFKNLKEIKP---FKLKIYSEIPLSCGLGSSAS 119

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLI-----CYQ 163
           + V +  ++L+  Y  E   DE++  A+++  +VQG +S  D A    GG+I      Y+
Sbjct: 120 VVVTVIRSILSF-YKIELENDEVINLAYSVEKEVQGRASVTDTATISLGGMIEIVNGEYR 178

Query: 164 -MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            MP    E I     + +        TA+++ ++S    ++PE  +I ++I  ++  +  
Sbjct: 179 PMPNDLEEFIKTCRFLVVNVEERTRKTAELVHEVS----KHPEKEQIFEEIGKIISTVRW 234

Query: 223 ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLS 258
           +S ++        L + MN    LL+  G+S  KL 
Sbjct: 235 VSDKS-------ELGKLMNENHELLKKFGISTEKLD 263


>gi|258539323|ref|YP_003173822.1| phosphomevalonate kinase [Lactobacillus rhamnosus Lc 705]
 gi|257150999|emb|CAR89971.1| Phosphomevalonate kinase [Lactobacillus rhamnosus Lc 705]
          Length = 357

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 2   ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 61

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 62  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELNKPLALYKLYIDSQLDAKDGKKYGLGS 119

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--- 162
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y   
Sbjct: 120 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 178

Query: 163 --------------------QMPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                               + P+ SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 179 DKAWLAAARNQMSLSALINAEWPELSIELLTAPADMQLLIGWTGSPASTSQLVDKITLAK 238

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++   +  + A    L ++     R  +L  +   + R + LL+ L       +  
Sbjct: 239 AKKPQL--YHDFLTASRETLEKL-INGFREHSLSHIQAGIRRNRELLDELAHFSGVAIQT 295

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V  L EQ    A+K SG+G GDC I L
Sbjct: 296 PALRQLV-TLAEQAG-GAAKSSGAGGGDCGIVL 326


>gi|251782244|ref|YP_002996546.1| mevalonate kinase [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|242390873|dbj|BAH81332.1| mevalonate kinase [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
          Length = 292

 Score = 70.5 bits (171), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 136/285 (47%), Gaps = 38/285 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILMGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIY 182
            D++L     +V K + I+    SG+D    +    I + +   +   KID    + +  
Sbjct: 112 SDDLL---EILVNKAEIIAHTNPSGLDAKTCLSDHAIKFIRNIGFETIKIDLGAFLIIAD 168

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +G    T + + K++  E       E N    A +G+L++   QA+  K+ + + Q M +
Sbjct: 169 TGVHGHTREAVGKVAQFE-------ETNLPYLAKLGRLTEAVEQAITQKDNQTIGQLMTQ 221

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               L+ +GVS +K  ++V  +  +   + +K++G GLG C+IAL
Sbjct: 222 AHSALKAIGVSITKADQLV-DVALKAGALGAKMTGGGLGGCMIAL 265


>gi|218883445|ref|YP_002427827.1| mevalonate kinase [Desulfurococcus kamchatkensis 1221n]
 gi|218765061|gb|ACL10460.1| mevalonate kinase [Desulfurococcus kamchatkensis 1221n]
          Length = 316

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 148/310 (47%), Gaps = 30/310 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
           C  APG ++L GEH V+ G+ A+  A+    +   T  ++  + I S   +  G +D + 
Sbjct: 3   CSIAPGKIILFGEHFVVEGYPAIGLAVG---LYARTCVEEGDLKIYS---RQLGPIDPSS 56

Query: 69  FHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLT---LQYH 123
                   I+    I+  C   + + + S++    G+GSSAA+ V++  +LL    +++ 
Sbjct: 57  KEAKPYMRIIEEASIRYGCRDRYRIYIDSEIPVGAGMGSSAAVNVSLAHSLLETCGVEFT 116

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH---- 179
           KE    ++   A+     V G  SG+D   S +GGL+ Y+   +  ++++   P +    
Sbjct: 117 KE----DVSRIAYLGETMVHGKPSGVDNTLSTYGGLVYYRQGLF--KRLNTSLPENTALI 170

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +  +G K  T  V++++  +E  Y  +  + + IY + G+L + +  A+   ++  L + 
Sbjct: 171 VADTGVKRDTGLVVREV--LE-RYRRLGGLGKAIYEVAGRLVEEAAVAIEKGDVSRLGEL 227

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD-----LNS 294
           M    GLL  +G S      +V+K+        +K+SG+G G  VI + + +     + +
Sbjct: 228 MIVNHGLLFAMGASAWINDYLVYKMINN-GAQGAKLSGAGRGGIVIGIARLENTGKIMEA 286

Query: 295 LPYQSVNCHM 304
           L  + VN ++
Sbjct: 287 LKTEKVNAYL 296


>gi|301604944|ref|XP_002932110.1| PREDICTED: mevalonate kinase-like [Xenopus (Silurana) tropicalis]
          Length = 388

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 91/357 (25%), Positives = 150/357 (42%), Gaps = 75/357 (21%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQY 60
            ++ VSAPG ++L GEH V+HG  AL   +N R  + +   KD      L NI + L   
Sbjct: 5   RELFVSAPGKVILHGEHAVVHGKMALAVGLNLRTFIRIRPCKDDTVLINLPNIGTKL--- 61

Query: 61  CGSLDLAMFH---PSF------------------------SFIIMAINHIKPSCG----- 88
             S D++      PSF                        S  ++A  ++  S       
Sbjct: 62  --SWDVSQLQSLLPSFQDDPQNMEILKNFAGLTDGCKDTESLAVLAFLYLYLSISGRDLP 119

Query: 89  -FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-KEPSPDEILTT------------ 134
             D+ V SQL +  GLGSSAA  V + AA+LT      +P  +E  T+            
Sbjct: 120 SVDVVVWSQLPTGAGLGSSAAYCVCLAAAMLTYCGRIADPMREEAKTSRWSQTELDLINQ 179

Query: 135 -AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA--- 190
            A      + G  SG+D A    GG + YQ  +  I  I+ +  +H++ +  K P +   
Sbjct: 180 WAFQGEKVIHGNPSGVDNAVGTWGGALQYQSGR--ITPIERVPMLHILLTNTKVPRSTKV 237

Query: 191 -------QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
                  ++LK    IE     I+ I+Q+   ++ +++      L   +  VL + ++  
Sbjct: 238 LVAGVKEKLLKFPDIIEPVLSSIHAISQECQRVLKEMT----AGLSMDHYSVLEELIDIN 293

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           Q  L  +GV    L+ I     E+   + SK++G+G G C + L + D +    ++V
Sbjct: 294 QHHLNVIGVGHPSLNTICRVTAERG--LHSKLTGAGGGGCAVTLLRPDTDHTVVEAV 348


>gi|241896117|ref|ZP_04783413.1| mevalonate kinase [Weissella paramesenteroides ATCC 33313]
 gi|241870631|gb|EER74382.1| mevalonate kinase [Weissella paramesenteroides ATCC 33313]
          Length = 312

 Score = 70.1 bits (170), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 124/284 (43%), Gaps = 19/284 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-YCGSLDLAM---FHP 71
           ++L+GEH V++G  A+   +     L +T++ +        L Q Y G L +AM   +  
Sbjct: 13  VILLGEHAVVYGQPAIALPLTD---LAMTVKIESREAGQVVLSQSYQGPL-VAMAEVYEG 68

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
               I   + H K     F + + S +  + G+GSSAA  +AI  A     + +  S  E
Sbjct: 69  IRQLINRLLQHFKSDEMPFTMTITSNIPQERGMGSSAATAIAIVRAFFDF-FDESLSKQE 127

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICY---QMPKYSIEKIDFIFPIHLIYSGYKT 187
           +   A        G  SG+D A + H   + +   Q P    EKID      LI +    
Sbjct: 128 LQRWASIEEAITHGSPSGLDTATAAHDEAVWFIKGQQP----EKIDMSLDGTLILADTGI 183

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
              Q    IS +        E+ Q+    +G++ + + +A+   NL  +   MN  Q  L
Sbjct: 184 -QGQTGLAISVVREHLTNDPEVGQQHIDKIGEIVKATREAIAENNLAKIGHFMNEAQKHL 242

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             LG+S  KL E++   R     + +K++G G+G  +IA+ K D
Sbjct: 243 SALGISHPKLDELIMAAR-HAGALGAKLTGGGVGGTMIAITKDD 285


>gi|322411584|gb|EFY02492.1| mevalonate kinase [Streptococcus dysgalactiae subsp. dysgalactiae
           ATCC 27957]
          Length = 292

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 136/286 (47%), Gaps = 38/286 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILMGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLTFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    + H++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y ++  
Sbjct: 56  TLSTAIYAALDHLQHLEEPITYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YFQKSL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIY 182
           PDE+L     +V K + I+    SG+D    +    I + +   +   KID    + +  
Sbjct: 112 PDELLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKFIRNIGFETIKIDLGAFLIIAD 168

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +G    T + + K++  E       E N    A +G+L++   +A+  K+ + + Q M +
Sbjct: 169 TGVHGHTREAINKVAQFE-------ETNLPYLAKLGRLTEAVEKAITQKDNQAIGQLMTQ 221

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
               L+ +GVS +K  E+V    +    + +K++G GLG C+IAL 
Sbjct: 222 AHSTLKAIGVSIAKADELVGAALKAG-ALGAKMTGGGLGGCMIALA 266


>gi|290892048|ref|ZP_06555045.1| mevalonate kinase [Listeria monocytogenes FSL J2-071]
 gi|290558642|gb|EFD92159.1| mevalonate kinase [Listeria monocytogenes FSL J2-071]
          Length = 322

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 132/299 (44%), Gaps = 19/299 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +       S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVENSTKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +  + +  +++ Y +      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETREAVKDVQVLYKKNQAKIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           L VSDS L +++ ++        +K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 241 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK---NQEIAEQITKELHNAG 295


>gi|227529132|ref|ZP_03959181.1| phosphomevalonate kinase [Lactobacillus vaginalis ATCC 49540]
 gi|227350976|gb|EEJ41267.1| phosphomevalonate kinase [Lactobacillus vaginalis ATCC 49540]
          Length = 376

 Score = 69.7 bits (169), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 143/347 (41%), Gaps = 76/347 (21%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--- 63
           I   APG L + GE+ V+ +G+ A++ A+++ V   +      +  I S   QY  +   
Sbjct: 8   ITEKAPGKLYIAGEYAVVENGYPAILVALDQFVTCSIEESAAEVGKIISR--QYHNNALQ 65

Query: 64  -------LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  + +      FS+I+ AI   +            FDL + SQLDS    + GLG
Sbjct: 66  WHRLGEQMVVDNRDNPFSYILSAIKVTEEYARSFARELRIFDLHIDSQLDSDSGKKYGLG 125

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ- 163
           SSAA+TVA   AL    Y+   + DEI   A     +VQG  S  D+AAS++GG I Y  
Sbjct: 126 SSAAVTVATVKALCRF-YNLPVTKDEIFKLAAIAHFEVQGNGSLGDVAASVYGGWIAYHS 184

Query: 164 ----------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYI 199
                                  P   IE +     + L+  ++G    T+Q++ KIS  
Sbjct: 185 FDRQWLAQQRKYLDLRTLVDLPWPDLKIESLKAPSNLQLLIGWTGKPASTSQLVDKISLF 244

Query: 200 EI----EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSD- 254
           +     EY +  E ++     M            N +L+ +   +   + LL+ LG +  
Sbjct: 245 KARQQKEYRQFLEDSKHCIQRM-------VDGFHNADLESIKNEIRYNRELLKQLGTNSG 297

Query: 255 --------SKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
                   +KL EI      +    A+K SG+G GDC I     D N
Sbjct: 298 VHIETPVLNKLCEIA-----EDFGGAAKTSGAGGGDCGIVAIDRDSN 339


>gi|226222649|ref|YP_002756756.1| mevalonate kinase [Listeria monocytogenes Clip81459]
 gi|254824769|ref|ZP_05229770.1| mevalonate kinase [Listeria monocytogenes FSL J1-194]
 gi|254851831|ref|ZP_05241179.1| mevalonate kinase [Listeria monocytogenes FSL R2-503]
 gi|255519789|ref|ZP_05387026.1| mevalonate kinase [Listeria monocytogenes FSL J1-175]
 gi|300763377|ref|ZP_07073375.1| mevalonate kinase [Listeria monocytogenes FSL N1-017]
 gi|225875111|emb|CAS03799.1| Putative mevalonate kinase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|258605123|gb|EEW17731.1| mevalonate kinase [Listeria monocytogenes FSL R2-503]
 gi|293594008|gb|EFG01769.1| mevalonate kinase [Listeria monocytogenes FSL J1-194]
 gi|300515654|gb|EFK42703.1| mevalonate kinase [Listeria monocytogenes FSL N1-017]
          Length = 322

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 130/299 (43%), Gaps = 19/299 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +       S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVENSTKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFSKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  ++  Y E      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           L VSDS L +++ ++        +K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 241 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK---NQEIAEQITKELHNAG 295


>gi|241888708|ref|ZP_04776015.1| mevalonate kinase [Gemella haemolysans ATCC 10379]
 gi|241864731|gb|EER69106.1| mevalonate kinase [Gemella haemolysans ATCC 10379]
          Length = 268

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 110/226 (48%), Gaps = 24/226 (10%)

Query: 80  INHIKPSCGFDLKVISQLDSQL----GLGSSAAITVAITAALLTLQYHKEPSPDEILTTA 135
           ++ I  +CG D K    + S +    GLGSSAA+++AI  A       K P+  EI    
Sbjct: 47  LSFIADTCGIDKKTKINITSTIPVGRGLGSSAALSIAIARA------KKLPNVREIANKC 100

Query: 136 HAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--IYSGYKTPTAQVL 193
              +    G  SGID+   +    + +   K    ++DF    +L  I +G    T + L
Sbjct: 101 EKFI---HGNPSGIDVNQVLSDTPLLFS-KKEGASELDFDLNSYLLIIDTGVVGITKETL 156

Query: 194 KKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVS 253
           K I+    +Y       +K  A +G+++ +  + L+NKN+ ++   M +   LL+ LGVS
Sbjct: 157 KHIADNYDKY-------EKYIAELGEITDLVIEPLKNKNIDLVGHYMYKAHDLLQKLGVS 209

Query: 254 DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
            +   E+V ++ +  + + +K++G G G C I+L K   N+L  Q+
Sbjct: 210 HASNDEVV-EICKNNNAIGAKLTGGGAGGCCISLSKTKENALEIQN 254


>gi|307569533|emb|CAR82712.1| mevalonate kinase [Listeria monocytogenes L99]
          Length = 313

 Score = 69.3 bits (168), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 125/280 (44%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +       S   + G LD     P F  
Sbjct: 1   MILCGEHAVVYGEPAISVPFTQAVV---TTNVENSTKTKFSSAFFSGDLDDM---PDFLA 54

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 55  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 113

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 114 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 171

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  +++ Y +      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 172 ETRDAVKDVQVLYKKNQAKIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 231

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ ++        +K++G G G C+IA+ K
Sbjct: 232 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK 270


>gi|238878641|gb|EEQ42279.1| hypothetical protein CAWG_00483 [Candida albicans WO-1]
          Length = 431

 Score = 69.3 bits (168), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 99/388 (25%), Positives = 158/388 (40%), Gaps = 89/388 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----RL----INIDSS----- 56
           V APG +++ GEH  ++G  A+  A++ R  L ++   D    RL    I +D S     
Sbjct: 8   VGAPGKVIIFGEHAAVYGKPAIAAALSLRCYLLVSPSSDSNTIRLQFPDIKLDHSWNIKD 67

Query: 57  -------------------------------LGQYCGSLDLAM-FHPSFSFIIMAINHIK 84
                                          L  +    D  M ++  F F+ + +N   
Sbjct: 68  LPWEEIKPYLTYDSANKPQIPSELVPEIVDKLSSFLNGFDNKMHYYACFCFLYLLMNLCD 127

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAAL-LTLQYHKEPS--PDEILTTAHAIVL 140
               G +  V S L    GLGSSA+ +V +++AL L   +  +PS   ++ L TA    L
Sbjct: 128 SKVSGMNFIVRSTLPIGAGLGSSASTSVCLSSALALMGGWINKPSLHENDKLDTADIPDL 187

Query: 141 K------------VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFP-IHLIYS 183
           +              G  SGID A +  GG + +Q      + SI      FP I L+ +
Sbjct: 188 EFIDKWSLIGEKCFHGNPSGIDNAVATFGGAVMFQRTSTPEQPSIRTNMRNFPAIKLLLT 247

Query: 184 GYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-----KNLKVL 236
             K P  TA ++  +  +  E+   N I+  I   +  LSQ + + + N     +   VL
Sbjct: 248 NTKVPKSTADLVAGVGRLNAEF---NSISTSILTAIEHLSQEAYKVMMNPMFGKEETNVL 304

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSL- 295
            + +N   GLL  LGVS   L E V  + ++  I A+K++G+G G C I L   D+    
Sbjct: 305 RKLVNINHGLLVALGVSHPAL-ETVKIIGDKHRIGATKLTGAGGGGCAITLVNDDVEEFV 363

Query: 296 -----------PYQSVNCHMHAKGIDIV 312
                       Y+S    +  KG+ I+
Sbjct: 364 IHNAIKEFEDSGYESFETSLGGKGVGIL 391


>gi|332686201|ref|YP_004455975.1| phosphomevalonate kinase [Melissococcus plutonius ATCC 35311]
 gi|332370210|dbj|BAK21166.1| phosphomevalonate kinase [Melissococcus plutonius ATCC 35311]
          Length = 377

 Score = 69.3 bits (168), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 153/357 (42%), Gaps = 58/357 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL-------TLRKDRLINIDSSLGQ 59
           I VS PG L + GE+ V+  GH A++ A+++ V + L       +++ ++  ++     +
Sbjct: 2   IEVSTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTLNQAENAGSIQSEQYSSLPIQWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSSA 107
             G L L +    F +++ AI+  +            + LK+ S+LDS    + GLGSS 
Sbjct: 62  RAGKLVLDIRENPFHYVLTAIHLTEEYAAEQNKRLSFYHLKITSELDSSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY----- 162
           A+TVA   AL  L Y    +  EI   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVATIKAL-NLFYKLNLTEIEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFSTFNH 180

Query: 163 ------------------QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP 204
                             + P  SI+++     + L+  G+    A     +   ++   
Sbjct: 181 HWVNQKKQQVSLTKLLSLKWPNLSIQRLSVPKRLRLLI-GWTGSPASTFDLVD--QVHRS 237

Query: 205 EINEINQKIYALMGKLSQISC--QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVW 262
           + N++    Y L      +    Q  +  N+ ++ + + + + LL+ L +      E   
Sbjct: 238 KTNKLLNYHYFLTQSKQCVDAMIQGFQTNNISLIQKQIKKNRELLQQLSILTGVCIETC- 296

Query: 263 KLRE-----QPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI 314
            L+      + +  ASK SG+G GDC I + K   + LP  S       +GI  +P+
Sbjct: 297 ALKHLCDLAESYNGASKSSGAGGGDCGIVIFKQKSSILPIMSA---WEKEGITPLPL 350


>gi|254167081|ref|ZP_04873934.1| mevalonate kinase [Aciduliprofundum boonei T469]
 gi|197623937|gb|EDY36499.1| mevalonate kinase [Aciduliprofundum boonei T469]
          Length = 309

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 123/267 (46%), Gaps = 33/267 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
            SAP  ++L GEH V++G  A+  AIN R   Y+ ++K     ++             M 
Sbjct: 3   TSAPAKVILFGEHAVVYGEPAIAVAINLRT--YVKIKKSEEYRVNG----------YPMS 50

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
               S+I  AI         D++  S + S  G+GSSA+ITVA+  ALL ++   E   +
Sbjct: 51  DKYHSYIKNAIKLCWDGKPLDIQTKSDVPSASGMGSSASITVAMLTALLAMK--DEVKEE 108

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHG-GLICYQMPK----YSIEKIDFIFPIHLI--- 181
           +I      +  + QG +S ID +   HG G++ ++  K    + +EK    + IH I   
Sbjct: 109 KIAKLGFEVEYRTQGSASPIDTSTVTHGKGILVHREKKDNFLWKVEKGGLKWYIHHIEVP 168

Query: 182 -------YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
                  +SG K  T  ++ K+      +   N   + +   +GK++  + + L++++ +
Sbjct: 169 SLKLVVGFSGIKGSTKDMVNKVR----RFYNWNSFARDVIRDIGKITMEAIEPLQDEDYE 224

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIV 261
            + + MN    LL  LGV+   L  ++
Sbjct: 225 RIGELMNEDNKLLTILGVNHPMLKRMI 251


>gi|46906235|ref|YP_012624.1| mevalonate kinase [Listeria monocytogenes serotype 4b str. F2365]
 gi|46879499|gb|AAT02801.1| mevalonate kinase [Listeria monocytogenes serotype 4b str. F2365]
          Length = 322

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 130/299 (43%), Gaps = 19/299 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +       S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVENSTKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGKGECVAIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFSKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  ++  Y E      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           L VSDS L +++ ++        +K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 241 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK---NQEIAEQITKELHNAG 295


>gi|45358898|ref|NP_988455.1| mevalonate kinase [Methanococcus maripaludis S2]
 gi|45047764|emb|CAF30891.1| Mevalonate kinase [Methanococcus maripaludis S2]
          Length = 317

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 127/276 (46%), Gaps = 41/276 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLG---QYC 61
            +  P  ++L GEH V+ G+ A+  A++ +    +    D     L++++       +  
Sbjct: 3   TIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENFDTISIDLVDLNEIFEITPELI 62

Query: 62  GSLDLAMFHPSFSFIIMAIN-------------HIKPSCGFDLKVISQLDSQLGLGSSAA 108
            +L+++ F P+  ++I A+               IKP   F LK+ S++    GLGSSA+
Sbjct: 63  KNLEISNFSPALKYVICAVKSVIFYLSEFKNLKEIKP---FKLKLYSEIPLSCGLGSSAS 119

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLI-----CYQ 163
           + V +  ++    Y  E   DE +  A+++  +VQG +S  D A    GG+I      Y+
Sbjct: 120 VVVTVIRSISNF-YGIELDNDETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGKYK 178

Query: 164 -MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            MPK   E I     + +        TA+++  +S    ++PE  +I ++I  ++  + Q
Sbjct: 179 PMPKDLEEFIKTCKFLVVNVEERTRKTAELVHDVS----KHPEKEQIFEEIGKIIQNVRQ 234

Query: 223 ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLS 258
           ++ +A        L + MN    LL+  G+S  KL 
Sbjct: 235 VTDKA-------ELGKLMNENHELLKKFGISTEKLD 263


>gi|331701431|ref|YP_004398390.1| mevalonate kinase [Lactobacillus buchneri NRRL B-30929]
 gi|329128774|gb|AEB73327.1| mevalonate kinase [Lactobacillus buchneri NRRL B-30929]
          Length = 325

 Score = 68.9 bits (167), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 106/229 (46%), Gaps = 22/229 (9%)

Query: 88  GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISS 147
            FDL + S+L ++ G+GSSAA  +AI  A     +    +  ++L  A        G  S
Sbjct: 86  AFDLDIQSKLPAERGMGSSAATAIAIVRAFFDF-FEVNLTRSQLLKLAGIEEKITHGNPS 144

Query: 148 GIDLAASIHGGLICYQMPKYSI-----EKIDFIFPIH---LIYSGYKTPTAQVLKKISYI 199
           G+D A +         MP + I     E+IDF  P     +  SG K  T++ +  +   
Sbjct: 145 GLDSATA------SSNMPIWFIRNEINEQIDFNLPTSSLVIADSGIKGKTSEAVSLVHDN 198

Query: 200 EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSE 259
            ++ PE +   Q +   + K+++ +  AL   +  +L + M + Q  L  LGVS+  L  
Sbjct: 199 LVDEPESS---QPLIDELSKIAETARNALATTDDVLLGKLMTQSQRDLAQLGVSNHTLDT 255

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
              ++    H + +K++GSGLG CVIAL K   N    Q ++  +   G
Sbjct: 256 FC-QVACDNHALGAKLTGSGLGGCVIALAK---NQRDAQQISTALRKAG 300


>gi|303314949|ref|XP_003067483.1| mevalonate kinase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240107151|gb|EER25338.1| mevalonate kinase, putative [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 571

 Score = 68.9 bits (167), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 155/376 (41%), Gaps = 76/376 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKDR---LINI-DSSLGQYCG-- 62
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K R    +N  D+ L       
Sbjct: 128 VSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWDID 187

Query: 63  SLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLKVISQ--------- 96
           SL   +FH S                    I   I+++ P    +++ + Q         
Sbjct: 188 SLPWDVFHHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFLYL 247

Query: 97  ---------------LDSQL----GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTTAH 136
                          L S +    GLGSSA++ V ++AA LL ++    P PD+    + 
Sbjct: 248 YLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDESE 307

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPIH 179
             + ++            G  SG+D   S  G  + ++   YS     I  +DF   P+ 
Sbjct: 308 VQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPMVIPILDFPELPLL 367

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLK 234
           L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ L 
Sbjct: 368 LVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKHSSETLN 427

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                     GLL +LGVS  +L E + +L +   I  +K++G+G G C I L + D  S
Sbjct: 428 YFGTLFRINHGLLVSLGVSHPRL-ERIRELVDHTGIGWTKLTGAGGGGCAITLIRTDRES 486

Query: 295 LPYQSVNCHMHAKGID 310
              + +   +  +G +
Sbjct: 487 TALKPLERQLDEEGYE 502


>gi|217965924|ref|YP_002351602.1| mevalonate kinase [Listeria monocytogenes HCC23]
 gi|217335194|gb|ACK40988.1| mevalonate kinase [Listeria monocytogenes HCC23]
          Length = 322

 Score = 68.9 bits (167), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 125/280 (44%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + V+   T   +       S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVENSTKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  +++ Y +      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQVLYKKNQAKIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ ++        +K++G G G C+IA+ K
Sbjct: 241 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK 279


>gi|47093020|ref|ZP_00230799.1| mevalonate kinase [Listeria monocytogenes str. 4b H7858]
 gi|47018588|gb|EAL09342.1| mevalonate kinase [Listeria monocytogenes str. 4b H7858]
          Length = 313

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 130/299 (43%), Gaps = 19/299 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + ++   T   +       S   + G LD     P F  
Sbjct: 1   MILCGEHAVVYGEPAISVPFTQAIV---TTNVENSTKTKFSSAFFSGDLDDM---PDFLA 54

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 55  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 113

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 114 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFSKKITFVVADTGVPS- 171

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  ++  Y E      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 172 ETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 231

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           L VSDS L +++ ++        +K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 232 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK---NQEIAEQITKELHNAG 286


>gi|320037853|gb|EFW19790.1| mevalonate kinase [Coccidioides posadasii str. Silveira]
          Length = 571

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 155/376 (41%), Gaps = 76/376 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKDR---LINI-DSSLGQYCG-- 62
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K R    +N  D+ L       
Sbjct: 128 VSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWDID 187

Query: 63  SLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLKVISQ--------- 96
           SL   +FH S                    I   I+++ P    +++ + Q         
Sbjct: 188 SLPWDVFHHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFLYL 247

Query: 97  ---------------LDSQL----GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTTAH 136
                          L S +    GLGSSA++ V ++AA LL ++    P PD+    + 
Sbjct: 248 YLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDESE 307

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPIH 179
             + ++            G  SG+D   S  G  + ++   YS     I  +DF   P+ 
Sbjct: 308 VQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPMVIPILDFPELPLL 367

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLK 234
           L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ L 
Sbjct: 368 LVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKHSSETLN 427

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                     GLL +LGVS  +L E + +L +   I  +K++G+G G C I L + D  S
Sbjct: 428 YFGTLFRINHGLLVSLGVSHPRL-ERIRELVDHTGIGWTKLTGAGGGGCAITLIRPDRES 486

Query: 295 LPYQSVNCHMHAKGID 310
              + +   +  +G +
Sbjct: 487 TALKPLERQLDEEGYE 502


>gi|254930858|ref|ZP_05264217.1| mevalonate kinase [Listeria monocytogenes HPB2262]
 gi|293582404|gb|EFF94436.1| mevalonate kinase [Listeria monocytogenes HPB2262]
 gi|328468332|gb|EGF39338.1| mevalonate kinase [Listeria monocytogenes 1816]
 gi|332310344|gb|EGJ23439.1| Mevalonate kinase [Listeria monocytogenes str. Scott A]
          Length = 322

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 130/299 (43%), Gaps = 19/299 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + ++   T   +       S   + G LD     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAIV---TTNVENSTKTKFSSAFFSGDLD---DMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V+S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGKGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFSKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  ++  Y E      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQALYKENQTEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           L VSDS L +++ ++        +K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 241 LTVSDSSLEKLI-EVARSSGADGAKLTGGGRGGCIIAVAK---NQEIAEQITKELHNAG 295


>gi|270290280|ref|ZP_06196505.1| mevalonate kinase [Pediococcus acidilactici 7_4]
 gi|270281061|gb|EFA26894.1| mevalonate kinase [Pediococcus acidilactici 7_4]
          Length = 306

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 135/292 (46%), Gaps = 22/292 (7%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAIN--KRVILYLTLRKDRLINIDSSLGQYCG 62
           + ++  ++   ++LMGEH V++   A+   I   K  +   ++  D  I I S   +Y  
Sbjct: 1   MKEVIKTSNAKIILMGEHSVVYNQPAIALPIRNVKTTVKIQSIPGD--IQIRS---RYFN 55

Query: 63  SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
              L   H +   I   IN       KP  G  L + SQ+ ++ G+GSSA+  VAI  A+
Sbjct: 56  GF-LNDIHSNLLGIKQLINQTLTTLGKPHYGLLLDIDSQIPAERGMGSSASTAVAIVRAM 114

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
               + +  + +++L   +     + G  SG+D A +     I ++    +I+ +   F 
Sbjct: 115 YAF-FDRPLTKNKLLKAVNISEKIIHGNPSGLDSATASADRPIWFKRDG-TIKALPINFN 172

Query: 178 IHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
            +L+   SG K  T + +  +         I+  ++ +   +G+L+  +  AL++ +   
Sbjct: 173 GYLVISDSGIKGKTGEAVDIVK----NKLRIDNDSRLLIEKLGELTSQTATALKDNDSLA 228

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   MN  Q  L  LGVS   + +++ +   Q   + SK++G GLG CVI+L
Sbjct: 229 LGDIMNNAQACLRQLGVSHPAVEKLI-QAANQSGALGSKLTGGGLGGCVISL 279


>gi|323127094|gb|ADX24391.1| mevalonate kinase [Streptococcus dysgalactiae subsp. equisimilis
           ATCC 12394]
          Length = 292

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 136/285 (47%), Gaps = 38/285 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y ++  
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YFQKSL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIY 182
           PDE+L     +V K + I+    SG+D    +    I + +   +   KID    + +  
Sbjct: 112 PDELL---EILVNKAEIIAHTNPSGLDAKTCLSDHAIKFIRNIGFETIKIDLGAFLIIAD 168

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +G    T + + K++  E       E N    A +G+L++   QA+  K+ + + Q M +
Sbjct: 169 TGVHGHTREAVGKVAQFE-------ETNLPYLAKLGRLTEAVEQAITQKDNQTIGQLMTQ 221

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               L+ +GVS +K  ++V  +  +   + +K++G GLG C+IAL
Sbjct: 222 AHSALKAIGVSITKADQLV-DVALKAGALGAKMTGGGLGGCMIAL 265


>gi|150399397|ref|YP_001323164.1| mevalonate kinase [Methanococcus vannielii SB]
 gi|150012100|gb|ABR54552.1| mevalonate kinase [Methanococcus vannielii SB]
          Length = 319

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 128/285 (44%), Gaps = 35/285 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRV-------ILYLTLRKDRLINIDSSLGQY 60
           + V  P  ++L GEH V+ G++A+  AI+ +           +T+    L  I     + 
Sbjct: 3   LTVKTPSKVILFGEHAVVDGYSAIAMAIDLKTTGEIKGNFETITIELSDLNEIFEIAPKL 62

Query: 61  CGSLDLAMFHPSFSFII----MAINHIKPSCG------FDLKVISQLDSQLGLGSSAAIT 110
              LD++ F PS  +++     AIN++    G      F LK+ S++    GLGSSA++ 
Sbjct: 63  IKELDISNFSPSLKYVLCATKYAINYLIEFKGLTSITPFKLKIFSEIPVSCGLGSSASVV 122

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI- 169
           V    ++    Y      +E++  A+++   +QG +S  D A     G+I      Y I 
Sbjct: 123 VTTINSISNF-YGISLKNEEVINMAYSVEKDIQGRASITDTATITLSGMIEIYAGNYKIM 181

Query: 170 --EKIDFIFPIHLIYSGYKT---PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQIS 224
             E  +FI   + +    +     TA ++ ++S    E+P+  E+ +KI  ++ K+    
Sbjct: 182 PKELSEFIKTCNFLIVNVEERTRKTADLVWEVS----EHPQKEELFKKIGTIIEKVKH-- 235

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPH 269
                N++ + L + M     +L+  G+S  KL  ++   ++  H
Sbjct: 236 -----NRSKEELGKLMVENHEILKKFGISTEKLDLVIEASKKYAH 275


>gi|242808537|ref|XP_002485185.1| mevalonate kinase [Talaromyces stipitatus ATCC 10500]
 gi|218715810|gb|EED15232.1| mevalonate kinase [Talaromyces stipitatus ATCC 10500]
          Length = 547

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 157/387 (40%), Gaps = 97/387 (25%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG AA+  AI+ R  +L  TL K         R I +D +    
Sbjct: 108 VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDHTWD-- 165

Query: 61  CGSLDLAMF-HPS-----FSFII--------------MAINHIKPSCGFDLKVISQ---- 96
             SL   +F HPS     +  +                A++  KP    D++ I Q    
Sbjct: 166 IDSLPWNVFKHPSKKKMYYDLVTELDPDLVEAVQPHAAAVSTDKPD---DIRKIHQGSAA 222

Query: 97  --------------------LDSQL----GLGSSAAITVAITAA-LLTLQYHKEPSPDEI 131
                               L S +    GLGSSA+++V ++AA LL ++    P PD+ 
Sbjct: 223 QFLYLFLSLGSPESHAAIYTLRSTIPISAGLGSSASVSVCLSAALLLQIRTLAGPHPDQP 282

Query: 132 LTTAHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS-------IEKID 173
              A   + ++            G  SG+D   S  G  + ++   YS       + K  
Sbjct: 283 PEEAEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVLFRRSDYSKPPTVTPLNKFP 342

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQAL 228
            + P+ L+ +     TA  + K+  +   +PE+ E     I++   +    + +   +A 
Sbjct: 343 EL-PLLLVNTRQSRSTAVEVAKVGRLRETHPEVTEAMLDAIDKVTMSASEMIKENDFEAD 401

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
            +++L+          GLL +LGVS  +L  I W          +K++G+G G C I L 
Sbjct: 402 DDEDLEQFGALFRINHGLLVSLGVSHPRLERIRW----------TKLTGAGGGGCAITLI 451

Query: 289 KGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           K + +    Q +   + ++  +    T
Sbjct: 452 KPNTSQQTLQDLEEKLTSENFEKFETT 478


>gi|68464835|ref|XP_723495.1| hypothetical protein CaO19.4809 [Candida albicans SC5314]
 gi|68465212|ref|XP_723305.1| hypothetical protein CaO19.12272 [Candida albicans SC5314]
 gi|46445332|gb|EAL04601.1| hypothetical protein CaO19.12272 [Candida albicans SC5314]
 gi|46445529|gb|EAL04797.1| hypothetical protein CaO19.4809 [Candida albicans SC5314]
          Length = 431

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 100/388 (25%), Positives = 161/388 (41%), Gaps = 89/388 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----RL----INIDSS----- 56
           V APG +++ GEH  ++G  A+  A++ R  L ++   D    RL    I +D S     
Sbjct: 8   VGAPGKVIIFGEHAAVYGKPAIAAALSLRCYLLVSPSSDSNTIRLQFPDIKLDHSWNIKD 67

Query: 57  -------------------------------LGQYCGSLDLAM-FHPSFSFIIMAINHIK 84
                                          L  +    D  M ++  F F+ + +N   
Sbjct: 68  LPWEEIKPYLTYDSANKPQIPSELVPEIVDKLSSFLNGFDNKMHYYACFCFLYLLMNLCD 127

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAAL-LTLQYHKEPS--PDEILTTAHAIVL 140
               G +  V S L    GLGSSA+ +V +++AL L   +  +PS   ++ L TA    L
Sbjct: 128 SKVSGMNFIVRSTLPIGAGLGSSASTSVCLSSALALMGGWINKPSLHENDKLDTADIPDL 187

Query: 141 K------------VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFP-IHLIYS 183
           +              G  SGID A +  GG + +Q      + SI      FP I L+ +
Sbjct: 188 EFIDKWSLIGEKCFHGNPSGIDNAVATFGGAVMFQRTSTPEQPSIRTNMRNFPAIKLLLT 247

Query: 184 GYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-----KNLKVL 236
             K P  TA ++  +  +  E+   N I+  I   +  LSQ + + + N     +   VL
Sbjct: 248 NTKVPKSTADLVAGVGRLNAEF---NSISTSILTAIEHLSQEAYKVMMNPMFGKEETNVL 304

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL---- 292
            + +N   GLL  LGVS   L E V  + ++  I A+K++G+G G C I L   D+    
Sbjct: 305 RKLVNINHGLLVALGVSHPAL-ETVKIIGDKHRIGATKLTGAGGGGCAITLVNDDVEESV 363

Query: 293 --NSLP------YQSVNCHMHAKGIDIV 312
             N++       Y+S    +  KG+ I+
Sbjct: 364 IHNAIKEFEDSGYESFETSLGGKGVGIL 391


>gi|253751169|ref|YP_003024310.1| mevalonate kinase [Streptococcus suis SC84]
 gi|253753070|ref|YP_003026210.1| mevalonate kinase [Streptococcus suis P1/7]
 gi|253754892|ref|YP_003028032.1| mevalonate kinase [Streptococcus suis BM407]
 gi|251815458|emb|CAZ51036.1| mevalonate kinase [Streptococcus suis SC84]
 gi|251817356|emb|CAZ55092.1| mevalonate kinase [Streptococcus suis BM407]
 gi|251819315|emb|CAR44664.1| mevalonate kinase [Streptococcus suis P1/7]
 gi|319757438|gb|ADV69380.1| mevalonate kinase [Streptococcus suis JS14]
          Length = 311

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 136/284 (47%), Gaps = 15/284 (5%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLI---NIDSSLGQYCGSLDLA 67
           A G ++LMGEH V++GH A+    +   +I  +T + + L    +    L      +  +
Sbjct: 7   ANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPKIWES 66

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H +  F +  I          +++ S + ++ G+GSSAA+ VA+  AL    Y KE +
Sbjct: 67  LKH-AIRFSLYRIG-APTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YEKELT 123

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             E+     +      G  SGID AA+  G    + +    IE  +     HL+   +G 
Sbjct: 124 DSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAHLVVADTGV 182

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + +  ++ +  + PE  ++ ++    +G L++ + + L     ++L   MN+   
Sbjct: 183 TGNTLEAISDVADLLEKKPEAIKLVEE----LGNLTRQAKEDLATDQAELLGSRMNQAHA 238

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +
Sbjct: 239 LLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALAR 281


>gi|94990249|ref|YP_598349.1| mevalonate kinase [Streptococcus pyogenes MGAS10270]
 gi|94543757|gb|ABF33805.1| Mevalonate kinase [Streptococcus pyogenes MGAS10270]
          Length = 292

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 136/285 (47%), Gaps = 38/285 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIY 182
            D++L     +V K + I+    SG+D    +    I + +   +   KID    + +  
Sbjct: 112 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKFIRNIGFETIKIDLGAFLIIAD 168

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +G    T + + K++  E       E N    A +G+L++   QA+  K+ + + Q M +
Sbjct: 169 TGVHGHTREAVGKVAQFE-------ETNLPYLAKLGRLTEAVEQAITQKDNQTIGQLMTQ 221

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               L+ +GVS +K  ++V  +  +   + +K++G GLG C+IAL
Sbjct: 222 AHSALKAIGVSITKADQLV-DVALKAGALGAKMTGGGLGGCMIAL 265


>gi|146317945|ref|YP_001197657.1| mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|146320132|ref|YP_001199843.1| mevalonate kinase [Streptococcus suis 98HAH33]
 gi|145688751|gb|ABP89257.1| Mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|145690938|gb|ABP91443.1| Mevalonate kinase [Streptococcus suis 98HAH33]
 gi|292557729|gb|ADE30730.1| Mevalonate kinase [Streptococcus suis GZ1]
          Length = 317

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 136/284 (47%), Gaps = 15/284 (5%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLI---NIDSSLGQYCGSLDLA 67
           A G ++LMGEH V++GH A+    +   +I  +T + + L    +    L      +  +
Sbjct: 13  ANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPKIWES 72

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H +  F +  I          +++ S + ++ G+GSSAA+ VA+  AL    Y KE +
Sbjct: 73  LKH-AIRFSLYRIG-APTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YEKELT 129

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             E+     +      G  SGID AA+  G    + +    IE  +     HL+   +G 
Sbjct: 130 DSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAHLVVADTGV 188

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + +  ++ +  + PE  ++ ++    +G L++ + + L     ++L   MN+   
Sbjct: 189 TGNTLEAISDVADLLEKKPEAIKLVEE----LGNLTRQAKEDLATDQAELLGSRMNQAHA 244

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +
Sbjct: 245 LLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALAR 287


>gi|19745944|ref|NP_607080.1| mevalonate kinase [Streptococcus pyogenes MGAS8232]
 gi|19748102|gb|AAL97579.1| mevalonate kinase [Streptococcus pyogenes MGAS8232]
          Length = 292

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 135/287 (47%), Gaps = 40/287 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D++L     +V K + I+    SG+D    +    I + +     E I+     +LI  
Sbjct: 112 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKF-IRNIGFETIEIALNGYLIIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + + K++  E       E+N    A +G L+Q   +A+  KN   + Q M 
Sbjct: 168 DTGIHGHTREAVNKVAQFE-------EMNLPYLAKLGALTQALERAINQKNKVAIGQLMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +    L+ +GVS SK  ++V +   +   + +K++G GLG C+IAL 
Sbjct: 221 QAHSALKAIGVSISKADQLV-EAALRAGALGAKMTGGGLGGCMIALA 266


>gi|296807128|ref|XP_002844180.1| mevalonate kinase [Arthroderma otae CBS 113480]
 gi|238843663|gb|EEQ33325.1| mevalonate kinase [Arthroderma otae CBS 113480]
          Length = 518

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 99/382 (25%), Positives = 157/382 (41%), Gaps = 88/382 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSMDEPEEVRKIHHHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS     I  +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVIPILDFPEM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV- 235
            + LI S     TA  + K+  ++  +P I E    +   +G+L++ + + + + +    
Sbjct: 312 RLLLINSRQPRSTAVEVAKVGALKKAHPAITE---SVLDSIGQLTENAHRIIMSDDFDEN 368

Query: 236 -------LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
                    Q      GLL +LGVS  +L E + +L +   I  +K++G+G G C I L 
Sbjct: 369 CHDTIDHFGQLFRINHGLLVSLGVSHPRL-ERIRELVDHADIGWTKLTGAGGGGCTITLL 427

Query: 289 KGDLNSLPYQSVNCHMHAKGID 310
           KG+ N    + +   +  +G +
Sbjct: 428 KGNRNEAAIEHMEEQLDDEGFE 449


>gi|16799089|ref|NP_469357.1| hypothetical protein lin0010 [Listeria innocua Clip11262]
 gi|16412431|emb|CAC95243.1| lin0010 [Listeria innocua Clip11262]
          Length = 322

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 124/280 (44%), Gaps = 16/280 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF-- 73
           ++L GEH V++G  A+     + ++   T   +       S   + G L+     P F  
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAIV---TTNVETSTKTKFSSAFFTGDLE---NMPDFLA 63

Query: 74  ---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              + ++  +N I       + V S +    GLGSSAA+  +I   L    +++E    +
Sbjct: 64  GIKALVVDVLNEIGNGENVSIHVTSGVPIGRGLGSSAAVATSIARGLYKY-FNQELDSKK 122

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L   +A      G +SG+D    +    + Y+  +  +E + F   I  + +    P+ 
Sbjct: 123 LLAIINAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS- 180

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLET 249
           +    +  ++I Y E      KI   +G +S +I      + +   +  AMN+ Q  LET
Sbjct: 181 ETRDAVKDVQILYKENQAEIGKIIHQLGDISREIKLHLEGDADTVKIGAAMNKAQSYLET 240

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VSDS L +++ K+        +K++G G G C+IA+ K
Sbjct: 241 LTVSDSSLEKLI-KVARSNGADGAKLTGGGRGGCIIAVAK 279


>gi|256847334|ref|ZP_05552780.1| phosphomevalonate kinase [Lactobacillus coleohominis 101-4-CHN]
 gi|256715998|gb|EEU30973.1| phosphomevalonate kinase [Lactobacillus coleohominis 101-4-CHN]
          Length = 367

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 165/380 (43%), Gaps = 83/380 (21%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I   APG L + GE+ V+ +G  A++ A+N+ V   +    +    I S   QY    + 
Sbjct: 2   ITEKAPGKLYIAGEYAVVENGFPAILVALNQFVYCSIEPSTNGTGKIVSH--QYQN--NA 57

Query: 67  AMFHPS------------FSFIIMAINHI--------KPSCGFDLKVISQLDS----QLG 102
             +H              FS+I+ AI           KP   +DL + S+LDS    + G
Sbjct: 58  VQWHRQGDQMIVDQRDNPFSYILSAIQVTEEYARTLNKPLDVYDLHIDSELDSASGKKYG 117

Query: 103 LGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           LGSSAA+TVA   AL    YH   + D I   A      VQG  S  D+AAS++GG I Y
Sbjct: 118 LGSSAAVTVATVKALCQF-YHLPVNNDRIFKLAAIAHFAVQGNGSLGDVAASVYGGWIAY 176

Query: 163 Q-----------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKIS 197
                                    P   IE +     + L+  ++G    T+Q++ KIS
Sbjct: 177 HSFDRQWLAEQRKFLDLTTLLNLPWPNLKIETLTAPANLALVIGWTGKPASTSQLVDKIS 236

Query: 198 YI----EIEYPE-INEINQKIYALM-----GKLSQISCQALRNKNLKVLAQAMNRQQGL- 246
                 + +Y E +N   Q I  ++     G L  I  +   N++   L Q + R+ G+ 
Sbjct: 237 LFKARQQAQYQEFLNASRQCIQRMINGFHAGSLEMIQTEIRYNRS---LLQELARRSGVQ 293

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC-VIAL-GKGDLNSLPYQSVNCHM 304
           +ET  +   +L +I  +        A+K SG+G GDC ++A+  + DL S+  Q      
Sbjct: 294 IETPVL--KQLCQIAEQFGG-----AAKTSGAGGGDCGIVAIDAQADLQSMINQWT---- 342

Query: 305 HAKGIDIVPITPSHSTSLYR 324
            A+ I+ +P+      +++R
Sbjct: 343 -AENIEHLPLAVHFMNNVHR 361


>gi|241949627|ref|XP_002417536.1| mevalonate kinase, putative [Candida dubliniensis CD36]
 gi|223640874|emb|CAX45191.1| mevalonate kinase, putative [Candida dubliniensis CD36]
          Length = 431

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 100/388 (25%), Positives = 162/388 (41%), Gaps = 89/388 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----RL----INIDSS----- 56
           V APG +++ GEH  ++G  A+  A++ R  L ++   D    RL    I +D S     
Sbjct: 8   VGAPGKVIIFGEHAAVYGKPAIAAALSLRCYLLVSPSIDSNTIRLQFPDIKLDHSWNIKD 67

Query: 57  -------------------------------LGQYCGSLDLAM-FHPSFSFIIMAINHIK 84
                                          L  +  S D  M ++  F F+ + +N   
Sbjct: 68  LPWEEIKPYLIYDRENKPQIPSELVPEIVDKLSNFLNSFDNKMHYYACFCFLYLLMNLCD 127

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAAL-LTLQYHKEPS--PDEILTTAHAIVL 140
               G +  V S L    GLGSSA+ +V +++AL L   +  +PS   ++ L TA    L
Sbjct: 128 SKVPGMNFIVRSTLPIGAGLGSSASTSVCLSSALALMGGWINKPSLHENDKLDTADIPDL 187

Query: 141 K------------VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFP-IHLIYS 183
           +              G  SGID A +  GG + +Q      + SI      FP I L+ +
Sbjct: 188 EFIDKWSLIGEKCFHGNPSGIDNAVATFGGAVMFQRTSTPEQPSIRTNMRNFPAIKLLLT 247

Query: 184 GYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-----KNLKVL 236
             K P  TA ++  +  +  E+   N I+  I   +  LSQ + + + N     +   VL
Sbjct: 248 NTKVPKSTADLVAGVGRLNAEF---NSISSSILTAIEHLSQEAYKVMMNPMFGKEETNVL 304

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL---- 292
            + +N   GLL  LGVS   L E V  + ++  I ++K++G+G G C I L   D+    
Sbjct: 305 RKLVNINHGLLVALGVSHPAL-ETVKIIGDKHRIGSTKLTGAGGGGCAITLVNDDVEESV 363

Query: 293 --NSLP------YQSVNCHMHAKGIDIV 312
             N++       Y+S    +  KG+ I+
Sbjct: 364 IHNAIKEFEENGYESFETSLGGKGVGIL 391


>gi|302911969|ref|XP_003050610.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731547|gb|EEU44897.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 496

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 149/359 (41%), Gaps = 80/359 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-TLRKDRLI--------------NID 54
           VSAPG +++ GEH V+HG AA+  AI+ R  L++ TL K +                NID
Sbjct: 51  VSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFPDIDLVHTWNID 110

Query: 55  S-------------SLGQYCGSLD---LAMFHP----------------------SFSFI 76
                         S       LD   +A   P                      +F ++
Sbjct: 111 ELPWQAFQQPSKKKSYYSLVTELDPDLVAALQPHINVVSPDRPEEIRRVHRSSASAFLYL 170

Query: 77  IMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
            +++     P C + L+  S +    GLGSSA+I+V ++AA LL L+    P PD+    
Sbjct: 171 FLSLGWPSFPGCLYTLR--STIPIGAGLGSSASISVCLSAALLLQLRTLSGPHPDQPPDE 228

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FP 177
           A   V ++            G  SG+D   +  G  + +Q   YS         DF   P
Sbjct: 229 ARLQVERINRWAFVSEMCIHGNPSGVDNTVATQGKAVVFQRTDYSKPPSVRPLWDFPELP 288

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPE-----INEINQKIYALMGKLSQISCQALRNKN 232
           + L+ +     TA  + K++ ++  +P+     ++ +++        +  I       + 
Sbjct: 289 LLLVDTRQAKSTAHEVGKVAKLKQTHPKLVGTILDAMDRVTNTAADLIEDIHFDNESEEC 348

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L + D
Sbjct: 349 LTKVGELMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITLLRPD 406


>gi|159905721|ref|YP_001549383.1| mevalonate kinase [Methanococcus maripaludis C6]
 gi|159887214|gb|ABX02151.1| mevalonate kinase [Methanococcus maripaludis C6]
          Length = 317

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 126/276 (45%), Gaps = 41/276 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLG---QYC 61
            +  P  ++L GEH V+ G+ A+  A++ +    +    D     L++++       +  
Sbjct: 3   TIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIGENSDTISIDLVDLNEIFEITPELI 62

Query: 62  GSLDLAMFHPSFSFIIMAI-------------NHIKPSCGFDLKVISQLDSQLGLGSSAA 108
            +L+++ F P+  ++I A+             N IKP   F LK+ S++    GLGSSA+
Sbjct: 63  KNLEISNFSPALKYVICAVKFVIFYLSEFKNLNEIKP---FKLKLYSEIPLSCGLGSSAS 119

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLI-----CYQ 163
           + V +  ++    Y  E   +E +  A+++  +VQG +S  D A    GG+I      Y+
Sbjct: 120 VVVTVIRSISNF-YGIELDNNETINLAYSVEKEVQGRASVTDTATISLGGMIEIINGEYK 178

Query: 164 -MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            MPK   E I     + +        TA+++  +S    ++PE  +I ++I  ++  + Q
Sbjct: 179 PMPKDLEEFIKTCKFLVVNVEERTRKTAELVHDVS----KHPEKPQIFEEIGKIIQNVRQ 234

Query: 223 ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLS 258
           +  +A        L + MN    LL   G+S  KL 
Sbjct: 235 VKDKA-------ELGKFMNENHELLRKFGISTEKLD 263


>gi|149279414|ref|ZP_01885545.1| putative galactokinase [Pedobacter sp. BAL39]
 gi|149229940|gb|EDM35328.1| putative galactokinase [Pedobacter sp. BAL39]
          Length = 382

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 142/331 (42%), Gaps = 47/331 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + V +PG + ++GEH   +G   L  AINK + + ++ R+D  +++ +   +   ++ L+
Sbjct: 19  LWVRSPGRINIIGEHTDYNGGFVLPAAINKAIYIGISKREDEEVHLYAEDFKEKHTVALS 78

Query: 68  MFHPSF----SFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              PS     ++I+   + +  S     GF+L +   +    GL SSAA+  A   AL  
Sbjct: 79  ALAPSEKSWPNYILGVADQLLKSGYKIGGFNLYIDGDVPLGAGLSSSAAVECATGYALDQ 138

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LICY---------Q 163
           L ++ + + + I   A        G+  GI D  AS+ G       L C          +
Sbjct: 139 L-FNLKLTQETIALVAQKAEHTFAGVMCGIMDQFASVFGKQDHVIKLDCRSLDYEYVPLK 197

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ- 222
           +  Y +  ++      L  S Y T  +Q  + +++I   +PE+  +     +++ K  + 
Sbjct: 198 LDGYKLVLLNTNVKHALSSSAYNTRRSQCEQGVAWITAHHPEVTSLRDATVSMLDKYVKE 257

Query: 223 --------------------ISCQALRNKNLKVLAQAM-NRQQGLLETLGVSDSKLSEIV 261
                               ++C  L+  +L  L Q M    +GL E   VS  +L  +V
Sbjct: 258 KDEEVYIKCRFVIDEIERLLVACDHLKKGDLAALGQKMYETHEGLSEAYEVSCKELDFLV 317

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDL 292
            ++R  P ++ +++ G G G C I + K + 
Sbjct: 318 AEVRNYPQVLGARMMGGGFGGCTINIVKDEF 348


>gi|145545001|ref|XP_001458185.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124426004|emb|CAK90788.1| unnamed protein product [Paramecium tetraurelia]
          Length = 288

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 140/290 (48%), Gaps = 34/290 (11%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V AP  +++ GEH V++GH AL  AINK   + +   +   I I      +   LDL   
Sbjct: 3   VRAPAKIIISGEHSVVYGHKALCAAINKYTTIKIHPNQTNSIEIRWG-NDWHEVLDLNQN 61

Query: 70  HPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +     +A I +++PS    ++V S++    GLGSSA+  VA+T A+         S 
Sbjct: 62  NTNSQLAQVARILNMRPSI---IEVQSEVPISSGLGSSASYAVALTKAM-------NGSI 111

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IFPIHLIYSG--- 184
           D+ +   +    K     SG+D+  + HGGL  +Q+ K  ++K++  I  I LI SG   
Sbjct: 112 DQAIQIENIFHGKR---GSGLDVQVTNHGGLCVFQIGK-PVQKVNLPIQNILLIDSGERK 167

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            K     + K  + +E         N+    ++ ++S+++ Q ++   +K L   +    
Sbjct: 168 QKGTEGSIAKVRNCVE---------NKDGRQILNRISEVTEQIIKEGLVKEL---IYENH 215

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            LL  LG+  +++++I+   + +   + +K++G+G G   IA  K D  S
Sbjct: 216 DLLNRLGICTNRINDIIRICKSEN--IPAKMTGAGDGGFCIAFPKDDQES 263


>gi|322696123|gb|EFY87920.1| mevalonate kinase [Metarhizium acridum CQMa 102]
          Length = 490

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 89/365 (24%), Positives = 159/365 (43%), Gaps = 91/365 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKD------RLINID-------- 54
           VSAPG +++ GEH V++G  A+  AI+ R  L++T L K       R  +ID        
Sbjct: 46  VSAPGKVIVFGEHSVVYGKTAIAAAISLRSYLHVTTLSKSKRTVSLRFTDIDLVHTWNID 105

Query: 55  ----------------------------SSLGQYC-----GSLDLAMFHP--SFSFIIMA 79
                                       ++LG +      G  D+   H   +F+F+ + 
Sbjct: 106 ELPWDTFQQPSKKKSYYSLVTELDPDLVAALGPHVDVSPDGPEDIRRVHRNGAFAFLYLF 165

Query: 80  INHIKPS---CGFDLKVISQLDSQLGLGSSAAITVAITAALL-TLQYHKEPSPDEILTTA 135
           ++   PS   C + L+  S +    GLGSSA+I V ++AALL  L+    P PD+    A
Sbjct: 166 LSLGSPSFPGCLYTLR--STIPIGAGLGSSASIAVCVSAALLIQLRTLSGPHPDQPPEEA 223

Query: 136 HAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKY----SIEKI-DFI-FPI 178
              + ++            G  SG+D   +  G  + +Q+  Y    S++ + DF   P+
Sbjct: 224 RLQIERINRWAFVYEMCIHGNPSGVDNTVATQGKAVVFQILDYDKPPSVKPLWDFPELPL 283

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR--------- 229
            L+ +     TA  + K+  +   +P++      + +++  + +++  A           
Sbjct: 284 LLVDTKQPKSTAHEVAKVGKLNKMHPKL------VASILDAMDKVASSAAELIADDDFDE 337

Query: 230 --NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              ++L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 338 EEERSLMKVGELMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITL 396

Query: 288 GKGDL 292
            + D+
Sbjct: 397 LRPDV 401


>gi|328464092|gb|EGF35574.1| phosphomevalonate kinase [Lactobacillus rhamnosus MTCC 5462]
          Length = 377

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 145/333 (43%), Gaps = 61/333 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRK------DRLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+++ V + +   K            +S   Q 
Sbjct: 13  ITAQAPGKLYVAGEYAVVETGFPAIIVALDQFVTVTVEATKHFGSIVSEQYQENSLYWQR 72

Query: 61  CGSLDLAMFHPS---FSFIIMAINHI--------KPSCGFDLKVISQLDSQ----LGLGS 105
            G  D  +F      F +I+ AI           KP   + L + SQLD++     GLGS
Sbjct: 73  QG--DEMVFDNRDNPFHYILSAIKLTEQYARELNKPLALYKLYIDSQLDAKDGKKYGLGS 130

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--- 162
           SAA+TVA   AL    Y  + S D+I   A    L VQG  S  D+AAS++GG I Y   
Sbjct: 131 SAAVTVATIKALAKF-YDLKMSKDQIYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 189

Query: 163 --------------------QMPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                               + P+ SIE +     + L+  ++G    T+Q++ KI+  +
Sbjct: 190 DKAWLAAARNQMSLSALINAEWPELSIELLTAPADMQLLIGWTGSPASTSQLVDKITLAK 249

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL------GVSD 254
            + P++   +  + A    L ++     R  +L  +   +   + LL+ L       +  
Sbjct: 250 AKKPQL--YHDFLTASRETLEKL-IDGFREHSLSHIQAGIRSNRELLDELAHFSGVAIQT 306

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L ++V  L EQ    A+K SG+G GDC I L
Sbjct: 307 PALRQLV-TLAEQAG-GAAKSSGAGGGDCGIVL 337


>gi|312869936|ref|ZP_07730075.1| phosphomevalonate kinase [Lactobacillus oris PB013-T2-3]
 gi|311094521|gb|EFQ52826.1| phosphomevalonate kinase [Lactobacillus oris PB013-T2-3]
          Length = 370

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 151/350 (43%), Gaps = 76/350 (21%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDRLINIDSS-------LGQ 59
           I   APG L + GE+ V+ +G+ A++ A+++ V   +      +  I S        L +
Sbjct: 2   ITEKAPGKLYIAGEYAVVENGYPAVLVALDQFVTCTIKESAREMGQIFSRQYHNNQLLWR 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDSQ----LGLGSS 106
             G  + +      FS+I+ AI   +            +DL++ SQLDSQ     GLGSS
Sbjct: 62  RMGDQMVVDKRDNPFSYILSAIRVTEEYARQFERELRIYDLQIDSQLDSQNGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--- 163
           AA+TVA   AL    Y+   + DEI   A     +VQG  S  D+AAS++GG I Y    
Sbjct: 122 AAVTVATVKALCRF-YNLPVTKDEIFKLAAIAHFEVQGNGSLGDVAASVYGGWISYHSFD 180

Query: 164 --------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIEI 201
                                P   IE +     + L+  ++G    T+Q++ KIS  + 
Sbjct: 181 RQWLAQQRQYLDIKSLVDLPWPDLQIESLHAPENLQLLIGWTGKPASTSQLVDKISLFKA 240

Query: 202 EYPEINEINQKIYALMGKLSQISC-----QALRNKNLKVLAQAMNRQQGLLETLGVSD-- 254
                    Q  Y    + S+ SC          ++L+ + + +   + LL+ LG +   
Sbjct: 241 R-------RQDDYHRFLEESK-SCIQRMVDGFHQQDLERIKREIRYNRDLLKQLGANSGV 292

Query: 255 -------SKLSEIVWKLREQPHIMASKISGSGLGDC-VIALGK-GDLNSL 295
                  ++L +I      +    A+K SG+G GDC ++A+ +  D N++
Sbjct: 293 DIETPVLNRLCQIA-----EQFGGAAKTSGAGGGDCGIVAIDQNADFNAV 337


>gi|289191663|ref|YP_003457604.1| mevalonate kinase [Methanocaldococcus sp. FS406-22]
 gi|288938113|gb|ADC68868.1| mevalonate kinase [Methanocaldococcus sp. FS406-22]
          Length = 312

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 142/299 (47%), Gaps = 37/299 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL----- 64
           +  P  ++L GEH V++G+ A+  AI+  +   + +R+     I  +L     SL     
Sbjct: 3   IETPSKVILFGEHAVVYGYRAISMAID--LTSTIEIREIDRNEIILNLNDLNKSLRLNLE 60

Query: 65  DLAMFHPS----FSFIIMAINH------IKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           D+   +P+    F + + AI +      I+P  GF++ + S++    GLGSSA+IT+   
Sbjct: 61  DIKNINPNNFGDFKYCLCAIKNTLNYINIEPKTGFEINISSKIPISCGLGSSASITIGTI 120

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A+    Y KE   +EI    + +  ++QG +S  D +   + G++  +  K    K +F
Sbjct: 121 RAVSEF-YDKELKDNEIAKLGYTVEKEIQGKASITDTSTITYRGILEIKNNKPKKIKGNF 179

Query: 175 IFPIH-----LIY-SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
              +      ++Y    K  TA+++ +++ IE +    +EI ++I  ++ K       AL
Sbjct: 180 EEFLKSCKFLIVYVEERKKKTAELVNEVAKIENK----DEIFKEIDKIIDK-------AL 228

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +  + +   + M +   LL+ L +S  K+  +V           +K++G+G G CVI L
Sbjct: 229 KVNSKEEFGKLMTKNHELLKKLNISTPKIDRVVD--IGNRFGFGAKLTGAGGGGCVIIL 285


>gi|302023327|ref|ZP_07248538.1| mevalonate kinase [Streptococcus suis 05HAS68]
 gi|330832128|ref|YP_004400953.1| mevalonate kinase [Streptococcus suis ST3]
 gi|329306351|gb|AEB80767.1| mevalonate kinase [Streptococcus suis ST3]
          Length = 311

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 136/284 (47%), Gaps = 15/284 (5%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLI---NIDSSLGQYCGSLDLA 67
           A G ++LMGEH V++G  A+    +   +I  +T + + L    +    L      +  +
Sbjct: 7   ANGKIILMGEHAVVYGQPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPKIWES 66

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H +  F +  I          +++ S + ++ G+GSSAA+ VA+  AL    Y KE +
Sbjct: 67  LKH-AIRFSLYRIG-APTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YKKELT 123

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             E+     +      G  SGID AA+  G    + +    IE  +  F  HL+   +G 
Sbjct: 124 DSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKFHAHLVVADTGV 182

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + +  ++ +  + PE  ++ ++    +G L++ + + L     ++L   MN+   
Sbjct: 183 TGNTLEAISDVADLLEKKPEAIKLVEE----LGNLTRQAKEDLATDQAELLGSRMNQAHA 238

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +
Sbjct: 239 LLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALAR 281


>gi|121706910|ref|XP_001271672.1| mevalonate kinase [Aspergillus clavatus NRRL 1]
 gi|119399820|gb|EAW10246.1| mevalonate kinase [Aspergillus clavatus NRRL 1]
          Length = 536

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 157/377 (41%), Gaps = 78/377 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINI---DSSLGQYCGSL 64
           VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R + +   D  L       
Sbjct: 91  VSAPGKVIVYGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTVTMNFRDIGLDHTWNID 150

Query: 65  DLA---MFHPS---FSFIIMA-------------INHIKPSCGFDLKVISQLDSQL---- 101
           DL      HPS   F + ++              ++ + P    D++ I +  +      
Sbjct: 151 DLPWDVFHHPSKKKFYYNLVTSLDPELVDAIQPHVDAVSPDKPEDVRKIHRRSASAFLYL 210

Query: 102 ------------------------GLGSSAAITVAITAALLTLQY------HKEPSPDEI 131
                                   GLGSSA++ V ++AALL LQ       H +  PDE 
Sbjct: 211 FLSLGSPQTPGAIYTLRSTIPIGAGLGSSASVCVCLSAALL-LQIRTLAGPHPDQPPDEA 269

Query: 132 LTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPI 178
            T    I        +   G  SG+D   S  G  + ++   Y+     I   +F   P+
Sbjct: 270 ETQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVIFRREDYTKPPTVIPLPNFPELPL 329

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNL 233
            L+ +     TA  + K+  ++ ++P + E     I++   A    +  I+ + +  + L
Sbjct: 330 LLVDTRQARSTAAEVAKVGKLKDDHPVVTEAILDAIDKVTLAAQEAIQDINSKGVSAQIL 389

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
           + L   +    G L +LGVS  +L E + +L +  +I  +K++G+G G C I + + D+ 
Sbjct: 390 EHLGTLIRINHGFLVSLGVSHPRL-ERIRELVDYANIGWTKLTGAGGGGCAITVLRPDVK 448

Query: 294 SLPYQSVNCHMHAKGID 310
               + +   +  +G +
Sbjct: 449 EEAVRDLEQKLSVEGFE 465


>gi|15674901|ref|NP_269075.1| mevalonate kinase [Streptococcus pyogenes M1 GAS]
 gi|71910495|ref|YP_282045.1| mevalonate kinase [Streptococcus pyogenes MGAS5005]
 gi|13622041|gb|AAK33796.1| mevalonate kinase [Streptococcus pyogenes M1 GAS]
 gi|71853277|gb|AAZ51300.1| mevalonate kinase [Streptococcus pyogenes MGAS5005]
          Length = 297

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 134/287 (46%), Gaps = 40/287 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 15  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 60

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 61  TLSTAIYASLDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 116

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D++L     +V K + I+    SG+D    +    I + +     E I+     +LI  
Sbjct: 117 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKF-IRNIGFETIEIALNGYLIIA 172

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + + K++  E       E N    A +G L+Q   +A+  KN   + Q M 
Sbjct: 173 DTGIHGHTREAVNKVAQFE-------ETNLPYLAKLGALTQALERAINQKNKVAIGQLMT 225

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +    L+ +GVS SK  ++V +   +   + +K++G GLG C+IAL 
Sbjct: 226 QAHSALKAIGVSISKADQLV-EAALRAGALGAKMTGGGLGGCMIALA 271


>gi|50914045|ref|YP_060017.1| mevalonate kinase [Streptococcus pyogenes MGAS10394]
 gi|56808907|ref|ZP_00366616.1| COG1577: Mevalonate kinase [Streptococcus pyogenes M49 591]
 gi|94988368|ref|YP_596469.1| mevalonate kinase [Streptococcus pyogenes MGAS9429]
 gi|94992250|ref|YP_600349.1| mevalonate kinase [Streptococcus pyogenes MGAS2096]
 gi|94994170|ref|YP_602268.1| Mevalonate kinase [Streptococcus pyogenes MGAS10750]
 gi|139473959|ref|YP_001128675.1| mevalonate kinase [Streptococcus pyogenes str. Manfredo]
 gi|209559229|ref|YP_002285701.1| Mevalonate kinase [Streptococcus pyogenes NZ131]
 gi|306827527|ref|ZP_07460810.1| mevalonate kinase [Streptococcus pyogenes ATCC 10782]
 gi|50903119|gb|AAT86834.1| Mevalonate kinase [Streptococcus pyogenes MGAS10394]
 gi|94541876|gb|ABF31925.1| mevalonate kinase [Streptococcus pyogenes MGAS9429]
 gi|94545758|gb|ABF35805.1| Mevalonate kinase [Streptococcus pyogenes MGAS2096]
 gi|94547678|gb|ABF37724.1| Mevalonate kinase [Streptococcus pyogenes MGAS10750]
 gi|134272206|emb|CAM30452.1| mevalonate kinase [Streptococcus pyogenes str. Manfredo]
 gi|209540430|gb|ACI61006.1| Mevalonate kinase [Streptococcus pyogenes NZ131]
 gi|304430325|gb|EFM33351.1| mevalonate kinase [Streptococcus pyogenes ATCC 10782]
          Length = 292

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 134/287 (46%), Gaps = 40/287 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D++L     +V K + I+    SG+D    +    I + +     E I+     +LI  
Sbjct: 112 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKF-IRNIGFETIEIALNGYLIIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + + K++  E       E N    A +G L+Q   +A+  KN   + Q M 
Sbjct: 168 DTGIHGHTREAVNKVAQFE-------ETNLPYLAKLGALTQALERAINQKNKVAIGQLMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +    L+ +GVS SK  ++V +   +   + +K++G GLG C+IAL 
Sbjct: 221 QAHSALKAIGVSISKADQLV-EAALRAGALGAKMTGGGLGGCMIALA 266


>gi|315641782|ref|ZP_07896786.1| mevalonate kinase [Enterococcus italicus DSM 15952]
 gi|315482457|gb|EFU72996.1| mevalonate kinase [Enterococcus italicus DSM 15952]
          Length = 312

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 136/300 (45%), Gaps = 49/300 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL-AMFH 70
           A G ++LMGEH V++G  A+ F                   I +S+ +     +L + +H
Sbjct: 9   ATGKIILMGEHAVVYGEPAIAFPFTG-------------TKIRASVSESVSGNELTSSYH 55

Query: 71  P-SFSFIIMAINHIKP----------SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
             S S I  A+ +++           +  F L++ S + ++ G+GSSAA+ VAIT A   
Sbjct: 56  SGSLSNIPEALANVRALTTRLQKELVTPDFQLQIDSTIPAERGMGSSAAVAVAITRAFFD 115

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH 179
            Q  ++ + +++L   +       G  SGID AA+     I ++  K         FP+H
Sbjct: 116 WQ-ERDLTEEQLLFYVNYSEQIAHGNPSGIDAAATSGSHPIFFRKNKEITS-----FPLH 169

Query: 180 L------IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYA----LMGKLSQISCQALR 229
           L        +G K  T   +K ++       +++E++Q   +     +G+L++ + +A+ 
Sbjct: 170 LDAYLLVADTGIKGQTRAAVKSVA-------QLHEVDQAFTSNHLQQIGRLTKRAQKAIM 222

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
               + L   M      L +L VS++ L+E + +L      + +K++G G G C I L K
Sbjct: 223 GNRPEELGLLMTEAHLRLASLHVSNTTLNEYI-RLALSEGALGAKLTGGGRGGCFIVLTK 281


>gi|21910131|ref|NP_664399.1| mevalonate kinase [Streptococcus pyogenes MGAS315]
 gi|28896170|ref|NP_802520.1| mevalonate kinase [Streptococcus pyogenes SSI-1]
 gi|9937400|gb|AAG02450.1|AF290097_1 mevalonate kinase [Streptococcus pyogenes]
 gi|21904323|gb|AAM79202.1| mevalonate kinase [Streptococcus pyogenes MGAS315]
 gi|28811420|dbj|BAC64353.1| putative mevalonate kinase [Streptococcus pyogenes SSI-1]
          Length = 292

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 134/287 (46%), Gaps = 40/287 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D++L     +V K + I+    SG+D    +    I + +     E I+     +LI  
Sbjct: 112 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKF-IRNIGFETIEIALNGYLIIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + + K++  E       E N    A +G L+Q   +A+  KN   + Q M 
Sbjct: 168 DTGIHGHTREAVNKVAQFE-------ETNLPYLAKLGALTQALERAINQKNKVAIGQLMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +    L+ +GVS SK  ++V +   +   + +K++G GLG C+IAL 
Sbjct: 221 QAHSALKAIGVSISKADQLV-EAALRAGALGAKMTGGGLGGCMIALA 266


>gi|284165812|ref|YP_003404091.1| mevalonate kinase [Haloterrigena turkmenica DSM 5511]
 gi|284015467|gb|ADB61418.1| mevalonate kinase [Haloterrigena turkmenica DSM 5511]
          Length = 328

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 137/299 (45%), Gaps = 30/299 (10%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLG----QYCG- 62
           SAPG + L GEH V++G  A+  AI  R  + +  R D  + +   D SL     +Y G 
Sbjct: 5   SAPGKVYLFGEHAVVYGEPAVPCAIELRARVDVEQRTDSKLRVHAEDLSLDGFTVEYAGE 64

Query: 63  -----SLDLA--MFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAIT 110
                 +D++  + + +  ++  AI  ++        GFD+ + S +    GLGSSAA+ 
Sbjct: 65  PEGRPDVDVSESLLNAAMGYVDSAIEQVRDVTGEDDVGFDVTIESDIPLGAGLGSSAAVA 124

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQMPK-YS 168
           VA   A  T +       DE+   A+    +VQG  +S  D   S  GG +  +     S
Sbjct: 125 VAAIDAG-TRELGTTLEIDELAERAYRTEHEVQGGQASRADTFCSATGGAVRVEGDDCRS 183

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
           +E  +   PI + + G    T +++  +  +  EY    E        +G + +    AL
Sbjct: 184 LEAPEL--PIVIGFDGGAGDTGELVAGVRDLREEY----EFAADTVEAIGDIVRRGEDAL 237

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              +++ L + MN   GLL  LGVS   L  +VW  R+    + +K++G+G G C++ L
Sbjct: 238 AAGDIEELGRLMNFNHGLLSALGVSSRTLDSMVWAARD-AGALGAKLTGAGGGGCIVGL 295


>gi|194043103|ref|XP_001929219.1| PREDICTED: mevalonate kinase-like [Sus scrofa]
          Length = 393

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 130/318 (40%), Gaps = 74/318 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-------------------TLRKD 48
           + VSAPG ++L GEH V+HG  AL  A+N R  L L                   T    
Sbjct: 6   LLVSAPGKVILHGEHSVVHGKVALAVALNLRTFLRLQPHNSGKVSLRLPNIGIQQTWDVA 65

Query: 49  RLINIDSS-------------LGQYCGSLDLAMFH-----PSFSFIIMAI---NHIKPSC 87
           RL  +D+S             L +  G    +  H     P+F ++ + I       PS 
Sbjct: 66  RLQLLDTSFLEQGDLTEQVEKLKEVAGFSKDSTNHDCLAVPAFLYLYLTICRSQRTLPS- 124

Query: 88  GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTTAH 136
             D+ V S+L +  GLGSSAA +V + AALLT    + P+P           +E L   +
Sbjct: 125 -LDIAVWSELPTGAGLGSSAAYSVCLAAALLT-ACEEIPNPLKDGEATGRWTEENLELIN 182

Query: 137 AIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQV 192
               +    + G  SG+D A S  GG + YQ  K S  K      I L+ +     T  +
Sbjct: 183 KWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISPLKRLPTLEILLVNTKVPRSTKAL 242

Query: 193 LKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN----------KNLKVLAQAMNR 242
           +  +    +++PEI      I  L+  +  IS +  R           ++  VL + ++ 
Sbjct: 243 VASVRNRMLKFPEI------IAPLLASMDAISLECERVLGEMAAAPALEHYLVLEELIDM 296

Query: 243 QQGLLETLGVSDSKLSEI 260
            Q  L  LGV  + L ++
Sbjct: 297 NQHHLNALGVGHASLDQL 314


>gi|227544620|ref|ZP_03974669.1| phosphomevalonate kinase [Lactobacillus reuteri CF48-3A]
 gi|300910250|ref|ZP_07127710.1| phosphomevalonate kinase [Lactobacillus reuteri SD2112]
 gi|227185403|gb|EEI65474.1| phosphomevalonate kinase [Lactobacillus reuteri CF48-3A]
 gi|300892898|gb|EFK86258.1| phosphomevalonate kinase [Lactobacillus reuteri SD2112]
          Length = 375

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 143/337 (42%), Gaps = 72/337 (21%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKD-------RLINIDS-SLG 58
           I   APG L + GE+ V+ +G+ A++ A+++ V   +            R  N D  S  
Sbjct: 2   ITEKAPGKLYIAGEYAVVENGYPAVLVALDQFVTCTIEESTQEVGQIISRQYNNDQLSWR 61

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSS 106
           +    + +      FS+I+ AI   +            F++ + SQLDS    + GLGSS
Sbjct: 62  RLGDQMVVDKRDNPFSYILSAIRVTEEYARTFSRDLRIFNIHIDSQLDSANGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AA+TVA   AL    Y+   + D+I   A     +VQG  S  D+AAS++GG I Y    
Sbjct: 122 AAVTVATVKALCRF-YNLPVNKDQIFKLAAIAHFEVQGNGSLGDVAASVYGGWISYHSFD 180

Query: 163 -----QMPKYSIEK--IDFIFP------------IHLI--YSGYKTPTAQVLKKISYI-- 199
                Q  KY   K  ID  +P            + L+  ++G    T+Q++ KIS    
Sbjct: 181 RQWLAQQRKYLDLKTIIDLPWPDLNIESLTAPKNLELLIGWTGKPASTSQLVDKISLFKA 240

Query: 200 --EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSD--- 254
             + EY    E ++     M             ++L+ +   +   + LL+ LG +    
Sbjct: 241 RRQTEYHHFLEKSKSCIQRM-------VDGFHRQDLEAIKNEIRYNRDLLKQLGTNSGVN 293

Query: 255 ------SKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
                 SKL +I      +    A+K SG+G GDC I
Sbjct: 294 IETESLSKLCQIA-----ESFGGAAKTSGAGGGDCGI 325


>gi|315045368|ref|XP_003172059.1| mevalonate kinase [Arthroderma gypseum CBS 118893]
 gi|311342445|gb|EFR01648.1| mevalonate kinase [Arthroderma gypseum CBS 118893]
          Length = 519

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 154/379 (40%), Gaps = 82/379 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 76  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 133

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 134 IDSLPWEVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEIRKIHQASANQFL 193

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 194 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 252

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 253 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 312

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE--INQKIYALMGKLSQISCQALR---NK 231
            + LI S     TA  + K++ ++  +P + E  ++   +A     S I+        + 
Sbjct: 313 KLLLINSRQPRSTAVEVAKVATLKKAHPLVTESVLDSIEHATESAYSLIASDEFDEHCSD 372

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
            +  L Q      GLL +LGVS  +L  I  +L +  +I  +K++G+G G C I L K +
Sbjct: 373 KIDHLGQLFRINHGLLVSLGVSHPRLERIR-ELVDHANIGWTKLTGAGGGGCTITLLKAN 431

Query: 292 LNSLPYQSVNCHMHAKGID 310
            N    + +   +  +G D
Sbjct: 432 WNEEAIEHLEEQLDDEGYD 450


>gi|162452483|ref|YP_001614850.1| phosphomevalonate kinase [Sorangium cellulosum 'So ce 56']
 gi|161163065|emb|CAN94370.1| Phosphomevalonate kinase [Sorangium cellulosum 'So ce 56']
          Length = 336

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 101/224 (45%), Gaps = 35/224 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + V APG LVL G + VL G  ALV A++ R +L    R   L+  +       G+LD A
Sbjct: 1   MIVRAPGKLVLSGAYAVLEGAPALVAAVD-RYVLADPARPAALVTDEVQAAIDAGALDAA 59

Query: 68  MFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-- 120
            +     F   A+   +P     S G   +  S+   +LGLGSSAAI VA  AA      
Sbjct: 60  AW-----FDASALRSAEPEPPLASPGAPPREASR---KLGLGSSAAILVATLAARAAAAS 111

Query: 121 ------------QYHKEPS--PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM-P 165
                       +  + P+  P  +   A A   + QG  SG+D+AAS++GG++C ++ P
Sbjct: 112 EARAARGVQRVQRVQRAPAWDPRALFLDALAAHRRAQGGGSGVDVAASVYGGVLCCRLGP 171

Query: 166 KYSIEKIDFIFP----IHLIYSGYKTPTAQVLKKISYIEIEYPE 205
              ++      P    I +  S     T+ +L+++  +    PE
Sbjct: 172 GGELDVAPHALPGGLVIEVFASDASARTSAMLERVRALAAREPE 215


>gi|323342436|ref|ZP_08082668.1| phosphomevalonate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463548|gb|EFY08742.1| phosphomevalonate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 344

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 143/328 (43%), Gaps = 60/328 (18%)

Query: 13  PGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           PG L LMGE+ ++  G  A++ AI++ + +Y+         ++S  G   G+ ++ M + 
Sbjct: 7   PGKLFLMGEYAIMEPGQKAVIAAIDRFLNVYI--EPSEQFEVNSRYGDLQGT-EIFMQND 63

Query: 72  SFSFIIMAIN--------HIKPSCGFDLKVISQLDS----QLGLGSSAAITVAITAALLT 119
           +   +  AI           KP   F + + S+LDS    + G GSS  + VA+  A+L 
Sbjct: 64  NLVHVKAAIEMSRRYLKFKKKPMISFKMHIESELDSDNQRKYGFGSSGVVIVAVIDAILK 123

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH 179
           L      S +    +  A V+ V  +SSG DLA++  GGL+ Y+    S   ++ +  ++
Sbjct: 124 LHDVNLDSLELFKLSVMAQVI-VGEMSSGGDLASTCFGGLVAYERYDESWLIVEDMCNMN 182

Query: 180 LIYSGY-------------------------KTPTAQVLKKISYIEIEYPE--INEINQK 212
           L+++ +                           P    ++++S     Y E  +N+ N  
Sbjct: 183 LVHTSWPGLVIEPLISNSVKLCVGWTGTVNQTAPFVDSVRELSSTNPNYYESFLNDAN-- 240

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG------VSDSKLSEIVWKLRE 266
                 +L  +   A    N  +L+QA+N  + L+  LG      +  ++L+ ++     
Sbjct: 241 ------RLVDLFIIAWNQDNFGMLSQAINNYRLLMLELGNRADINIETNELTALI--ESA 292

Query: 267 QPHIMASKISGSGLGDCVIALGKGDLNS 294
           Q     +KISGSG GDC  AL   + N 
Sbjct: 293 QNLDFPAKISGSGGGDCGFALISENFNE 320


>gi|156054466|ref|XP_001593159.1| hypothetical protein SS1G_06081 [Sclerotinia sclerotiorum 1980]
 gi|154703861|gb|EDO03600.1| hypothetical protein SS1G_06081 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 473

 Score = 67.0 bits (162), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 155/357 (43%), Gaps = 78/357 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------NID 54
           VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I             NID
Sbjct: 32  VSAPGKVIVFGEHAVVHGKPAIAAAISLRSYLLVTALSKSKRTISLRFPDINLSHTWNID 91

Query: 55  S---------SLGQY----CGSLD---LAMFHP----------------------SFSFI 76
                     S  +Y      SLD   +A   P                      SF +I
Sbjct: 92  DLPWSTFSHPSKKKYYYDQVTSLDPELVAAMKPHLENISPDESPSIRKIHQSSASSFLYI 151

Query: 77  IMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
            +++     P C + L+  S +    GLGSSA+I+V +++A LL ++    P PD+    
Sbjct: 152 FLSLGSQSFPGCLYTLR--STIPIGAGLGSSASISVCLSSALLLQIRTLSGPHPDQPSNE 209

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQ-MPKYSIEKI--DFI-FPIH 179
           A   + ++            G  SG+D   S  G  + YQ  P+    K   DF   P+ 
Sbjct: 210 ASLQLERINRWAFVGEMCIHGNPSGVDNTVSTQGKAVIYQKFPEGPTVKPLRDFPELPLL 269

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK--LSQISCQALRNKNLKV-- 235
           L+ +     TA  + K+  ++ ++P I +       ++G+   + IS     ++N++   
Sbjct: 270 LVDTQQAKSTAHEVAKVGLLKEKHPAIVDSILDAIDMVGQSAAAMISDPNYDSENIECVE 329

Query: 236 -LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
            L + M    GLL +LGVS  +L E + +L +   I  +K++G+G G C I L K D
Sbjct: 330 SLGKLMTINHGLLVSLGVSHPRL-ERIRELVDHEGIGWTKLTGAGGGGCSITLLKPD 385


>gi|148656261|ref|YP_001276466.1| mevalonate kinase [Roseiflexus sp. RS-1]
 gi|148568371|gb|ABQ90516.1| mevalonate kinase [Roseiflexus sp. RS-1]
          Length = 314

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 122/292 (41%), Gaps = 26/292 (8%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINK---RVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           SAPG ++L GEH V++G  A+   +N    RV +        +      LG+    L  +
Sbjct: 4   SAPGKIILCGEHAVVYGRPAIAIPLNDVRARVSIIPGAPGSGVCFDAPDLGRRW--LITS 61

Query: 68  MFHPSFSFIIMAINH---IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
             H   S + +AI     ++     ++ + S +    G+GS AAI  AI  AL +  Y +
Sbjct: 62  APHDPLSELTLAILRQFGVQRMPDIEIAITSDIPIASGMGSGAAIATAIVRALAS-AYGR 120

Query: 125 EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHL- 180
             S  E+    +    +  G  SGID     +  +I +Q    P + IE I    P  L 
Sbjct: 121 NLSAAEVSALVYESEQRFHGTPSGIDNTVIAYEQVIWFQRRSEPPHQIEPIAIAEPFTLL 180

Query: 181 -----IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
                + S  + P  +V ++       Y       + ++  +  +   + +AL   +   
Sbjct: 181 IGDTGVRSATRLPVGEVRRRWERDPSRY-------EMLFDAVADVVYQARRALAEGDRAA 233

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   ++R Q LLE +GVS  +L  ++           +K+SG G G  +IAL
Sbjct: 234 LGPLLDRNQALLEEIGVSSPELERLI-TAARSAGAGGAKLSGGGWGGVMIAL 284


>gi|327311566|ref|YP_004338463.1| mevalonate kinase [Thermoproteus uzoniensis 768-20]
 gi|326948045|gb|AEA13151.1| mevalonate kinase [Thermoproteus uzoniensis 768-20]
          Length = 314

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 130/294 (44%), Gaps = 22/294 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-----TLRKDRLINIDSSLGQYCG 62
           I V APG + L GEH V++G  A+  A++K V +       T+ +     +D       G
Sbjct: 2   IRVFAPGVVKLFGEHAVVYGKPAIAVAVDKGVEVACEKGDKTVVRTGKAYVDIEYEHGTG 61

Query: 63  SLDLAMFHPSFSFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVAIT---AA 116
           +       P  S++  A+   + S G      ++       +G  +SA+++V I    +A
Sbjct: 62  AAHAKGHEPFLSYVAAALRKAEESFGRLAASFEIRGDFPPSVGAATSASVSVGILKAYSA 121

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID-FI 175
            L +   K     E+   AH + L+VQG +S +D A S  GG++  +   +S  +ID  +
Sbjct: 122 CLGVDVGKA----ELAKLAHGVELEVQGAASPMDTAVSAIGGMLRIEPNPFSYRRIDSAV 177

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
               L     +  T  ++  +  ++     ++ +   I    G+L   +   L + +L+ 
Sbjct: 178 DGFVLAVLPRRGTTKDIVAGVRALKARRRSVDAVIDAI----GRLVDEAEGCLASSDLEC 233

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           + + M     LL  LGV    +  ++  L+  P+I   KISG+G G  V+ L K
Sbjct: 234 VGELMEINNWLLGALGVVGHDVVMMLKYLK--PYIYGGKISGAGRGGIVVLLPK 285


>gi|14602065|ref|NP_148611.1| mevalonate kinase [Aeropyrum pernix K1]
 gi|8928161|sp|Q9Y946|KIME_AERPE RecName: Full=Mevalonate kinase; Short=MK
 gi|5106143|dbj|BAA81454.1| mevalonate kinase [Aeropyrum pernix K1]
          Length = 324

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 146/293 (49%), Gaps = 23/293 (7%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-DRLINIDSS-LGQYCGSLD--- 65
           SAPG ++++GEH V+ G  A+V AI +R  L +T+R   + I ++SS LG++   L    
Sbjct: 8   SAPGKVIIVGEHFVVRGSLAIVAAIGRR--LRVTVRSGGKGIVLESSMLGRHSAPLPGQG 65

Query: 66  -LAMFHPSFSFIIMAINHIKPSCGFDLK-----VISQLDSQLGLGSSAAITVAITAALLT 119
             A   P     I  +  +  + G+ +      V S +  + GLGSSAA  VA   AL  
Sbjct: 66  AAAKVSPVLEPYIAVLRSLA-ARGYSVVPHTILVESGIPPRAGLGSSAASMVAY--ALSY 122

Query: 120 LQYHKEP-SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
              H +P S +++ + A        G  SG+D+  ++ GG++ Y+  +  ++    +  +
Sbjct: 123 SAMHGDPLSAEDLYSVAMEGEKIAHGKPSGVDVTIAVRGGVLAYRRGENPVDIRPGLTGV 182

Query: 179 HLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
            L+   +G +  T  V++ +  I      + E +  IY     +++ +  A+   + + L
Sbjct: 183 TLLVADTGVERRTRDVVEHVLSIA---DALGEASTYIYRAADLIAREALHAIEKGDAERL 239

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
              MN  QGLL +LG S  ++  +V+++R     + +K++G+G G CVI L K
Sbjct: 240 GLIMNAAQGLLSSLGASSLEIETLVYRMR-SAGALGAKLTGAGWGGCVIGLFK 291


>gi|71903327|ref|YP_280130.1| mevalonate kinase [Streptococcus pyogenes MGAS6180]
 gi|71802422|gb|AAX71775.1| mevalonate kinase [Streptococcus pyogenes MGAS6180]
          Length = 292

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 134/287 (46%), Gaps = 40/287 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ A+   +    ++      D+ +  D              F+ 
Sbjct: 10  AHSKIILIGEHAVVYGYPAIALPLTDIEVVCHIFPADKPLVFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  I A    +  ++    ++  ++SQ+  + G+GSSAA+++A   A+ +  Y +EP 
Sbjct: 56  TLSTAIYAALDYLQRLQEPIAYE--IVSQVPQKRGMGSSAAVSIAAIRAVFS--YCQEPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D++L     +V K + I+    SG+D    +    I + +     E I+     +L+  
Sbjct: 112 SDDLLEI---LVNKAEIIAHTNPSGLDAKTCLSDHAIKF-IRNIGFETIEIALNGYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + + K++  E       E N    A +G L+Q   +A+  KN   + Q M 
Sbjct: 168 DTGIHGHTREAVNKVAQFE-------ETNLPYLAKLGALTQALERAINQKNKVAIGQLMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +    L+ +GVS SK  ++V +   +   + +K++G GLG C+IAL 
Sbjct: 221 QAHSALKAIGVSISKADQLV-EAALRAGALGAKMTGGGLGGCMIALA 266


>gi|222152926|ref|YP_002562103.1| mevalonate kinase [Streptococcus uberis 0140J]
 gi|222113739|emb|CAR41732.1| mevalonate kinase [Streptococcus uberis 0140J]
          Length = 292

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 136/279 (48%), Gaps = 34/279 (12%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++LMGEH V++G  A+   +    +       D  +  D     +  +L  A++     +
Sbjct: 14  IILMGEHSVVYGFPAIALPLKDIEVTCRIKASDTPLRFD-----FYDTLSTAIY-SGLDY 67

Query: 76  IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTA 135
           + +  NH      +D  ++SQ+  + G+GSSAA+++A   A+    Y  E   DE+L   
Sbjct: 68  LKIK-NH---PISYD--IVSQVPQKRGMGSSAAVSIAAIRAVF--DYFNEELSDELLEI- 118

Query: 136 HAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPT 189
             +V K + I+    SG+D    +    I + +     E ++     +LI   +G    T
Sbjct: 119 --LVNKAEIIAHTNPSGLDAKTCLSDQAIKF-IRNVGFESLNIHLDAYLIIADTGIHGHT 175

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            + ++K++  E       E N      +G+L++    A++N+++K +  +M +    L+ 
Sbjct: 176 REAVQKVAKYE-------ETNLPYLKQLGQLTEDVENAIKNRDIKTIGYSMTQAHEALKA 228

Query: 250 LGVSDSKLSEIVWK-LREQPHIMASKISGSGLGDCVIAL 287
           +GVS +K +++V + L+E    + +K+SG GLG C+IAL
Sbjct: 229 IGVSIAKANQLVEEALKEGA--LGAKMSGGGLGGCIIAL 265


>gi|227510339|ref|ZP_03940388.1| phosphomevalonate kinase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227189991|gb|EEI70058.1| phosphomevalonate kinase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 369

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 90/179 (50%), Gaps = 23/179 (12%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLG 58
           H I   APG L + GE+ V+  G+ +++ A+++ V + ++  K       +    DS   
Sbjct: 6   HLITAKAPGKLYIAGEYAVVETGYPSIIVALDQFVTVEISRSKSFGSIVSKQYREDSVFW 65

Query: 59  QYCGS-LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGS 105
           +  G  + L     +F++II AI   +            +DL+V S LDS    + GLGS
Sbjct: 66  RRQGDQMILDNRDNTFNYIISAIRLTEEYAKTLGRRMEVYDLRVNSDLDSPNGKKYGLGS 125

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           SAA+TVA   AL   ++++ P     L    AI  L VQG  S  D+AAS++GG I YQ
Sbjct: 126 SAAVTVATVKALC--EFYQIPLTKSKLFKLSAIAHLDVQGNGSLGDVAASVYGGWIAYQ 182


>gi|148544142|ref|YP_001271512.1| phosphomevalonate kinase [Lactobacillus reuteri DSM 20016]
 gi|184153515|ref|YP_001841856.1| mevalonate kinase [Lactobacillus reuteri JCM 1112]
 gi|194468007|ref|ZP_03073993.1| phosphomevalonate kinase [Lactobacillus reuteri 100-23]
 gi|227364571|ref|ZP_03848632.1| phosphomevalonate kinase [Lactobacillus reuteri MM2-3]
 gi|325682314|ref|ZP_08161831.1| phosphomevalonate kinase [Lactobacillus reuteri MM4-1A]
 gi|148531176|gb|ABQ83175.1| phosphomevalonate kinase [Lactobacillus reuteri DSM 20016]
 gi|183224859|dbj|BAG25376.1| mevalonate kinase [Lactobacillus reuteri JCM 1112]
 gi|194452860|gb|EDX41758.1| phosphomevalonate kinase [Lactobacillus reuteri 100-23]
 gi|227070408|gb|EEI08770.1| phosphomevalonate kinase [Lactobacillus reuteri MM2-3]
 gi|324978153|gb|EGC15103.1| phosphomevalonate kinase [Lactobacillus reuteri MM4-1A]
          Length = 375

 Score = 66.6 bits (161), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 147/337 (43%), Gaps = 72/337 (21%)

Query: 8   ICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYL--TLRK-----DRLINIDS-SLG 58
           I   APG L + GE+ V+ +G+ A++ A+++ V   +  ++++      R  N D  S  
Sbjct: 2   ITEKAPGKLYIAGEYAVVENGYPAILVALDQFVTCTIEESVQEVGQIISRQYNNDQLSWR 61

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSS 106
           +    + +      FS+I+ AI   +            F++ + SQLDS    + GLGSS
Sbjct: 62  RLGDQMVVDKRDNPFSYILSAIRVTEEYARTFSRDLRIFNIHIDSQLDSANGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AA+TVA   AL    Y+   + D+I   A     +VQG  S  D+AAS++GG I Y    
Sbjct: 122 AAVTVATVKALCRF-YNLPVNKDQIFKLAAIAHFEVQGNGSLGDVAASVYGGWISYHSFD 180

Query: 163 -----QMPKYSIEK--IDFIFP------------IHLI--YSGYKTPTAQVLKKISYI-- 199
                Q  KY   K  ID  +P            + L+  ++G    T+Q++ KIS    
Sbjct: 181 RQWLAQQRKYLDLKTIIDLPWPDLNIESLTAPKNLELLIGWTGKPASTSQLVDKISLFKA 240

Query: 200 --EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSD--- 254
             + EY    E ++     M             ++L+ +   +   + LL+ LG +    
Sbjct: 241 RRQTEYHHFLEKSKSCIQRM-------VDGFHRQDLEAIKNEIRYNRDLLKQLGTNSGVN 293

Query: 255 ------SKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
                 SKL +I      +    A+K SG+G GDC I
Sbjct: 294 IETESLSKLCQIA-----ESFGGAAKTSGAGGGDCGI 325


>gi|116871433|ref|YP_848214.1| mevalonate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116740311|emb|CAK19429.1| mevalonate kinase [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 322

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 124/279 (44%), Gaps = 14/279 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVIL--YLTLRKDRLINIDSSLGQYCGSL-DLAMFHPS 72
           ++L GEH V++G  A+     + V+     T  K R      S   + G L D+  F   
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVVTTNVETSTKTRF-----SSAFFTGDLEDMPDFLAG 64

Query: 73  F-SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
             + +I  +N I       + V S +    GLGSSAA+  +I   L    ++++    ++
Sbjct: 65  IKALVIDVLNEIGKGECVSIHVTSGVPIGRGLGSSAAVATSIARGLYKY-FNQKLDSKKL 123

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQ 191
           L   +       G +SG+D    +    + Y+  +  +E + F   I  + +    P+ +
Sbjct: 124 LAIVNDAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKITFVVADTGVPS-E 181

Query: 192 VLKKISYIEIEYPEINEINQKIYALMGKLS-QISCQALRNKNLKVLAQAMNRQQGLLETL 250
               +  +++ Y E      KI   +G +S +I      + +   +  AMNR Q  LETL
Sbjct: 182 TRDAVKDVQVLYKENQAEIGKIIQQLGDISREIKHHLEGDADTVKIGAAMNRAQSYLETL 241

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            VSDS L +++ K+        +K++G G G C+IA+ K
Sbjct: 242 TVSDSSLEKLI-KVARNSGADGAKLTGGGRGGCIIAVAK 279


>gi|227513347|ref|ZP_03943396.1| phosphomevalonate kinase [Lactobacillus buchneri ATCC 11577]
 gi|227083220|gb|EEI18532.1| phosphomevalonate kinase [Lactobacillus buchneri ATCC 11577]
          Length = 369

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 90/179 (50%), Gaps = 23/179 (12%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLG 58
           H I   APG L + GE+ V+  G+ +++ A+++ V + ++  K       +    DS   
Sbjct: 6   HLITAKAPGKLYIAGEYAVVETGYPSIIVALDQFVTVEISRSKSFGSIVSKQYREDSVFW 65

Query: 59  QYCGS-LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGS 105
           +  G  + L     +F++II AI   +            +DL+V S LDS    + GLGS
Sbjct: 66  RRQGDQMILDNRDNTFNYIISAIRLTEEYAQTLGRRMAVYDLRVNSDLDSPNGKKYGLGS 125

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           SAA+TVA   AL   ++++ P     L    AI  L VQG  S  D+AAS++GG I YQ
Sbjct: 126 SAAVTVATVKALC--EFYQIPLTKSKLFKLSAIAHLDVQGNGSLGDVAASVYGGWIAYQ 182


>gi|50287417|ref|XP_446138.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525445|emb|CAG59062.1| unnamed protein product [Candida glabrata]
          Length = 430

 Score = 66.2 bits (160), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/351 (23%), Positives = 140/351 (39%), Gaps = 74/351 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAIN--------------------------------K 37
           VSAPG ++L GEH  ++   A+  +++                                K
Sbjct: 11  VSAPGKVILFGEHSAVYNEPAVAASVSSLRTYLLVSPAGSNAEDSIELSFPDIGFDHVWK 70

Query: 38  RVILYLTLRKDRLI--------NIDSSLGQYCGSLDLAM--------FHPSFSFIIMAIN 81
           R  L   LR+  L+        N++  L    G L++ +        +H +F F+ +   
Sbjct: 71  RKELEPVLRETALLQAAREDTKNLNEEL---VGLLNVILEPLKESLHYHAAFCFLYLFCT 127

Query: 82  HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-----QYHKEPSPDEILTTAH 136
               +      V S L    GLGSSAAI+V++  A+L L             D+ L    
Sbjct: 128 LCPSATNIKFSVKSTLPIGAGLGSSAAISVSLAMAMLRLGGKLVTGESLSGEDKALINEW 187

Query: 137 AIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI-------FPIHLIYSGYKT 187
           A + +  + G  SGID A + +G  + ++         +F+        P+ L Y+    
Sbjct: 188 AFIGEKCIHGTPSGIDNAVATYGNAVLFKRSADGTTDFEFLDKFHELKIPMVLTYTRIPR 247

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL------RNKNLKVLAQAMN 241
            T  ++  +  +  +YP++  I   +   MG+L+  S   L       + N + L   +N
Sbjct: 248 STKVLVSSVRDLSNKYPKV--IQDHVIKAMGELALESVDILNSGIGGNDSNYERLLDLVN 305

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
              GLL  +GVS   L EI+  L     I A+K++G+G G C   +   D+
Sbjct: 306 INHGLLVAIGVSHPGL-EIIRNLSITNSIGATKLTGAGGGGCAFTVLNKDV 355


>gi|227524490|ref|ZP_03954539.1| phosphomevalonate kinase [Lactobacillus hilgardii ATCC 8290]
 gi|227088360|gb|EEI23672.1| phosphomevalonate kinase [Lactobacillus hilgardii ATCC 8290]
          Length = 369

 Score = 66.2 bits (160), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 90/179 (50%), Gaps = 23/179 (12%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLG 58
           H I   APG L + GE+ V+  G+ +++ A+++ V + ++  K       +    DS   
Sbjct: 6   HLITAKAPGKLYIAGEYAVVETGYPSIIVALDQFVTVEISRSKSFGSIVSKQYREDSVFW 65

Query: 59  QYCGS-LDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGS 105
           +  G  + L     +F++II AI   +            +DL+V S LDS    + GLGS
Sbjct: 66  RRQGDQMILDNRDNTFNYIISAIRLTEEYAQTLGRRMAVYDLRVNSDLDSPNGKKYGLGS 125

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           SAA+TVA   AL   ++++ P     L    AI  L VQG  S  D+AAS++GG I YQ
Sbjct: 126 SAAVTVATVKALC--EFYQIPLTKSKLFKLSAIAHLDVQGNGSLGDVAASVYGGWIAYQ 182


>gi|332797141|ref|YP_004458641.1| mevalonate kinase [Acidianus hospitalis W1]
 gi|332694876|gb|AEE94343.1| mevalonate kinase [Acidianus hospitalis W1]
          Length = 318

 Score = 66.2 bits (160), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 121/258 (46%), Gaps = 19/258 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V  P  L L GEH V++G  A+  AIN+++ + + +   ++I   +SL      +DL 
Sbjct: 2   IEVEVPLKLTLFGEHAVVYGEPAIAMAINEKMKIKI-VPYHKMILKSNSLSIKGIKVDLE 60

Query: 68  MFH-------PSFSFIIMAINHIKPSCGFD----LKVISQLDSQLGLGSSAAITVAITAA 116
                        S+ +  IN  +   G      +++ S +D  +GLG+SAA+ V I   
Sbjct: 61  EMKLESEETSKVLSYALSTINFFEKEYGTRKNALIEIESPVDPSVGLGTSAAVIVGIVGG 120

Query: 117 LLT-LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
               L Y  E + +EI   +H I L VQG+ S +D   +  GGLI +       EKI   
Sbjct: 121 YSRYLGY--ELTREEIAKISHKIELTVQGLGSRMDTYTTSLGGLIYFHKGG-GYEKIRGE 177

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
             I   Y      TA++LK++  ++ + P++   N  I ++ GK    +  A+   + + 
Sbjct: 178 IRITAGYIRRIATTAEILKRVKSLKEKNPDL--FNDLISSI-GKTVNKAKIAIEKGDEEE 234

Query: 236 LAQAMNRQQGLLETLGVS 253
           + + M    GLL +LGV+
Sbjct: 235 IGELMYVNHGLLMSLGVT 252


>gi|119181177|ref|XP_001241830.1| hypothetical protein CIMG_05726 [Coccidioides immitis RS]
          Length = 612

 Score = 66.2 bits (160), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 89/376 (23%), Positives = 154/376 (40%), Gaps = 76/376 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL----RKDRLINI-DSSLGQYCG-- 62
           VSAPG +++ GEH V+HG  A+  AI+ R  L +T     R+   +N  D+ L       
Sbjct: 169 VSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWDID 228

Query: 63  SLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLKVISQ--------- 96
           SL   +F+ S                    I   I+++ P    +++ + Q         
Sbjct: 229 SLPWDVFNHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFLYL 288

Query: 97  ---------------LDSQL----GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTTAH 136
                          L S +    GLGSSA++ V ++AA LL ++    P PD+    + 
Sbjct: 289 YLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDESE 348

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPIH 179
             + ++            G  SG+D   S  G  + ++   YS     I  +DF   P+ 
Sbjct: 349 VQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPTVIPILDFPELPLL 408

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLK 234
           L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ L 
Sbjct: 409 LVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKNSSETLN 468

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                     GLL +LGVS  +L E + +L +   I  +K++G+G G C I L + D  S
Sbjct: 469 YFGTLFRINHGLLVSLGVSHPRL-ERIRELVDHTGIGWTKLTGAGGGGCAITLIRTDRES 527

Query: 295 LPYQSVNCHMHAKGID 310
              + +   +  +G +
Sbjct: 528 TALKPLERQLDEEGYE 543


>gi|78486073|ref|YP_391998.1| GHMP kinase [Thiomicrospira crunogena XCL-2]
 gi|78364359|gb|ABB42324.1| mevalonate kinase [Thiomicrospira crunogena XCL-2]
          Length = 349

 Score = 66.2 bits (160), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 131/312 (41%), Gaps = 50/312 (16%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAI-----------------------------NK 37
           K     P  L+L GEH VL G  AL  A+                             N 
Sbjct: 4   KTLCHTPAKLILTGEHAVLFGAPALSMAVDLPTQCDMNFTPDTGSKEPSCLEIELSDFNH 63

Query: 38  RVILYLTLRKDRLINIDSSLGQY---CGSLDLAMFHPSFSFIIMAINH------IKPSCG 88
           + I  L++ + R+I I++    Y     S+   +  P    I++          +KP   
Sbjct: 64  KQIYPLSIWQQRVIEIETRFALYEKQALSIQSVLQQP-VDLILLTFQQFHNAYRLKPG-H 121

Query: 89  FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD-EILTTAHAIVLKVQGISS 147
           + +K+ S   +  GLGSSA++ +++  +L +  +HK    D E+L+ A  +     G SS
Sbjct: 122 WGVKLQSHQLTGKGLGSSASVIISLLQSLFS--HHKLSYSDVELLSIAQRVESHQHGSSS 179

Query: 148 GIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEIN 207
           G+D    + GGL+ YQ      +     F   +I +G  TP +   + ++ +  E+    
Sbjct: 180 GLDPTTVLKGGLLRYQQGSPLQQLTSHHFHGWIIDTG--TPESTTGQAVNQVHREFSH-- 235

Query: 208 EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ 267
                I+     ++Q+  QA ++ +   L QA+   Q LLET+GV    +   +  L  Q
Sbjct: 236 --QHPIWTEFKNVAQLIEQAWQDSDAPQLKQAIKHNQQLLETIGVVPPTVQRFIHTLN-Q 292

Query: 268 PHIMASKISGSG 279
               A+KI G+G
Sbjct: 293 SSESAAKICGAG 304


>gi|116333506|ref|YP_795033.1| mevalonate kinase [Lactobacillus brevis ATCC 367]
 gi|116098853|gb|ABJ64002.1| phosphomevalonate kinase [Lactobacillus brevis ATCC 367]
          Length = 357

 Score = 66.2 bits (160), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 88/177 (49%), Gaps = 23/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLGQY 60
           I   APG L + GE+ V+  G+ A++ A+N+ V + +   +D      +    +S   Q 
Sbjct: 2   ISAQAPGKLYIAGEYAVVEPGYPAIIVALNQFVTVTIETSRDYGRIASKQYQENSLYWQR 61

Query: 61  CGS-LDLAMFHPSFSFIIMAINHI--------KPSCGFDLKVISQLDS----QLGLGSSA 107
            G+ L        F +I+ AI+          KP   + L V S+LDS    + GLGSSA
Sbjct: 62  QGTELVFDNRDNPFHYILSAIHLTEQYAQTLGKPLSIYHLNVNSELDSADGKKYGLGSSA 121

Query: 108 AITVAITAALLTLQYHKEP-SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           A+TVA   AL   Q++  P S D +   A    L VQG  S  D+AAS++GG I YQ
Sbjct: 122 AVTVATVKALC--QFYDIPMSQDRLFKLAAIAHLDVQGNGSLGDIAASVYGGWIAYQ 176


>gi|330834518|ref|YP_004409246.1| phosphomevalonate kinase [Metallosphaera cuprina Ar-4]
 gi|329566657|gb|AEB94762.1| phosphomevalonate kinase [Metallosphaera cuprina Ar-4]
          Length = 318

 Score = 66.2 bits (160), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 140/306 (45%), Gaps = 47/306 (15%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD---- 65
           VSAPG ++ +G + V+ G  + V AINKRV      R DRL  I +S G +    +    
Sbjct: 3   VSAPGKILWIGSYSVVFGGISHVIAINKRVRCKHE-RSDRLEFI-TSYGIFKEGENELID 60

Query: 66  --LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLD-SQLGLGSSAAITVAITAALLTLQY 122
             L +    F  I   I H+    GF      Q+D  + GLGSS+A TVA+TA L+ +  
Sbjct: 61  SVLKVIRERFPIIKGRI-HLVNDEGF------QIDGKKTGLGSSSAATVALTACLMRV-L 112

Query: 123 HKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI------ 175
             E   +EI   +  A  L+ +GI SG D+AA+  G ++  +     +EK+D        
Sbjct: 113 TGEFDLNEIYRLSQKANYLRQKGIGSGFDIAAATFGSVVYRRFK--DVEKVDSTVKPLRV 170

Query: 176 --FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKI---------YALMGKLSQ-I 223
             + I L ++G    T  ++++   +E   P   E+ ++I            MG L   I
Sbjct: 171 HDYQILLGFTGRSANTIDLVRRFHQME-NVPRFKELMKEIEIDNEMAIKLLEMGMLDNAI 229

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
               L  + L VLA+ +      LE     D K+ E    L E+     S + G+G GD 
Sbjct: 230 PHIKLARRYLNVLAKDVVG----LEIENEEDRKIIE----LAERNGAFISLMPGAGGGDL 281

Query: 284 VIALGK 289
           ++A+G+
Sbjct: 282 IMAMGE 287


>gi|227890029|ref|ZP_04007834.1| possible mevalonate kinase [Lactobacillus johnsonii ATCC 33200]
 gi|227849473|gb|EEJ59559.1| possible mevalonate kinase [Lactobacillus johnsonii ATCC 33200]
          Length = 305

 Score = 65.9 bits (159), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 135/294 (45%), Gaps = 31/294 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           KI V A G ++L+GEH V++G+ AL   I    I       D    +D++   Y G+  D
Sbjct: 4   KIEVKAHGKVILIGEHSVVYGYDALALPIQALNITTTVEETDGPTWMDTT--HYHGAFFD 61

Query: 66  LAMFHPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL-----LT 119
               +    +I+   +  +K +    +    ++  + G GSSA + +  T A+     LT
Sbjct: 62  APAEYDGIKYIVKTLLERVKNAPNLKITYTGEIPMERGFGSSAVVALGTTKAVSQFLGLT 121

Query: 120 LQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICY----QMPKYSIEKIDF 174
           L      S  EI+  T HA ++   G +SG+D AA+++   + +      PK   +K+  
Sbjct: 122 L------SESEIMEITNHAEMIN-HGKASGLD-AATVNSDYLVFFNKQDGPKQLFQKLGA 173

Query: 175 IFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
              I        T  A Q +KK         + +++ +K  A +G+L+  + Q   N+N 
Sbjct: 174 TLLIMDTGELGNTKVAVQSVKK-------QMDESDLKKKQIARLGELATATRQNWFNQNA 226

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + + +  N  + +L +  +S  ++  I  K+  +   + +K+SG GLG  VIAL
Sbjct: 227 EEIGKIFNEAEDILASFKLSTERIDNIC-KIANENGALGAKLSGGGLGGIVIAL 279


>gi|332523876|ref|ZP_08400128.1| mevalonate kinase [Streptococcus porcinus str. Jelinkova 176]
 gi|332315140|gb|EGJ28125.1| mevalonate kinase [Streptococcus porcinus str. Jelinkova 176]
          Length = 292

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 135/283 (47%), Gaps = 32/283 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G  A+   +    +  L    +  +  D     +  +L  A++  
Sbjct: 10  AHSKIILMGEHSVVYGFPAIALPLKDIEVTCLIKEANEKLKFD-----FYDTLSTAIY-S 63

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           +  F+ +     KP      ++ISQ+  + G+GSSAA+++A   A+    Y  +P  D++
Sbjct: 64  ALDFLQI---KEKP---ISYEIISQVPQKRGMGSSAAVSIAAIRAVF--DYFDQPINDDL 115

Query: 132 LTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
           L     +V K + I+    SG+D    +    I + +     E +      +L+   +G 
Sbjct: 116 LEI---LVNKAEIIAHTNPSGLDAKTCLSDHAITF-IRNVGFESLAINLEAYLVIADTGI 171

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + + K++  E       E N    A +GKL++   +A+ +K+++V+  AM +   
Sbjct: 172 HGHTREAVNKVAKFE-------ESNLPHLACLGKLTEEVHRAIISKDVEVMGHAMTQAHQ 224

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
            L+ +GVS  + S+++ +       + +K+SG GLG C+IAL 
Sbjct: 225 ELKAIGVSIEQ-SDLLVQEALAHQALGAKMSGGGLGGCIIALA 266


>gi|319440913|ref|ZP_07990069.1| phosphomevalonate kinase [Corynebacterium variabile DSM 44702]
          Length = 369

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 87/343 (25%), Positives = 145/343 (42%), Gaps = 83/343 (24%)

Query: 10  VSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLR------------KDRLINIDSS 56
           V APG L + GE+ V+  G+ A++ A+++    Y+T+R             D+  N  S 
Sbjct: 12  VRAPGKLYIAGEYAVVEPGYPAVLIAVDR----YITVRVSPASADTGHITTDQ--NAGSH 65

Query: 57  LGQYCGSLDLAMFHPS---FSFIIMAINHIK--------PSCGFDLKVISQLDS----QL 101
           L  Y    D+ +  P    FSF++ A+  ++        P   FDL + S+LD     + 
Sbjct: 66  LEWYRQGSDM-LIEPDQDQFSFVLAAVRIVEEAAVALGVPLQVFDLDITSELDDDSGRKF 124

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   AL    Y  + +  E L  A    ++VQ   SG D+AAS+ GG I 
Sbjct: 125 GLGSSAAVTVATVRALCA-HYKLKLTLMEQLKLALLASIEVQRSGSGGDVAASMFGGWIA 183

Query: 162 Y-----------------------QMPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKI 196
           Y                       + P  S+  +     + L+  ++G    T++++  +
Sbjct: 184 YTSFDREWAREQRAERPLVELVKAEWPGLSVRPLTPPESLRLLVGWTGSPASTSRLVGDV 243

Query: 197 SYIEIEYPEINEINQKIYALMGKLS------QISCQALRNKNLKVLAQAMNRQQGLLETL 250
                   + N+     ++  G L+      +    AL   + + +   + R + LL  L
Sbjct: 244 --------QSNKRGDAAWSYAGFLADSRDCVESFVSALDAADTEGVFAGIRRNRALLREL 295

Query: 251 G------VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           G      +    L  ++    +Q    A+K SG+G GDC I L
Sbjct: 296 GEHTGTTIETPTLRRLIESAEDQGG--AAKTSGAGGGDCGIVL 336


>gi|302418800|ref|XP_003007231.1| mevalonate kinase [Verticillium albo-atrum VaMs.102]
 gi|261354833|gb|EEY17261.1| mevalonate kinase [Verticillium albo-atrum VaMs.102]
          Length = 445

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 112/242 (46%), Gaps = 33/242 (13%)

Query: 73  FSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAI-TAALLTLQYHKEPSPDE 130
           F ++ +++ H   P C + L+  S +    GLGSSA+I V + TA LL L+    P PD+
Sbjct: 116 FLYLFLSLGHQSFPGCLYTLR--STIPIGAGLGSSASIAVCVATALLLQLRTLSGPHPDQ 173

Query: 131 ILTTAHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEKI-----DF 174
               A   + ++            G  SG+D   S  G  + YQ P Y+   +     DF
Sbjct: 174 PPDEARLQIERINRWAFVYEMCIHGNPSGVDNTVSTQGKAVVYQRPDYTKPPLVRPLWDF 233

Query: 175 I-FPIHLIYSGYKTPTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISC 225
              P+ LI +     TA+ + K++ ++  + +        I+++ Q + +L   +     
Sbjct: 234 PELPLLLIDTKQSKSTAREVAKVAKLKDTHTKLVGSILDAIDKVTQSVTSL---IDDEDF 290

Query: 226 QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
            +   ++L+ + + M    GLL  LGVS  +L  I  +L +   I  +K++G+G G C I
Sbjct: 291 DSEEEESLRKVGELMTINHGLLNALGVSHPRLERIR-ELVDHADIGWTKLTGAGGGGCSI 349

Query: 286 AL 287
            L
Sbjct: 350 TL 351


>gi|259047795|ref|ZP_05738196.1| mevalonate kinase [Granulicatella adiacens ATCC 49175]
 gi|259035472|gb|EEW36727.1| mevalonate kinase [Granulicatella adiacens ATCC 49175]
          Length = 323

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 138/300 (46%), Gaps = 21/300 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILY--LTLRKDRLINID---SSLGQYCGSLDL 66
           A G ++L GEH V++   A+   IN   +    +T  K + I  +     L     S++ 
Sbjct: 10  ANGKIILAGEHAVVYHKPAIALPINAVFVKADIVTATKGQTIECELYSGDLQSMPASMEG 69

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
             F    +F++ +   +  S  F L + S + ++ G+GSSAA++VA+  A+    +   P
Sbjct: 70  LQFAIQKAFLLASSKEVT-SHAFVLSIESTIPAERGMGSSAAVSVAVVRAI--FDFFNTP 126

Query: 127 SPDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY 182
             D  L     IV   + IS    SG+D A +     + +Q  +  ++ ++   P +L+ 
Sbjct: 127 LSDATLWD---IVQGAETISHGNPSGVDTATTSGTRPVFFQ-KEQELQTLELDMPAYLVI 182

Query: 183 --SGYKTPTAQVLKKISYIE--IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
             SG    T Q +  +S ++  I  P  NE        +G + Q +  A+  K+   L Q
Sbjct: 183 ADSGVTGNTKQAVHHVSTLQERIIDPTTNETGSDAVQSIGAIVQDTKTAIETKDPLKLGQ 242

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ 298
            MN     L+ LGVS   +  +V    E  H + +K++G GLG C+IAL   + ++L  Q
Sbjct: 243 LMNSNHDRLKKLGVSHDIIEALVSTAHEN-HALGAKVTGGGLGGCMIALVATENDALHLQ 301


>gi|116511264|ref|YP_808480.1| mevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
 gi|116106918|gb|ABJ72058.1| mevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
          Length = 310

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 130/301 (43%), Gaps = 37/301 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS------LD 65
           A   L+L+GEH V++G  A+         L +T+ K  +    S  GQY  +      LD
Sbjct: 11  AHSKLILIGEHSVVYGQPAIA--------LPVTILKTTVTITSSKYGQYIENNEFRRRLD 62

Query: 66  LA--MFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
           L    F      I+  ++    S   F L++ S +    GLG+SA++  AI  A      
Sbjct: 63  LMGDEFEGIRQLIMRLLDKFHSSKMPFSLEIDSNIPQGRGLGASASLATAIIRAFYDFFD 122

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY 182
            + P  D +L  A+       G SSGID+A       +  + P + I K   I P  L  
Sbjct: 123 AELPQKD-LLFYANFSENITHGKSSGIDVAT------VNSEHPLWFI-KDSTIEPFELNL 174

Query: 183 SGY--------KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
            G+           T+Q    I+ +  +  E NE  Q     +G+L+  S   L    LK
Sbjct: 175 HGFIVIGDTGVHGFTSQA---INIVREKLVEENEKTQNSINDLGQLATDSKAFLMTDKLK 231

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                MN+    L  LGVS  +L  +V   R+    + +K++GSGLG  ++AL + + ++
Sbjct: 232 EFGHVMNKAHERLSELGVSHPRLDNLVDTARKNG-ALGAKLTGSGLGGVMVALAENEKDA 290

Query: 295 L 295
           +
Sbjct: 291 I 291


>gi|268319453|ref|YP_003293109.1| hypothetical protein FI9785_975 [Lactobacillus johnsonii FI9785]
 gi|262397828|emb|CAX66842.1| mvk [Lactobacillus johnsonii FI9785]
          Length = 305

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 137/295 (46%), Gaps = 33/295 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           KI V A G ++L+GEH V++G+ AL   I    I       D    +D++   Y G+  D
Sbjct: 4   KIEVKAHGKVILIGEHSVVYGYDALALPIQSLNITTTVEETDGPTWMDTT--HYHGAFFD 61

Query: 66  LAMFHPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL-----LT 119
               +    +I+   +  +K +    +    ++  + G GSSA + +  T A+     LT
Sbjct: 62  APAEYNGIKYIVKTLLERVKNAPNLKITYTGEIPMERGFGSSAVVALGTTKAVSQFLGLT 121

Query: 120 LQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICY----QMPKYSIEKIDF 174
           L      S  EI+  T HA ++   G +SG+D AA+++   + +      PK   +K+  
Sbjct: 122 L------SEAEIMEITNHAEMIN-HGKASGLD-AATVNSDYLVFFNKQDGPKQLSQKLGA 173

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEIN--QKIYALMGKLSQISCQALRNKN 232
              I  + +G    T   +K +        +++E N  +K  A +G+L+  + Q   N+N
Sbjct: 174 TLLI--MDTGELGNTKVAVKSVK------KQMDESNLKKKQIARLGELATATRQNWFNQN 225

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            + + +  N  + +L +  +S  ++  I  K+  +   + +K+SG GLG  VIAL
Sbjct: 226 AEEIGKIFNEAENILASFKLSTERIDNIC-KIANENGALGAKLSGGGLGGIVIAL 279


>gi|156741717|ref|YP_001431846.1| mevalonate kinase [Roseiflexus castenholzii DSM 13941]
 gi|156233045|gb|ABU57828.1| mevalonate kinase [Roseiflexus castenholzii DSM 13941]
          Length = 316

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 125/300 (41%), Gaps = 40/300 (13%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINK---RVILY-----LTLRKD-----RLINIDSS 56
            SAPG ++L GEH V++G  A+   ++K   R  +      + +R D     R   + ++
Sbjct: 5   TSAPGKIILCGEHAVVYGRPAIALPLSKIRARASVAPGAAGIGIRFDAPNLGRRWLLAAA 64

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
            G     L LA         I  I  I+ +   D+ + S      G+GS AAI  AI  A
Sbjct: 65  PGDPLSELTLATLK---QLGITRIPDIQITITSDIPIAS------GMGSGAAIATAIVRA 115

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKID 173
           L T  + +  S  EI    +A   +  G  SGID     +   I +Q    P + IE + 
Sbjct: 116 LAT-AFGRNLSAAEISALVYASEQRYHGTPSGIDNTVIAYEQAIWFQRRSEPPHLIEPLP 174

Query: 174 FIFPIHL------IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
              P  L      + S  + P  +V ++       Y       + ++ L+  +   +  A
Sbjct: 175 IAAPFTLVIGDTGVRSATRLPVGEVRRRWQEDPARY-------EALFDLVADVVHQARHA 227

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   ++  L   ++R Q  LE +GVS  +L  ++     +     +K+SG G G  +IAL
Sbjct: 228 LARGDVATLGPLLDRNQEALEQIGVSSPELERLI-TAARRAGAAGAKLSGGGWGGVMIAL 286


>gi|116333504|ref|YP_795031.1| mevalonate kinase [Lactobacillus brevis ATCC 367]
 gi|116098851|gb|ABJ64000.1| mevalonate kinase [Lactobacillus brevis ATCC 367]
          Length = 315

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 135/284 (47%), Gaps = 17/284 (5%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           S+   ++L+G+H V++G  A+   +   V  ++T+       + +S   Y G +  A  H
Sbjct: 8   SSNAKIILIGDHSVVYGQPAIALPL-PSVTTHVTMTATDHEQLLTSR-YYDGPI--AQMH 63

Query: 71  PSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
            + + +   I  +       +  F + + S L ++ G+GSSAA  VAIT A+    + + 
Sbjct: 64  QNLAGVATLIKTLLRRFDAVNTPFHMTITSDLPAERGMGSSAAAAVAITRAMYAF-FDRF 122

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--S 183
            + +++L +A        G  SGID A +     I + +P     +I F    +L+   S
Sbjct: 123 LNREQLLASAAIEEAITHGKPSGIDAATASSNAPIWF-IPHQESLQIPFALTGYLVIADS 181

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
           G K  T + +  ++  +  +P+  E   +I  L G L+  + QAL   N+  L Q +   
Sbjct: 182 GIKGQTGKAVAAVARRKTAFPQ--ETQTQINHL-GDLTYQARQALATPNIHQLGQILTEA 238

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           Q  L+ LGVS  +L  +  ++      + +K++G G+G C+IAL
Sbjct: 239 QQQLQALGVSSRELDHLT-QVATDNGALGAKLTGGGMGGCLIAL 281


>gi|72125755|ref|XP_790690.1| PREDICTED: similar to Mevalonate kinase (MK) [Strongylocentrotus
           purpuratus]
 gi|115614665|ref|XP_001200159.1| PREDICTED: similar to Mevalonate kinase (MK) [Strongylocentrotus
           purpuratus]
          Length = 413

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 148/369 (40%), Gaps = 91/369 (24%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I +SAPG ++L GEH V+HG  AL   +N R  L L  +    ++++        S D+ 
Sbjct: 16  IFISAPGKIILHGEHAVVHGKTALAAGLNLRSYLCLKEKDSGRLHLNLPDIDLERSWDVL 75

Query: 68  MFHPSFSFIIMA-INHIKPSCG-------------------------------------- 88
                F  ++ + +  +KPS                                        
Sbjct: 76  ELQEQFRDLLNSDVMEVKPSVEIMQRLRLFLGYSDTETTKRLAVMAFLYLYLCIAGRNGK 135

Query: 89  ---FDLKVISQLDSQLGLGSSAAITVAITAALL--------------TLQYHKEPSPDEI 131
               D  V S L    GLGSSAA +V + A LL              TL + +E   + I
Sbjct: 136 FPILDTLVSSALPPGAGLGSSAAFSVCLAAGLLTWAKAIIPLSLSDNTLDWSRE-DMELI 194

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQ---------MPKYSIEKIDFIFPIHLIY 182
            T A+     + G  SGID + S+HGG I Y+         MP+ S         I L+ 
Sbjct: 195 NTWAYEGERVIHGNPSGIDNSISVHGGAIEYRQKVITPLENMPELS---------ILLVN 245

Query: 183 SGYKTPTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQAL-RNKNL 233
           +     T +++  +     +YP+        I EI+Q+    +  L   + ++L ++   
Sbjct: 246 TCVARSTKELVAGVQRRHDKYPKVYGPILDSIEEISQECKRTLQALK--TGESLDKDGAF 303

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
           K L + ++  Q LL  +GVS   ++ IV       + + +K++G+G G CV AL   D  
Sbjct: 304 KSLGELVDINQQLLYVIGVSHPAINNIV--RSAAAYKIHAKLTGAGGGGCVFALLPPD-- 359

Query: 294 SLPYQSVNC 302
            +P  SV  
Sbjct: 360 -IPKDSVKA 367


>gi|237784666|ref|YP_002905371.1| phosphomevalonate kinase [Corynebacterium kroppenstedtii DSM 44385]
 gi|237757578|gb|ACR16828.1| phosphomevalonate kinase [Corynebacterium kroppenstedtii DSM 44385]
          Length = 409

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 151/365 (41%), Gaps = 91/365 (24%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT--------LRKD--RLINIDSS 56
           +  SAPG L + GE+ V+H GHAAL+ A+++ V + LT        LR D       D +
Sbjct: 6   VHASAPGKLYIAGEYAVVHPGHAALLIAVDRYVHVTLTPTGTDAGTLRSDASDPTKPDEA 65

Query: 57  LGQYCGSLD---LAMFHPSFS----FIIMAINHIK--------PSCGFDLKVISQLD--- 98
             ++  S D    A FH   +    ++  A+  ++        P+ G+D+ + S LD   
Sbjct: 66  PVRWEASFDPMAAARFHTDETGFHKYVAAAVLTVERWRAEKHLPTSGYDIDISSHLDDAT 125

Query: 99  --SQLGLGSSAAITVAITAALLTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASI 155
             ++ GLGSSAA+TVA        ++H  +P+P++I   A    ++V   +SG D+AAS 
Sbjct: 126 SGAKFGLGSSAAVTVAT--VAAAARHHGLQPTPEQIYRLAAIATVRVTTKTSGGDVAASA 183

Query: 156 HGGLICY----------------------------QMPKYSIEKIDFIFPIHLIYSGYKT 187
            GG + Y                            + P  S+ +I    P   +  G+  
Sbjct: 184 LGGWVEYHSPDRAWLEDRAWGSGSRTTTISDLLTGEWPGLSLRRITPAAPGIQLSVGWTG 243

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
             A   + + ++  +    +++ Q+  A +G L     +AL  +N    A +     G +
Sbjct: 244 TPADTTELVGHVVKKTALPDDLLQRSDAAVGSL----VEALTGENGGCEAGSGEPASGDV 299

Query: 248 ETLGVSDSKLSEIVWKLR--------------EQPHIMA-----------SKISGSGLGD 282
            + G + S     V + R              E P +             +K SG+G GD
Sbjct: 300 NSDGRATSATGNAVAQARQVLGEIATQRGVAIETPALRTLITTALDEGWWAKSSGAGGGD 359

Query: 283 CVIAL 287
           C IAL
Sbjct: 360 CGIAL 364


>gi|224475736|ref|YP_002633342.1| mevalonate kinase [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222420343|emb|CAL27157.1| mevalonate kinase [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 307

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 130/280 (46%), Gaps = 14/280 (5%)

Query: 14  GSLVLMGEHGVLHGHAALV--FAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH- 70
           G ++L+GEH V  G  A+   F+  K  +    + +  +  + S +  Y G ++ A  H 
Sbjct: 11  GKIILVGEHAVTFGEPAIAIPFSSGKVKVEIAEMPELAVSTMISDV--YEGEVEHAPEHL 68

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
            +      A +HI+      +K+ ++L    GLGSSAA+ VA T A       K  S +E
Sbjct: 69  HALISRFEAESHIESPIM--IKIEAKLPPSRGLGSSAAVAVAFTRAAFDF-LDKPLSDEE 125

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY-SIEKIDFIFPIHLIYSGYKTPT 189
           ++   +   +   G  SGID    +      +Q   + S+E +     + ++ +G K  T
Sbjct: 126 LIEHVNWAEMIAHGKPSGIDAQTIVSNQPTWFQKGVFTSLESLRIPGYMVVLDTGIKGNT 185

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            + ++ +     E    N+ N++    +G+L   + QA+  +N   LA+  N  Q  L T
Sbjct: 186 KEAVRDVH----ELVNNNKENKQFIDRIGQLVYSANQAINMRNFDALAEIFNECQSYLAT 241

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L VS  K+ +++    +Q   +A K++GSG G  VI L K
Sbjct: 242 LTVSHPKIDKLL-NAAKQAGAVAGKLTGSGRGGSVITLVK 280


>gi|58260880|ref|XP_567850.1| cystathionine beta-lyase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134117161|ref|XP_772807.1| hypothetical protein CNBK1800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255425|gb|EAL18160.1| hypothetical protein CNBK1800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229931|gb|AAW46333.1| cystathionine beta-lyase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 918

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 145/365 (39%), Gaps = 76/365 (20%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----------------- 48
             I VSAPG ++L GEH V+HG  A+  +++ R    L+ R+D                 
Sbjct: 480 EDIAVSAPGKVILFGEHAVVHGVTAIASSVDLRCFSVLSPRRDGKVGLEVPNIGVELEWE 539

Query: 49  ------RLINIDSSLGQYCGS--LDLAMFHP--------------------SFSFIIMAI 80
                  L+ + ++ G++     LD A+                       +F ++ M I
Sbjct: 540 ISKLPWNLLPVHANGGRHVADKELDTALLQAVEGAVNTHVEVGKTGIGACVAFLYLYMMI 599

Query: 81  NHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-------KEPSPDEIL 132
           +  + +         S L    GLGSSAA +  + A+ L  + H       + P  D  L
Sbjct: 600 SGEETNALSVTFTASSNLPISAGLGSSAAYSTCVAASFLLARQHLTIPSADRLPKEDTDL 659

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFP---IHLIYSGYK 186
               A + +  + G  SGID A ++ GG + +       +  +D +F    + L+ +   
Sbjct: 660 VDGWAFLAEKVLHGNPSGIDNAVAVRGGAVAFTRSVGGKQGGMDGLFEFSSVRLLLTNTL 719

Query: 187 TP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVL 236
            P  T  ++  +S   +  P+        I  I+ +  +L+G    +     R+  +K L
Sbjct: 720 VPRDTKTLVAGVSAKRLAEPQAVNSILDSIQTISDEARSLLGGGKPVE----RSILVKRL 775

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
              +      L  LGVS   L  IV    + P  +A+K++G+G G C + L   D    P
Sbjct: 776 EALIKENHEHLVELGVSHPSLEMIVAATAQAPFELATKLTGAGGGGCALTLIPDD---FP 832

Query: 297 YQSVN 301
             S+N
Sbjct: 833 ESSLN 837


>gi|300707487|ref|XP_002995949.1| hypothetical protein NCER_101036 [Nosema ceranae BRL01]
 gi|239605195|gb|EEQ82278.1| hypothetical protein NCER_101036 [Nosema ceranae BRL01]
          Length = 290

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 132/305 (43%), Gaps = 47/305 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYL--TLRKDRLINIDSSLGQYCGSLDLAMF 69
           +P  L+L GEH VL G   +   INK  ILY+    +K+  IN+          L     
Sbjct: 7   SPLKLILFGEHSVLIGGRCISVCINKYCILYMPEYKKKENCINL----------LIKESN 56

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQ-------LDSQLGLGSSAAITVAITAALLTLQY 122
           +P F F          S G D KV+S        +D Q  LG     + AI+       Y
Sbjct: 57  NPVFVF----------SVGKDSKVMSTSSNYNGIIDIQYFLGCGLGSSAAISILSSIALY 106

Query: 123 HKEP---SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FP 177
           H++      ++I   A        G SSG+D A   +G +I ++  K      ++I  + 
Sbjct: 107 HQKKINFYNEKIFKEADTFEDIFHGKSSGVDCATLRYGRMISFKNKKVKKMTAEYISMYK 166

Query: 178 IHLIYSGYKTPTAQVLKK-ISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
           I +  S     T + +K+ ++  +  Y  ++ I++K Y L+ +  ++ C+         L
Sbjct: 167 ILIYNSNISKDTCKTIKQDLNNKQKNYEMLSVISEKAYELLSRPFKL-CE---------L 216

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
              + + Q + E LGV   K+   V +LREQ   + SKI+G+G G  +  + K   +   
Sbjct: 217 YALIKKAQDIFEDLGVVPEKMKNEVRRLREQG--IESKITGAGNGGHLFTIVKKSCSLEN 274

Query: 297 YQSVN 301
           ++ VN
Sbjct: 275 WEEVN 279


>gi|58260882|ref|XP_567851.1| cystathionine beta-lyase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134117159|ref|XP_772806.1| hypothetical protein CNBK1800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255424|gb|EAL18159.1| hypothetical protein CNBK1800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229932|gb|AAW46334.1| cystathionine beta-lyase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 900

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 145/365 (39%), Gaps = 76/365 (20%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----------------- 48
             I VSAPG ++L GEH V+HG  A+  +++ R    L+ R+D                 
Sbjct: 480 EDIAVSAPGKVILFGEHAVVHGVTAIASSVDLRCFSVLSPRRDGKVGLEVPNIGVELEWE 539

Query: 49  ------RLINIDSSLGQYCGS--LDLAMFHP--------------------SFSFIIMAI 80
                  L+ + ++ G++     LD A+                       +F ++ M I
Sbjct: 540 ISKLPWNLLPVHANGGRHVADKELDTALLQAVEGAVNTHVEVGKTGIGACVAFLYLYMMI 599

Query: 81  NHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-------KEPSPDEIL 132
           +  + +         S L    GLGSSAA +  + A+ L  + H       + P  D  L
Sbjct: 600 SGEETNALSVTFTASSNLPISAGLGSSAAYSTCVAASFLLARQHLTIPSADRLPKEDTDL 659

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFP---IHLIYSGYK 186
               A + +  + G  SGID A ++ GG + +       +  +D +F    + L+ +   
Sbjct: 660 VDGWAFLAEKVLHGNPSGIDNAVAVRGGAVAFTRSVGGKQGGMDGLFEFSSVRLLLTNTL 719

Query: 187 TP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVL 236
            P  T  ++  +S   +  P+        I  I+ +  +L+G    +     R+  +K L
Sbjct: 720 VPRDTKTLVAGVSAKRLAEPQAVNSILDSIQTISDEARSLLGGGKPVE----RSILVKRL 775

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
              +      L  LGVS   L  IV    + P  +A+K++G+G G C + L   D    P
Sbjct: 776 EALIKENHEHLVELGVSHPSLEMIVAATAQAPFELATKLTGAGGGGCALTLIPDD---FP 832

Query: 297 YQSVN 301
             S+N
Sbjct: 833 ESSLN 837


>gi|312210344|emb|CBX90431.1| similar to mevalonate kinase [Leptosphaeria maculans]
          Length = 561

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 155/363 (42%), Gaps = 93/363 (25%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------NID 54
           VSAPG +++ GEH V+HG AA+  AI+ R  L+++   + +R +             NID
Sbjct: 76  VSAPGKVIVYGEHAVVHGKAAIAAAISLRSYLHVSFLSKSNRTVQLRFPDIQMEHTWNID 135

Query: 55  S---------SLGQY----CGSLD---LAMFHP----------------------SFSFI 76
                        +Y      SLD   +A   P                      SF ++
Sbjct: 136 ELPWDTFTMPGKKKYYYDSVTSLDPDFMAAIQPFIDQVSPKAPESIRKIHHASACSFLYL 195

Query: 77  IMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY------HKEPSPD 129
            +++   K P C + L+  S +    GLGSSA+I+V ++ ALL LQ       H++  P 
Sbjct: 196 FLSLASRKVPPCVYTLR--STIPIGAGLGSSASISVCLSTALL-LQIRALSGPHQDQPPQ 252

Query: 130 EILTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH--- 179
           E       I        + + G  SG+D   S  G  + +Q  +    K   + PIH   
Sbjct: 253 ECELNIERINRWSFVGEMCIHGNPSGVDNTVSSGGKALLFQRRE---GKPPLVVPIHSFP 309

Query: 180 -----LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKN-- 232
                L+ +     TA  + K++++   +P + E    I   +G +++ + + L + +  
Sbjct: 310 ELPLLLVNTRQSRSTATEVAKVAHLRQIHPALTE---NILNAIGLVTESAHKLLTSPDFD 366

Query: 233 ------LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
                 LK L + +    GLL +LGVS  KL  I  +L +   I  +K++G+G G C I 
Sbjct: 367 PTSHASLKFLGELVTINHGLLVSLGVSHPKLERIR-ELIDHTGIGWTKLTGAGGGGCAIT 425

Query: 287 LGK 289
           + K
Sbjct: 426 ILK 428


>gi|327304279|ref|XP_003236831.1| mevalonate kinase [Trichophyton rubrum CBS 118892]
 gi|326459829|gb|EGD85282.1| mevalonate kinase [Trichophyton rubrum CBS 118892]
          Length = 518

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 97/385 (25%), Positives = 154/385 (40%), Gaps = 94/385 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR------- 229
            + LI S     TA  + K++ ++  +P + E      +++  +   +  A R       
Sbjct: 312 KLLLINSRQPRSTAVEVAKVAALKKAHPVVTE------SILDSIDHTTESAYRLIASDDF 365

Query: 230 ----NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
               ++ +  L +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I
Sbjct: 366 DEHCSEKINHLGELFRINHGLLVSLGVSHPRLERIR-ELVDHADIGWTKLTGAGGGGCTI 424

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGID 310
            L K   N    + +   ++ +G D
Sbjct: 425 TLFKAKWNEEAIEHLEEQLNDEGYD 449


>gi|302662770|ref|XP_003023036.1| hypothetical protein TRV_02858 [Trichophyton verrucosum HKI 0517]
 gi|291187012|gb|EFE42418.1| hypothetical protein TRV_02858 [Trichophyton verrucosum HKI 0517]
          Length = 518

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 151/379 (39%), Gaps = 82/379 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNK 231
            + LI S     TA  + K++ ++  +P + E     I+    +    +S        ++
Sbjct: 312 KLLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLISSDDFDEHCSE 371

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
            +  L +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I L K  
Sbjct: 372 KIDHLGELFRINHGLLVSLGVSHPRLERIR-ELVDHADIGWTKLTGAGGGGCTITLFKAK 430

Query: 292 LNSLPYQSVNCHMHAKGID 310
            N    + +   +  +G D
Sbjct: 431 WNEEAIEHLEEQLDDEGYD 449


>gi|329667335|gb|AEB93283.1| mevalonate kinase [Lactobacillus johnsonii DPC 6026]
          Length = 305

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 135/294 (45%), Gaps = 31/294 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           KI V A G ++L+GEH V++G+ AL   I    I       D    +D++   Y G+  D
Sbjct: 4   KIEVQAHGKVILIGEHSVVYGYDALALPIQALNITTTVEETDGPTWMDTT--HYHGAFFD 61

Query: 66  LAMFHPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL-----LT 119
               +    +I+   +  +K +    +    ++  + G GSSA + +  T A+     LT
Sbjct: 62  APAEYDGIKYIVKTLLERVKNAPNLKITYTGEIPMERGFGSSAVVALGTTKAVSQFLGLT 121

Query: 120 LQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICY----QMPKYSIEKIDF 174
           L      S  EI+  T HA ++   G +SG+D AA+++   + +      PK   +K+  
Sbjct: 122 L------SEAEIMEITNHAEMIN-HGKASGLD-AATVNSDYLVFFNKQDGPKQLSQKLGA 173

Query: 175 IFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
              I        T  A Q +KK         + +++ +K  A +G+L+  + Q   N+N 
Sbjct: 174 TLLIMDTGELGNTKVAVQSVKK-------QMDESDLKKKQIARLGELATATRQNWFNQNA 226

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + + +  N  + +L +  +S  ++  I  K+  +   + +K+SG GLG  VIAL
Sbjct: 227 EEIGKIFNEAEDILASFKLSTERIDNIC-KIANENGALGAKLSGGGLGGIVIAL 279


>gi|28378414|ref|NP_785306.1| phosphomevalonate kinase [Lactobacillus plantarum WCFS1]
 gi|28271250|emb|CAD64154.1| phosphomevalonate kinase [Lactobacillus plantarum WCFS1]
          Length = 363

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 90/347 (25%), Positives = 156/347 (44%), Gaps = 57/347 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-----YC 61
           I V APG L + GE+ V+  G+ A++ A+N+ V   ++   + + +I S   Q     + 
Sbjct: 2   ITVKAPGKLYIAGEYAVVESGYPAIIVALNQFVTATIS-PSETIGSIVSEQYQENSIVWR 60

Query: 62  GSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDS----QLGLGSS 106
              D  +F      F +I+ AIN        +    G + L + S+LDS    + GLGSS
Sbjct: 61  RQGDAMVFDNRDNPFHYILAAINLTESYAHELGRELGVYHLGINSELDSADGKKYGLGSS 120

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AA+TVA   AL    YH     +++   A    L VQG  S  D+AAS++GG I Y    
Sbjct: 121 AAVTVATVKALCQF-YHLPMDKNKLFKLAAIAHLSVQGNGSLGDIAASVYGGWIAYHSFD 179

Query: 163 ------QMPKYSIE----------KIDFIFP-----IHLIYSGYKTPTAQVLKKISYIEI 201
                 Q  + S+           KI+ + P     + + ++G    T+ ++ K++ ++ 
Sbjct: 180 RQWLHLQQAQSSLSDLLTMPWPDLKIELLTPPAALRLMIGWTGSPASTSHLVDKVALVKA 239

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-----VSDSK 256
           +  + +E    + A    L ++      + +L V+   +   + LL+ LG       ++ 
Sbjct: 240 K--QRSEYQTFLKASKACLKRM-ITGFHHSDLHVIQTELRTNRQLLQKLGGFSHVTIETP 296

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           L + + +L E     A+K SG+G GDC I L    ++  P  +   H
Sbjct: 297 LLQRMIQLAESAG-AAAKTSGAGGGDCGIVLIDQTIDPRPLLTAWAH 342


>gi|322386746|ref|ZP_08060370.1| mevalonate kinase [Streptococcus cristatus ATCC 51100]
 gi|321269028|gb|EFX51964.1| mevalonate kinase [Streptococcus cristatus ATCC 51100]
          Length = 292

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 129/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ AL   +N               NI+ +   +       ++  
Sbjct: 10  AHSKIILMGEHSVVYGYPALALPLN---------------NIEVTCQVFPSEKPWTLYEE 54

Query: 72  -SFSFIIMA-INHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            + S  + A + H+ K       +V S +  + G+GSSAA+++A   A+    Y +E   
Sbjct: 55  DTLSMAVFACLEHLGKQGAQIRCQVNSMVPEKRGMGSSAAVSIAAIRAVF--DYFEEALD 112

Query: 129 DEILTT-AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            E L   A+   +      SG+D    +    I + +      +I+     HL+   +G 
Sbjct: 113 HETLEILANRAEMIAHMNPSGLDAKTCLSDVAIKF-IRNVGFSEIELDLDAHLLIADTGI 171

Query: 186 KTPTAQVLKKISYIEIE-YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + +KK+  +  E  P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIKKVESLGQEALPLLQE--------LGNLTKIVEKAIHLKDLLTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           G L  LGVS  +LS+ + +L  +   + +K+SG GLG CVI L
Sbjct: 224 GKLAQLGVS-CQLSDDLVELALENGALGAKMSGGGLGGCVIVL 265


>gi|125623292|ref|YP_001031775.1| mevalonate kinase [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492100|emb|CAL97029.1| Mvk protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070043|gb|ADJ59443.1| mevalonate kinase [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 310

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 128/301 (42%), Gaps = 37/301 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD----LA 67
           A   L+L+GEH V++G  A+         L +T+ K  +    S  GQY  + +    L 
Sbjct: 11  AHSKLILIGEHSVVYGQPAIA--------LPVTILKTTVTITSSKYGQYIENNEFRRRLD 62

Query: 68  MFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
           +    F  I   I  +          F L++ S +    GLG+SA++  AI  A      
Sbjct: 63  LMGDEFEGIRQLIMRLLAKFHSSKMPFSLEIDSNIPQGRGLGASASLATAIIRAFYDFFD 122

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY 182
            + P  D +L  A+       G SSGID+A       +  + P + I K   I P  L  
Sbjct: 123 AELPQKD-LLFYANFSENITHGKSSGIDVAT------VNSEHPLWFI-KDSTIEPFELNL 174

Query: 183 SGY--------KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
            G+           T+Q    I+ +  +  E NE  Q     +G+L+  S   L    LK
Sbjct: 175 HGFIVIGDTGVHGFTSQA---INIVREKLVEENEKTQNSINDLGQLATDSKAFLMTDKLK 231

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                MN+    L  LGVS  +L  +V   R+    + +K++GSGLG  ++AL + + ++
Sbjct: 232 EFGHVMNKAHERLSELGVSHPRLDNLVDTARKNG-ALGAKLTGSGLGGVMVALAENEKDA 290

Query: 295 L 295
           +
Sbjct: 291 I 291


>gi|329117553|ref|ZP_08246270.1| mevalonate kinase [Streptococcus parauberis NCFD 2020]
 gi|326907958|gb|EGE54872.1| mevalonate kinase [Streptococcus parauberis NCFD 2020]
          Length = 292

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 138/284 (48%), Gaps = 34/284 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G  A+   +    ++    R ++ +  D     +  +L  A+F  
Sbjct: 10  AHSKIILMGEHSVVYGFPAIALPLKDIEVVCRIRRAEKKLEFD-----FYDTLSTAIFS- 63

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
                  A++++K  +     ++ SQ+  + G+GSSAA+++A   A+ +  Y  +   D+
Sbjct: 64  -------ALDYLKIKNQPISYEITSQVPQRRGMGSSAAVSIAAIRAVFS--YFDQELSDQ 114

Query: 131 ILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SG 184
           +L     +V K + I+    SG+D    +    I + +       ++     +L+   +G
Sbjct: 115 LLEI---LVNKAEIIAHTNPSGLDAKTCLSDQAIKF-IRNVGFVSLEINLDAYLVIADTG 170

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
               T + + K++  E       E N    A +G+L++   +A++ K++  + Q+M +  
Sbjct: 171 IHGHTREAVNKVAKFE-------ESNLPHLAALGQLTEDVEEAIKAKDVISIGQSMTQAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
             L+ +GVS  K +++V +  +Q   + +K+SG GLG C+IAL 
Sbjct: 224 EHLKAIGVSVEKSNQLVEEALKQG-ALGAKMSGGGLGGCIIALA 266


>gi|162447659|ref|YP_001620791.1| mevalonate kinase [Acholeplasma laidlawii PG-8A]
 gi|161985766|gb|ABX81415.1| mevalonate kinase [Acholeplasma laidlawii PG-8A]
          Length = 313

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 137/290 (47%), Gaps = 23/290 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA--MF 69
           A G ++LMGEH V++G  A+     +  I     + +  I IDS    + G LD A    
Sbjct: 9   ASGKIILMGEHSVVYGKPAIALPFKQAQISSKVFKTNDKITIDSFY--HKGYLDDAPDTL 66

Query: 70  HPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           +     I + + ++K P  G  +++ S L  Q GLGSSA++++AI  +L      K    
Sbjct: 67  YGIKQLIYIVLVYLKQPFHGIHIQIESSLPPQRGLGSSASVSIAIVRSL--FDAFKVELS 124

Query: 129 DEILTTAHAIVLKVQGIS-SGIDLAASIHGGLICYQ--MPKYSIE-KIDFIFPIHLIYSG 184
            E L     +  ++  ++ SG+D      G  + YQ  + K  I  K+D +  I +  +G
Sbjct: 125 QERLNYFVDVAEQIHHVNPSGLDAITIAFGQAVFYQKDLGKTLIPLKMDAV--IVVADTG 182

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKNLKVLAQAMN 241
            K  T + ++++  +  + P I      +  +M +L +++ +    L    +  L  AM 
Sbjct: 183 KKGLTKEAVQEVKQLWTDNPTI------VSPIMDRLEELTNEVRTYLETNEIIRLGLAMT 236

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
               LL ++ VSD  L ++V ++      + +K++G G G C+IAL + +
Sbjct: 237 EAHQLLRSIKVSDDLLEKLV-EVSLLNGALGAKLTGGGKGGCMIALAQNE 285


>gi|115398019|ref|XP_001214601.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192792|gb|EAU34492.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 541

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 150/375 (40%), Gaps = 76/375 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINI---DSSLGQYCGSL 64
           VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R + +   D  L       
Sbjct: 98  VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLTKSQRTVTLNFRDIGLAHTWNID 157

Query: 65  DLA--MFH----------------PSFSFIIMA-INHIKPSCGFDLKVISQLDSQL---- 101
           DL   +FH                P     I   ++ + P    D + I +  +      
Sbjct: 158 DLPWDVFHQPAKKKYYYDLVTSLDPELVDAIQPYVDQVSPDLPEDQRKIHRRSASAFLYL 217

Query: 102 ------------------------GLGSSAAITVAITAA-LLTLQYHKEPSPDEILTTAH 136
                                   GLGSSA++ V ++AA LL ++    P PD+    A 
Sbjct: 218 LLSLGSPQHPGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRTLAGPHPDQPPDEAE 277

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKY----SIEKIDFI--FPIH 179
             + ++            G  SG+D   S  G  + ++   Y    S+  +      P+ 
Sbjct: 278 VQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVIFRRTDYSKPPSVRSLPTFPELPLL 337

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLK 234
           L+ +     TA  + K+  ++ E+P + E     I++   +    L       +  + L+
Sbjct: 338 LVDTRQPRSTAVEVAKVGKLKEEHPVVTESILDAIDKLTLSAEELLDGCEKTGVTEEVLE 397

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            L   +    G L +LGVS  +L E + +L +  +I  +K++G+G G C I L + D + 
Sbjct: 398 RLGTLVRINHGFLVSLGVSHPRL-ERIRELVDFANIGWTKLTGAGGGGCAITLLRPDADK 456

Query: 295 LPYQSVNCHMHAKGI 309
              + +   + A+G 
Sbjct: 457 NAVRDLEAKLAAEGF 471


>gi|256847332|ref|ZP_05552778.1| mevalonate kinase [Lactobacillus coleohominis 101-4-CHN]
 gi|256715996|gb|EEU30971.1| mevalonate kinase [Lactobacillus coleohominis 101-4-CHN]
          Length = 315

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 125/288 (43%), Gaps = 8/288 (2%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS--LGQYCGSLDLAMFHPSF 73
           ++LMGEH V++G  A+   +       + +  D    I  S         L  AM   + 
Sbjct: 13  IILMGEHSVVYGQPAIALPLPNVTTEVVMIGNDNHEQIIESRYFSGPVAELPQAMSGIAK 72

Query: 74  SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILT 133
               + I+    + G+ +K+ S + ++ G+GSSAA TVAI  A+    Y +      +L 
Sbjct: 73  LIKELVIHFAGQADGWTMKITSDIPAERGMGSSAACTVAIIRAMFDF-YDQSLDRQSLLR 131

Query: 134 TAHAIVLKVQGISSGIDLAASIHGGLICYQM-PKYSIEKIDFIFPIHLIYSGYKTPTAQV 192
            A           SG+D A       + ++   K +   ++    + +  +G K  T + 
Sbjct: 132 WADVEEKVTHRSPSGLDAATVSSANPVWFKKGAKGTPISLNLEATMVIADTGIKGATREA 191

Query: 193 LKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
           ++ +       P   +  Q++   +G+L++ S  A+ N     L + +      L+ LGV
Sbjct: 192 IQTVKDKLQHQP---KAAQQLIDKLGQLTEESRDAVANNQATRLGEKLTAAHHALDQLGV 248

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           SD KL+++V       H + +K++G G G C+ A+ K  L +    S+
Sbjct: 249 SDPKLNQLVTTALAN-HALGAKLTGGGRGGCMFAITKSALGARKLASI 295


>gi|326482092|gb|EGE06102.1| mevalonate kinase [Trichophyton equinum CBS 127.97]
          Length = 518

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 97/385 (25%), Positives = 153/385 (39%), Gaps = 94/385 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR------- 229
            + LI S     TA  + K++ ++  +P + E      +++  +   +  A R       
Sbjct: 312 KLLLINSRQPRSTAVEVAKVAALKKAHPVVTE------SILDSIDHTTESAYRLIASDDF 365

Query: 230 ----NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
               ++ +  L +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I
Sbjct: 366 DEHCSEKIDHLGELFRINHGLLVSLGVSHPRLERIR-ELVDHADIGWTKLTGAGGGGCTI 424

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGID 310
            L K   N    + +   +  +G D
Sbjct: 425 TLFKAKWNEEAIEHLEEQLDDEGYD 449


>gi|15899698|ref|NP_344303.1| (phospho) mevalonate kinase, putative [Sulfolobus solfataricus P2]
 gi|284175800|ref|ZP_06389769.1| (phospho) mevalonate kinase, putative [Sulfolobus solfataricus
           98/2]
 gi|13816374|gb|AAK43093.1| (Phospho) mevalonate kinase, putative [Sulfolobus solfataricus P2]
 gi|261601433|gb|ACX91036.1| GHMP kinase [Sulfolobus solfataricus 98/2]
          Length = 323

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 153/348 (43%), Gaps = 62/348 (17%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I VSAPG ++ +G + V+ G  + V A+NKRV   L   K++               D  
Sbjct: 2   IKVSAPGKILWIGSYSVVFGGISHVIAVNKRVSCSLREIKEK---------------DSL 46

Query: 68  MFHPSFSFIIMAINHIKPSC-------------GFDLKVISQLD-----SQLGLGSSAAI 109
           +FH S+     + N +  S              G+++ + +  +      + GLGSS+A 
Sbjct: 47  IFHTSYGHFKNSGNELINSVLDTFRERLSQLPQGYEIDLYNDKEFIIDGKKTGLGSSSAA 106

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYS 168
           TV++TA L     H +    EI   A     K Q GI SG D+A+++ G ++  +     
Sbjct: 107 TVSLTACLY-YAIHGKLDLFEIHKLAQIANYKRQKGIGSGFDIASAVFGSIVYKRFT--D 163

Query: 169 IEKIDFIFP--------IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL 220
           ++K+DF F         + L ++G  + T  +++K     +E   +++  ++I  L+ + 
Sbjct: 164 LDKMDFYFEKLNLGNYDMMLGFTGKSSETVGLVRKF----VEKSNLDDF-KEIMRLIDEE 218

Query: 221 SQISCQALRNKNLKVLAQAMNRQQGLL-----ETLGVS-DSKLSEIVWKLREQPHIMASK 274
           + ++ + ++   L    + +   +  L       +GV   SK+ E + K+ E+   + + 
Sbjct: 219 NYMAIKLIKLNKLDEAVEHIKLGRKYLNYIAERIVGVKLVSKMEEELIKIAEEEGALVAL 278

Query: 275 ISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSL 322
             G+G GD + ALG  DLN      V      +GI I+ +       L
Sbjct: 279 SPGAGGGDSIFALGN-DLN-----RVREAWSKRGIFIIDVKEDEGLRL 320


>gi|169773659|ref|XP_001821298.1| mevalonate kinase [Aspergillus oryzae RIB40]
 gi|238491672|ref|XP_002377073.1| mevalonate kinase [Aspergillus flavus NRRL3357]
 gi|83769159|dbj|BAE59296.1| unnamed protein product [Aspergillus oryzae]
 gi|220697486|gb|EED53827.1| mevalonate kinase [Aspergillus flavus NRRL3357]
          Length = 534

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/375 (23%), Positives = 155/375 (41%), Gaps = 76/375 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINID-SSLG-QYCGSLD 65
           VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R I ++   +G  +  S+D
Sbjct: 92  VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLTKSQRTITLNFRDIGLNHTWSID 151

Query: 66  ---LAMFH-PS----------------FSFIIMAINHIKPSCGFDLK------------- 92
                +FH P+                   I+  +  I P    D +             
Sbjct: 152 ELPWDLFHQPTKKKYYYDLVTSIDPELLDAILPLVERISPDLPEDKRKHQRGAATAFLYL 211

Query: 93  ---------------VISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEILTTAH 136
                          + S + +  GLGSSA+I V I+AA LL ++    P PD+    A 
Sbjct: 212 FCALGSPQHPGAIYTLRSTIPTGAGLGSSASICVCISAALLLQIRTLAGPHPDQPPDEAE 271

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEKI-----DFI-FPIH 179
             + ++            G  SG+D   +  G  + ++   YS         +F   P+ 
Sbjct: 272 VQIERINRWAFVGEMCIHGNPSGVDNTVAAGGKAVIFRRGDYSKPPAVSSLPNFPELPLL 331

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINE----INQKIYALMGK-LSQISCQALRNKNLK 234
           L+ +     TA  + K+  ++ E P + E      +K+ A   + + +     +    L+
Sbjct: 332 LVDTRQSRSTAVEVAKVGQLKEEQPLVTEAILDTIEKVNASAQEIIRETDSSGISKDTLE 391

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            +   +    GLL +LGVS  +L E + +L +  +I  +K++G+G G C I L + D + 
Sbjct: 392 RIGALIRINHGLLVSLGVSHPRL-ERIRELVDFANIGWTKLTGAGGGGCAITLLRPDADP 450

Query: 295 LPYQSVNCHMHAKGI 309
              + +   +  +G 
Sbjct: 451 SAIRQLEEKLDEEGF 465


>gi|289433383|ref|YP_003463255.1| mevalonate kinase [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289169627|emb|CBH26161.1| unnamed protein product [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 322

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 123/295 (41%), Gaps = 11/295 (3%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFHPSF- 73
           ++L GEH V++G  A+     + V+   T   +     + S   + G+L D+  F     
Sbjct: 10  MILCGEHAVVYGEPAISVPFTQAVV---TTNVETSTKTEFSSAFFSGNLEDMPDFLAGIK 66

Query: 74  SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILT 133
           S ++  +  I       + V S +    GLGSSAA+  +I   L    + KE    ++L 
Sbjct: 67  SLVVDILKEIGKGECVSIHVTSGVPIGRGLGSSAAVATSIARGLYKY-FDKELDKKKLLA 125

Query: 134 TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVL 193
             +A      G +SG+D    +    + Y+  +  +E + F   +  + +    P+    
Sbjct: 126 IVNAAEKIAHGNASGVDAITVVSEKPVWYERDR-KLEIMHFPKKVTFVVADTGVPSETRA 184

Query: 194 KKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVS 253
                 ++      EI + I+AL     +I      N +   +  AMN+ Q  LE L VS
Sbjct: 185 AVADVQQLYQKNEAEIGKIIHALGDISREIKTNLEGNADTVKIGTAMNKAQSYLEILTVS 244

Query: 254 DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           D  L +++   R      A K++G G G C+IA+ K   N    + +   +H  G
Sbjct: 245 DKSLEKLIEVARSNGADGA-KLTGGGRGGCIIAVAK---NQETAEKITKALHKAG 295


>gi|302501690|ref|XP_003012837.1| hypothetical protein ARB_01088 [Arthroderma benhamiae CBS 112371]
 gi|291176397|gb|EFE32197.1| hypothetical protein ARB_01088 [Arthroderma benhamiae CBS 112371]
          Length = 518

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 97/385 (25%), Positives = 153/385 (39%), Gaps = 94/385 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR------- 229
            + LI S     TA  + K++ ++  +P + E      +++  +   +  A R       
Sbjct: 312 KLLLINSRQPRSTAVEVAKVAALKKAHPVVTE------SILDSIDHTTESAYRLIASDDF 365

Query: 230 ----NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
               ++ +  L +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I
Sbjct: 366 DEHCSEKIDHLGELFRINHGLLVSLGVSHPRLERIR-ELVDHADIGWTKLTGAGGGGCTI 424

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGID 310
            L K   N    + +   +  +G D
Sbjct: 425 TLFKAKWNEEAIEHLEEQLDDEGYD 449


>gi|154321109|ref|XP_001559870.1| hypothetical protein BC1G_01429 [Botryotinia fuckeliana B05.10]
 gi|150851967|gb|EDN27159.1| hypothetical protein BC1G_01429 [Botryotinia fuckeliana B05.10]
          Length = 498

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 148/355 (41%), Gaps = 78/355 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKD------RLINIDSSLGQYCG 62
           VSAPG +++ GEH V+HG  A+  AI+ R  L +T L K       R  +I+ S      
Sbjct: 56  VSAPGKVIVFGEHAVVHGKPAIAAAISLRSYLLVTSLSKSKRTISLRFPDINLSHTWNID 115

Query: 63  SLDLAMF-HPS---------------------------------------------FSFI 76
            L  + F HPS                                             F +I
Sbjct: 116 DLPWSTFSHPSKKKHYYDEVTSLDPELVAAMKPHLENISPDESPAIRKIHQSSASSFLYI 175

Query: 77  IMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA-LLTLQYHKEPSPDEILTT 134
            +++     P C + L+  S +    GLGSSA+I+V +++A LL ++    P PD+    
Sbjct: 176 FLSLGSQSFPGCLYTLR--STIPIGAGLGSSASISVCLSSALLLQIRTLSGPHPDQPSNE 233

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFPIH 179
           A   + ++            G  SG+D   S  G  + YQ     P     +     P+ 
Sbjct: 234 ASLQLERINRWAFVGEMCIHGNPSGVDNTVSTQGKAVIYQKSPDGPTVKPLRNFPELPLL 293

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS--QISCQALRNKNLKV-- 235
           L+ +     TA  + K+  ++ ++P I +       ++G+ +   IS     +++LK   
Sbjct: 294 LVDTQQAKSTAHEVAKVDLLKQKHPAIVDSILNAIDMVGQSAAVMISDPEYDSEDLKCVE 353

Query: 236 -LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            L + M    GLL +LGVS  +L E + +L +   I  +K++G+G G C I L K
Sbjct: 354 DLGKLMTVNHGLLVSLGVSHPRL-ERIRELVDHEGIGWTKLTGAGGGGCSITLLK 407


>gi|331701429|ref|YP_004398388.1| phosphomevalonate kinase [Lactobacillus buchneri NRRL B-30929]
 gi|329128772|gb|AEB73325.1| phosphomevalonate kinase [Lactobacillus buchneri NRRL B-30929]
          Length = 361

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 90/177 (50%), Gaps = 23/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLGQY 60
           I V APG L + GE+ V+  G+ +++ A+++ V + ++  K       +    DS   + 
Sbjct: 2   IKVKAPGKLYIAGEYAVVETGYPSIIVALDQFVTVEISRSKSYGSIVSKQYREDSVYWRR 61

Query: 61  CGS-LDLAMFHPSFSFIIMAI---NHIKPSCG-----FDLKVISQLDS----QLGLGSSA 107
            G  + L     +F++II AI        S G     +DL++ S LDS    + GLGSSA
Sbjct: 62  RGDQMILDNRDNTFNYIISAIQLTEEYAQSLGRQMELYDLRINSDLDSPNGKKYGLGSSA 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           A+TVA   AL   Q++  P     L    AI  L VQG  S  D+AAS++GG I Y+
Sbjct: 122 AVTVATVKALC--QFYNLPLTKSKLFKLSAIAHLDVQGNGSLGDIAASVYGGWIAYR 176


>gi|134058497|emb|CAL00706.1| unnamed protein product [Aspergillus niger]
          Length = 448

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/358 (24%), Positives = 145/358 (40%), Gaps = 78/358 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------NID 54
           VSAPG +++ GEH V+HG AA+  AI+ R    +T   +  R I             NID
Sbjct: 7   VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYFLVTTLSKSQRTITLNLRDMDFNHTWNID 66

Query: 55  S---------SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLK------------- 92
                     S  +Y   L  ++    +  +   +  I P    +++             
Sbjct: 67  DLPWDFFKQPSKKKYYYDLVTSLDEELYDSLKPCVEDISPKAPEEIRKKHKGSALAFLYL 126

Query: 93  -----------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPDE- 130
                       I  L S +    GLGSSA++    +AALL LQ       H +  PDE 
Sbjct: 127 FCSLGSPQHPGAIYTLRSTIPMGAGLGSSASVCTCFSAALL-LQIRTLAGPHDDQPPDEA 185

Query: 131 ------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPI 178
                 I   A    L + G  SG+D   S  G  + ++   YS     I   +F   P+
Sbjct: 186 ELQIERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRREDYSKPPKVIPLPNFPELPL 245

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNL 233
            L+ +     TA  + K+  ++ E+P + E     I++   +    +  +   ++  + L
Sbjct: 246 LLVDTRQSRSTAVEVAKVGKLKKEHPLVTESILDAIDKVTVSAQSAIQGVEGDSIDKETL 305

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           + +   +    G L +LGVS  +L  I  +L +  +I  +K++G+G G C I L + D
Sbjct: 306 EHIGTLVRVNHGFLVSLGVSHPRLERIR-ELVDFANIGWTKLTGAGGGGCAITLLRPD 362


>gi|317038103|ref|XP_001401587.2| mevalonate kinase [Aspergillus niger CBS 513.88]
          Length = 539

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/358 (24%), Positives = 146/358 (40%), Gaps = 78/358 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------NID 54
           VSAPG +++ GEH V+HG AA+  AI+ R    +T   +  R I             NID
Sbjct: 98  VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYFLVTTLSKSQRTITLNLRDMDFNHTWNID 157

Query: 55  S---------SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLK------------- 92
                     S  +Y   L  ++    +  +   +  I P    +++             
Sbjct: 158 DLPWDFFKQPSKKKYYYDLVTSLDEELYDSLKPCVEDISPKAPEEIRKKHKGSALAFLYL 217

Query: 93  -----------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPDE- 130
                       I  L S +    GLGSSA++    +AALL LQ       H +  PDE 
Sbjct: 218 FCSLGSPQHPGAIYTLRSTIPMGAGLGSSASVCTCFSAALL-LQIRTLAGPHDDQPPDEA 276

Query: 131 ------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-FPI 178
                 I   A    L + G  SG+D   S  G  + ++   YS     I   +F   P+
Sbjct: 277 ELQIERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRREDYSKPPKVIPLPNFPELPL 336

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNL 233
            L+ +     TA  + K+  ++ E+P + E     I++   +    +  +   ++  + L
Sbjct: 337 LLVDTRQSRSTAVEVAKVGKLKKEHPLVTESILDAIDKVTVSAQSAIQGVEGDSIDKETL 396

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           + +   +    G L +LGVS  +L E + +L +  +I  +K++G+G G C I L + D
Sbjct: 397 EHIGTLVRVNHGFLVSLGVSHPRL-ERIRELVDFANIGWTKLTGAGGGGCAITLLRPD 453


>gi|226467520|emb|CAX69636.1| mevalonate kinase (mevalonic aciduria) [Schistosoma japonicum]
          Length = 391

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/356 (21%), Positives = 151/356 (42%), Gaps = 73/356 (20%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL-------------- 50
           ++K  VSAP   +L GEH V++G+ A+   I       +T++ +                
Sbjct: 1   MNKFVVSAPAKAILFGEHAVVYGYPAIATTIKLHCYFTVTIKNETCENITLDLKDLSENS 60

Query: 51  ----------INIDSSLGQYCGSLDLAMFHPSFS-----------------FIIMAINHI 83
                     I+I + +  Y   L   +F  ++                    I A+  +
Sbjct: 61  IHIPIKMVHSISIKTPVLDYAWKLVSDLFDCAYRDSPRSSSITASTCVIIYLFIRAMQLL 120

Query: 84  KPSCGFD-------------LKVISQLDSQLGLGSSAAITVAITAALLTLQ--------Y 122
              C                ++V S++ +  G+GSS A +VA    +L L         +
Sbjct: 121 GDKCNNQQCCPLLNGENAIYIEVHSEIPTGSGIGSSGAFSVAAATTVLLLTNTYPLLKIW 180

Query: 123 HKEPSPDEILTT-AHAIVLKVQGISSGIDLAASIHGGLICY---QMPKY---SIEKIDFI 175
             + +  E++++ A      + G SSG+D     +GG I +   ++P +   +I  +D +
Sbjct: 181 DIDRTHRELISSLARDAERIIHGTSSGLDSTICTYGGTIVFSKDRLPSFRRINIPNVDAV 240

Query: 176 FPIHLIYSGYKTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
             + L+ +     T+  +KK+    + +   +N I ++I  ++ ++S I  Q    +  +
Sbjct: 241 -KLLLVSTNITRSTSMAVKKVYDRWKEDKTYVNSIFKEIGIIVDEVSDILNQKHTWETCQ 299

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
            L   + + Q LL+ LGVS+S  +E++ +LRE    + +K++G+G G CV+    G
Sbjct: 300 SLISYIVKNQYLLKELGVSNSVSNELIEELREVG--IPAKVTGAGFGGCVVGFISG 353


>gi|325978457|ref|YP_004288173.1| mevalonate kinase [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
 gi|325178385|emb|CBZ48429.1| mvk [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 292

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 133/286 (46%), Gaps = 40/286 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       +  I+ D              F+ 
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIEVECHIYPAEEKIHFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  + A    +NH   S  + ++  S++  + G+GSSAA+++A   A+     + E S
Sbjct: 56  TLSTAVYAALEYLNHTDVSITYAIR--SEIPQKRGMGSSAAVSIAAIRAVFD---YFEQS 110

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D  + T   +V K + I+    SG+D    +    I + +       +D     +L+  
Sbjct: 111 ID--MDTLEILVNKAEIIAHSNPSGLDAKTCLSDKAITF-IRNIGFSTLDLDLDAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + ++K++  E       E N    A++G L++I  +A+++K+++ +   M 
Sbjct: 168 DTGIYGNTREAVEKVAQAE-------EANLPHLAVLGDLTEIVQKAIQDKDIQKIGHMMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +    L+ +GVS     ++V KL  +   + +K+SG GLG C+IAL
Sbjct: 221 KAHAHLQAIGVSIDVADQLV-KLSLENGALGAKMSGGGLGGCIIAL 265


>gi|332364383|gb|EGJ42157.1| mevalonate kinase [Streptococcus sanguinis SK355]
          Length = 292

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +ID      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIDLDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVVAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|227510341|ref|ZP_03940390.1| possible mevalonate kinase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227189993|gb|EEI70060.1| possible mevalonate kinase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 325

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 135/285 (47%), Gaps = 28/285 (9%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKD---RLIN---IDSSLGQYCGSLDLAMF 69
           ++  GEH V++G  A+   +   V ++ +++ D   + IN    D  + +   +L     
Sbjct: 13  IIWFGEHSVVYGKPAIALPL-YNVDVHTSIKTDVTGQTINCRYFDGPISKMADNL----- 66

Query: 70  HPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
               S +I  +  I       F L++ S++ S+ G+GSSAA  VAI      L +    +
Sbjct: 67  -KGVSVLIHELLTIFNATDLNFHLEIDSKIPSERGMGSSAATAVAIVRVFFKL-FETPLT 124

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF---PIHLIYSG 184
            D +L  A        G  SG+D A +     + +   + + E+IDF      + +  SG
Sbjct: 125 RDRLLGLADVEEKITHGNPSGLDTATASSDTPVWFIRNEIN-EQIDFNLSKSSLVIADSG 183

Query: 185 YKTPTAQVLKKISYIEIEYPEINE--INQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            K  T + +  +    ++ PE  +  I+Q     +G++++ + QAL+  + + L + M +
Sbjct: 184 IKGKTGEAVSMVHDNLLDQPEFAKPLIDQ-----LGQIAKDARQALQISDEQRLGRLMTQ 238

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q  L  LGVS  KL +   ++  Q   + +K++GSGLG C+I++
Sbjct: 239 SQYNLSKLGVSTRKLDDFC-RIAIQNGALGAKLTGSGLGGCMISI 282


>gi|305663858|ref|YP_003860146.1| mevalonate kinase [Ignisphaera aggregans DSM 17230]
 gi|304378427|gb|ADM28266.1| mevalonate kinase [Ignisphaera aggregans DSM 17230]
          Length = 347

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 127/294 (43%), Gaps = 39/294 (13%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAAL------------------VFAINKRVILYLTLR 46
           + +I VS P  + L GEH V++G  A+                  V  IN R  +++ + 
Sbjct: 1   MDEIIVSIPTKVTLFGEHAVVYGKPAIATTIPVFIEISGVLIREPVLTINMRNPIHMYIE 60

Query: 47  KDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAIN------HIKPSCGFDLKVISQLDSQ 100
               I+ID +  +   S D         +++ A+             G+ + + S L   
Sbjct: 61  S---ISIDRTTNKLNVSTDRKHVEQLIRYMVTALEICEDDLKTDKRYGYVININSDLPPG 117

Query: 101 LGLGSSAAITVAITAALLTLQYHK------EPSPDEILTTAHAIVLKVQGISSGIDLAAS 154
           +GLG+SAAI+V  T  L  L  +       E S + I   A     +VQG++S +D    
Sbjct: 118 IGLGTSAAISVG-TITLCELLNNGMTIDSIEKSKERIAYLAWKTEQRVQGMASPMDTFTI 176

Query: 155 IHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQK 212
             GGL          + ID    I+++   +  K  TA++++++  ++ + P + +    
Sbjct: 177 TFGGLRYIDPTTLQAKPIDINKEINILVGATERKYTTAELVRRVRMLKEKNPLLID---S 233

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLRE 266
           I + +G +   + +AL + +   L   MN   G LE LG+ D K S I+  LR+
Sbjct: 234 IMSGIGYVVSEAYKALIDGDWDYLGMLMNINHGFLEALGIVDEKHSNIIHILRK 287


>gi|61555432|gb|AAX46713.1| mevalonate kinase [Bos taurus]
          Length = 440

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 127/320 (39%), Gaps = 74/320 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCG 62
           + VSAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI         
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAMALNLRTFLRLQPHSNGRVGLNLPNIGVRRAWDVA 65

Query: 63  SLDLAMFHPSF-------SFIIMAINHIKPSCGF-------------------------- 89
           SL L     SF       +     +  +K   GF                          
Sbjct: 66  SLQL--LDTSFLGHGDSAALTAKHVEKLKEVAGFPKDCVDPEHLAVLAFLYLYLSICQSQ 123

Query: 90  ------DLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
                 D+ V S+L +  GLGSSAA +V + AALLT    + P+P           +E L
Sbjct: 124 RALPSLDITVWSELPTGAGLGSSAAYSVCLAAALLT-ACEEIPNPLKDGEAAGRWTEENL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + YQ  K S  K   +  I LI +     
Sbjct: 183 ELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPVLKILLINTKVPRS 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G+++     A   ++   L + +
Sbjct: 243 TKVLVANVRSRLLKFPEIVAPLLTSIDAISLECERVLGEMA----AAPTPEHYLTLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|306831549|ref|ZP_07464707.1| mevalonate kinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|304426334|gb|EFM29448.1| mevalonate kinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 292

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 133/286 (46%), Gaps = 40/286 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       +  I+ D              F+ 
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIEVECHIYPAEEKIHFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  + A    +NH   S  + ++  S++  + G+GSSAA+++A   A+     + E S
Sbjct: 56  TLSTAVYAALEYLNHTDVSITYAIR--SEIPQKRGMGSSAAVSIAAIRAVFD---YFEQS 110

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D  + T   +V K + I+    SG+D    +    I + +       +D     +L+  
Sbjct: 111 ID--MDTLEILVNKAEIIAHSNPSGLDAKTCLSDKAITF-IRNIGFSTLDLDLDAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + ++K++  E       E N    A++G L++I  +A+++K+++ +   M 
Sbjct: 168 DTGIYGNTREAVEKVAQAE-------EANLPHLAVLGDLTEIVQKAIQDKDIQKIGYMMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +    L+ +GVS     ++V KL  +   + +K+SG GLG C+IAL
Sbjct: 221 KAHAHLQAIGVSIDVADQLV-KLSLENGALGAKMSGGGLGGCIIAL 265


>gi|81428517|ref|YP_395517.1| phosphomevalonate kinase [Lactobacillus sakei subsp. sakei 23K]
 gi|78610159|emb|CAI55208.1| Phosphomevalonate kinase [Lactobacillus sakei subsp. sakei 23K]
          Length = 367

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 142/336 (42%), Gaps = 67/336 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLGQY 60
           I   APG L + GE+ V+  G  A++ A+N+ V + +   ++      +    +S   Q 
Sbjct: 13  ITAKAPGKLYIAGEYAVVETGFPAIIVALNQFVTVSIEESREYGSIVSKQYQENSLYWQR 72

Query: 61  CGSLDLAMFHPS---FSFIIMAI---NHIKPSCG-----FDLKVISQLDS----QLGLGS 105
            G  D  +F      F +I+ AI          G     + L+V S LDS    + GLGS
Sbjct: 73  QG--DEMVFDNRDNPFHYILSAIKLTEQYARQAGKKLSIYHLRVNSDLDSADGKKYGLGS 130

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-- 163
           SAA+TVA   AL    Y  E + D++   A    L VQG  S  D+AAS++GG I Y+  
Sbjct: 131 SAAVTVATVKALCAF-YKLELTNDQLYKLAAIAHLDVQGNGSLGDIAASVYGGWIAYRSF 189

Query: 164 ---------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISYIE 200
                                 P  SIE +     + L+  ++G    T+ ++ KI+  +
Sbjct: 190 DKQWLAETRPTMTLNELLAIPWPSLSIELLTPPAELSLLIGWTGSPASTSHLVDKIALAK 249

Query: 201 IEYPEINEINQKIYALMGKLSQISCQ----ALRNKNLKVLAQAMNRQQGLLETLG----- 251
            E        Q  Y    K S+   +      R  NL+ +   +   + LL+ L      
Sbjct: 250 TE-------RQADYQNFLKASKACLEDMVAGFRTNNLQQIQAELRHNRALLQELADFSHV 302

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             ++ + + +  L E+    A+K SG+G GDC I +
Sbjct: 303 AIETPVLQKMGTLAEEAG-GAAKTSGAGGGDCGIVI 337


>gi|226292608|gb|EEH48028.1| mevalonate kinase [Paracoccidioides brasiliensis Pb18]
          Length = 490

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 150/377 (39%), Gaps = 78/377 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRK--------------DRLINID 54
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K              D   NID
Sbjct: 44  VSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSQRTITLNFRDIELDHTWNID 103

Query: 55  S-SLGQYCGSLDLAMFHPSF-SFIIMAINHIKP-----SCGFDLKV-------------- 93
           S     +C       ++ S  S     +  I+P     S G   +V              
Sbjct: 104 SLPWALFCQPSKKKFYYDSVTSLDPELLEAIQPHIADISIGKPDEVRKIHRSSATAFLYL 163

Query: 94  ---ISQLDSQL-------------GLGSSAAITVAITAALLTLQY------HKEPSPDE- 130
              +S  DS               GLGSSA+I V ++AALL LQ       H++  P+E 
Sbjct: 164 FLSLSSPDSHAAIYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQPPEEA 222

Query: 131 ------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FPI 178
                 I   A    + + G  SG+D   S  G  + ++   YS        +DF   P+
Sbjct: 223 EVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELPL 282

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNL 233
            L+ S     TA  + K+      +P + E     I+Q   +    +         N+++
Sbjct: 283 LLVNSRQPRSTATEVAKVGRFCKAHPAVAESTLAAIDQVTESANNFIQSGRFDKDSNEDI 342

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
               +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I L + + N
Sbjct: 343 DHFGELFRINHGLLVSLGVSHPRLERIR-ELVDHAGIGWTKLTGAGGGGCAIVLLRANTN 401

Query: 294 SLPYQSVNCHMHAKGID 310
                 +  ++  +G +
Sbjct: 402 QAVLHHLEQNLDDEGFE 418


>gi|59857699|gb|AAX08684.1| mevalonate kinase [Bos taurus]
          Length = 396

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 133/320 (41%), Gaps = 74/320 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINI--------- 53
           + VSAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI         
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGRVGLNLPNIGVRRAWDVA 65

Query: 54  -----DSSLGQYCGSLDLAMFHP----------------------SFSFIIMAI---NHI 83
                D+S   +  S  L   H                       +F ++ ++I     +
Sbjct: 66  SLQLLDTSFLGHGDSAALTAKHVEKLKEVAGFPKDCVDPEHLAVLAFLYLYLSICQSQRV 125

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            PS   D+ V S+L +  GLGSSAA +V + AALLT    + P+P           +E L
Sbjct: 126 LPS--LDITVWSELPTGAGLGSSAAYSVCLAAALLT-ACEEIPNPLKDGEAAGRWTEENL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + YQ  K S  K   +  I LI +     
Sbjct: 183 ELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPVLKILLINTKVPRS 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G+++     A   ++   L + +
Sbjct: 243 TKVLVANVRSRLLKFPEIVAPLLTSIDAISLECERVLGEMA----AAPTPEHYLTLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|229585837|ref|YP_002844339.1| GHMP kinase [Sulfolobus islandicus M.16.27]
 gi|228020887|gb|ACP56294.1| GHMP kinase [Sulfolobus islandicus M.16.27]
          Length = 322

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 148/315 (46%), Gaps = 59/315 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD-- 65
           I +SAPG ++ +G + V+ G  + V A+NKRV   L   ++R +   +S G +  S +  
Sbjct: 2   IRISAPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNEL 61

Query: 66  ----LAMFHPSFSFIIMAINHIKPSCGFDLKVISQ----LD-SQLGLGSSAAITVAITAA 116
               L  F   F+         +   G+++++ +     LD  + GLGSS+A TV++TA 
Sbjct: 62  INSVLDTFRERFT---------QFPQGYEIELYNDKEFILDGKKTGLGSSSAATVSLTAC 112

Query: 117 LLTLQYHKEPSPD--EILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKID 173
           L    Y    + D  EI   A     K Q GI SG D+A+++ G +I  +     +EK+D
Sbjct: 113 LY---YAINGNLDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIIYKRFT--DLEKMD 167

Query: 174 FIFP--------IHLIYSGYKTPTAQVLKKI---SYIEIEYPE----INEINQKIYALMG 218
           F +         + L ++G  + T  ++KK    S +E ++ E    I+E N     L+ 
Sbjct: 168 FYYEKLKLGNYDMVLGFTGKSSETVGLVKKFVEKSNLE-DFREIMRLIDEENNMAIRLI- 225

Query: 219 KLSQISCQA----LRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQPHIMAS 273
           KL++I        L  K L  +A+ +         +GV   SK  E + K+ E+   + +
Sbjct: 226 KLNKIDEAVEHVRLGRKYLNYIAERI---------VGVKLVSKKEEELIKIAEEEGALIA 276

Query: 274 KISGSGLGDCVIALG 288
              G+G GD + ALG
Sbjct: 277 LSPGAGGGDSIFALG 291


>gi|195978205|ref|YP_002123449.1| mevalonate kinase Mvk [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195974910|gb|ACG62436.1| mevalonate kinase Mvk [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 292

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 134/288 (46%), Gaps = 40/288 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ AL   +           KD  I +   +      L    + P
Sbjct: 10  AHSKIILMGEHSVVYGYPALALPL-----------KD--IEVTCRIFPAAKPLAFDFYDP 56

Query: 72  SFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             + +  A+ H+    +P       ++SQ+  + G+GSSAA+++A   A+ +  Y ++P 
Sbjct: 57  LSTAVYAALEHLGCLAEP---IHYDIMSQVPQKRGMGSSAAVSIAAVRAVFS--YFQQPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
             E+L     +V K + I+    SG+D    +    I + +     + ID     +L+  
Sbjct: 112 SGELLEI---LVNKAEIIAHTNPSGLDAKTCLSDKAIKF-IRNVGFDTIDIQLNAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G +  T + + K++  E E       N    A +G L++   QA++ K+   + + M 
Sbjct: 168 DTGIQGHTREAVNKVAQFEEE-------NLPHLAKLGCLTEAVEQAIKTKDCLAIGRFMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +    L+ +GVS +K  ++V    E    + +K++G GLG C+IAL +
Sbjct: 221 QAHESLKAIGVSVAKADQLVEAALEA-GALGAKMTGGGLGGCMIALAE 267


>gi|296108716|ref|YP_003615665.1| mevalonate kinase [Methanocaldococcus infernus ME]
 gi|295433530|gb|ADG12701.1| mevalonate kinase [Methanocaldococcus infernus ME]
          Length = 287

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 134/288 (46%), Gaps = 30/288 (10%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI----NIDSSLGQYCGSLD 65
           + A G ++  GEH V++G+ AL   IN    + +  + D L+    N++  LG      +
Sbjct: 1   MKAKGKVIFFGEHAVVYGYTALSLPINLSTNVNIK-KNDNLVIELKNLNKKLG-----FE 54

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
            A     F ++I AI  +K    F L V S+L    GLGSSA++ VA   AL    ++  
Sbjct: 55  EAKKDKDFRYVIKAIELLKVKEPFFLSVSSELPVSCGLGSSASVVVATIRALSKF-FNLN 113

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-IEKIDFIFPIHLIYSG 184
               EI   +H +  +VQG +S  D     +   +  +  ++S I++ +       +Y  
Sbjct: 114 LPKKEIAKLSHRVEREVQGKASITDTYTISYERALKIRNNEFSFIDEFEKTVREEKLYIA 173

Query: 185 Y----KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           Y    +  TA ++K +S             ++   +  ++ +I+ +AL + +++ + + M
Sbjct: 174 YVEEREMKTADLIKVVSEK-----------EEKEEIFKEIEEITREAL-SSDVERIKELM 221

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
                LL+ LGVS   L+ +V     +     +K++G+G G CVI LG
Sbjct: 222 LENHKLLDKLGVSTKGLNRVVR--LAKKFGCGAKLTGAGGGGCVIILG 267


>gi|227828610|ref|YP_002830390.1| GHMP kinase [Sulfolobus islandicus M.14.25]
 gi|238620810|ref|YP_002915636.1| GHMP kinase [Sulfolobus islandicus M.16.4]
 gi|227460406|gb|ACP39092.1| GHMP kinase [Sulfolobus islandicus M.14.25]
 gi|238381880|gb|ACR42968.1| GHMP kinase [Sulfolobus islandicus M.16.4]
          Length = 322

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 148/315 (46%), Gaps = 59/315 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD-- 65
           I +SAPG ++ +G + V+ G  + V A+NKRV   L   ++R +   +S G +  S +  
Sbjct: 2   IRISAPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNEL 61

Query: 66  ----LAMFHPSFSFIIMAINHIKPSCGFDLKVISQ----LD-SQLGLGSSAAITVAITAA 116
               L  F   F+         +   G+++++ +     LD  + GLGSS+A TV++TA 
Sbjct: 62  INSVLDTFRERFT---------QFPQGYEIELYNDKEFILDGKKTGLGSSSAATVSLTAC 112

Query: 117 LLTLQYHKEPSPD--EILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKID 173
           L    Y    + D  EI   A     K Q GI SG D+A+++ G +I  +     +EK+D
Sbjct: 113 LY---YAINGNLDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIIYKRFT--DLEKMD 167

Query: 174 FIFP--------IHLIYSGYKTPTAQVLKKI---SYIEIEYPE----INEINQKIYALMG 218
           F +         + L ++G  + T  ++KK    S +E ++ E    I+E N     L+ 
Sbjct: 168 FYYEKLKLGNYDMVLGFTGKSSETVGLVKKFVEKSNLE-DFREIMRLIDEENNMAIRLI- 225

Query: 219 KLSQISCQA----LRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQPHIMAS 273
           KL++I        L  K L  +A+ +         +GV   SK  E + K+ E+   + +
Sbjct: 226 KLNKIDEAVEHVRLGRKYLNYIAERI---------VGVKLVSKEEEELIKIAEEEGALIA 276

Query: 274 KISGSGLGDCVIALG 288
              G+G GD + ALG
Sbjct: 277 LSPGAGGGDSIFALG 291


>gi|62751666|ref|NP_001015528.1| mevalonate kinase [Bos taurus]
 gi|75060948|sp|Q5E9T8|KIME_BOVIN RecName: Full=Mevalonate kinase; Short=MK
 gi|59858029|gb|AAX08849.1| mevalonate kinase [Bos taurus]
 gi|74356342|gb|AAI04541.1| Mevalonate kinase [Bos taurus]
 gi|296478467|gb|DAA20582.1| mevalonate kinase [Bos taurus]
          Length = 396

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 127/320 (39%), Gaps = 74/320 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCG 62
           + VSAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI         
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGRVGLNLPNIGVRRAWDVA 65

Query: 63  SLDLAMFHPSF-------SFIIMAINHIKPSCGF-------------------------- 89
           SL L     SF       +     +  +K   GF                          
Sbjct: 66  SLQL--LDTSFLGHGDSAALTAKHVEKLKEVAGFPKDCVDPEHLAVLAFLYLYLSICQSQ 123

Query: 90  ------DLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
                 D+ V S+L +  GLGSSAA +V + AALLT    + P+P           +E L
Sbjct: 124 RALPSLDITVWSELPTGAGLGSSAAYSVCLAAALLT-ACEEIPNPLKDGEAAGRWTEENL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + YQ  K S  K   +  I LI +     
Sbjct: 183 ELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPVLKILLINTKVPRS 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G+++     A   ++   L + +
Sbjct: 243 TKVLVANVRSRLLKFPEIVAPLLTSIDAISLECERVLGEMA----AAPTPEHYLTLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|293572992|ref|ZP_06683934.1| phosphomevalonate kinase [Enterococcus faecium E980]
 gi|291606894|gb|EFF36274.1| phosphomevalonate kinase [Enterococcus faecium E980]
          Length = 361

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I VSAPG L + GE+ V+  GH A++ A+++ V +  T+   R +    S  QY G    
Sbjct: 2   IEVSAPGKLYIAGEYAVVETGHPAVIAAVDQFVTV--TVESARKVGSIQS-AQYSGMPVR 58

Query: 63  ------SLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  L L +    F +I+ AI   +            +DLKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYILAAIRLTEKYAQEKNILLSFYDLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SS A+TVA   AL  + Y    S  EI   A    L VQ   S  D+AAS +GG I +
Sbjct: 119 SSGAVTVATVKAL-NVFYALNLSQLEIFKIAALANLAVQDNGSCGDIAASCYGGWIAF 175


>gi|293556923|ref|ZP_06675484.1| phosphomevalonate kinase [Enterococcus faecium E1039]
 gi|291601007|gb|EFF31298.1| phosphomevalonate kinase [Enterococcus faecium E1039]
          Length = 361

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I VSAPG L + GE+ V+  GH A++ A+++ V +  T+   R +    S  QY G    
Sbjct: 2   IEVSAPGKLYIAGEYAVVETGHPAVIAAVDQFVTV--TVESARKVGSIQS-AQYSGMPVR 58

Query: 63  ------SLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  L L +    F +I+ AI   +            +DLKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYILAAIRLTEKYAQEKNILLSFYDLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SS A+TVA   AL  + Y    S  EI   A    L VQ   S  D+AAS +GG I +
Sbjct: 119 SSGAVTVATVKAL-NVFYALNLSQLEIFKIAALANLAVQDNGSCGDIAASCYGGWIAF 175


>gi|225680902|gb|EEH19186.1| mevalonate kinase [Paracoccidioides brasiliensis Pb03]
          Length = 490

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 144/360 (40%), Gaps = 78/360 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRK--------------DRLINID 54
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K              D   NID
Sbjct: 44  VSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSQRTITLNFRDIELDHTWNID 103

Query: 55  S-SLGQYCGSLDLAMFHPSF-SFIIMAINHIKP-----SCGFDLKV-------------- 93
           S     +C       ++ S  S     +  I+P     S G   +V              
Sbjct: 104 SLPWALFCQPSKKKFYYDSVTSLDPELLEAIQPHIADISIGKPDEVRKIHRSSATAFLYL 163

Query: 94  ---ISQLDSQL-------------GLGSSAAITVAITAALLTLQY------HKEPSPDE- 130
              +S  DS               GLGSSA+I V ++AALL LQ       H++  P+E 
Sbjct: 164 FLSLSSPDSHAAIYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQPPEEA 222

Query: 131 ------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FPI 178
                 I   A    + + G  SG+D   S  G  + ++   YS        +DF   P+
Sbjct: 223 EVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELPL 282

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNL 233
            L+ S     TA  + K+      +P + E     I+Q   +    +         N+++
Sbjct: 283 LLVNSRQPRSTATEVAKVGRFCKAHPAVAESTLAAIDQVTESANNFIQSGRFDKDSNEDI 342

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
               +      GLL +LGVS  +L  I  +L +   I  +K++G+G G C I L + + N
Sbjct: 343 DHFGELFRINHGLLVSLGVSHPRLERIR-ELVDHAGIGWTKLTGAGGGGCAIVLLRANTN 401


>gi|15921220|ref|NP_376889.1| hypothetical protein ST0978 [Sulfolobus tokodaii str. 7]
 gi|15622005|dbj|BAB65998.1| 314aa long hypothetical protein [Sulfolobus tokodaii str. 7]
          Length = 314

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 88/175 (50%), Gaps = 25/175 (14%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +SAPG ++ +G + V+ G  + V AINKRV            +I SS   +        F
Sbjct: 2   ISAPGKILWIGSYSVVFGGISHVIAINKRV----------RCDIKSS-NNFIFETTYGTF 50

Query: 70  HPSFSFIIMA-INHIKPSCG----FDLKVISQLDSQL-----GLGSSAAITVAITAALLT 119
               + +I + I   K   G    F +K+ +  D Q+     GLGSS+A TVA+TA +  
Sbjct: 51  KDKGNELIESVITVFKEKFGSLPPFHVKLFNDKDFQIHGKKTGLGSSSASTVALTACIYY 110

Query: 120 LQYHKEPSPDEILTTAH-AIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID 173
             + K  + DEI   A  A  ++ +GI SG D+A++++G ++  +   Y IEK+D
Sbjct: 111 YLF-KNLNKDEIYKLAQKANYIRQKGIGSGFDIASAVYGSIVYRRF--YDIEKVD 162


>gi|69246579|ref|ZP_00604009.1| Gram positive phosphomevalonate kinase [Enterococcus faecium DO]
 gi|257878883|ref|ZP_05658536.1| phosphomevalonate kinase [Enterococcus faecium 1,230,933]
 gi|257881519|ref|ZP_05661172.1| phosphomevalonate kinase [Enterococcus faecium 1,231,502]
 gi|257885791|ref|ZP_05665444.1| phosphomevalonate kinase [Enterococcus faecium 1,231,501]
 gi|257890741|ref|ZP_05670394.1| phosphomevalonate kinase [Enterococcus faecium 1,231,410]
 gi|258615045|ref|ZP_05712815.1| phosphomevalonate kinase [Enterococcus faecium DO]
 gi|260558442|ref|ZP_05830638.1| phosphomevalonate kinase [Enterococcus faecium C68]
 gi|261207164|ref|ZP_05921853.1| phosphomevalonate kinase [Enterococcus faecium TC 6]
 gi|289565285|ref|ZP_06445736.1| phosphomevalonate kinase [Enterococcus faecium D344SRF]
 gi|293560304|ref|ZP_06676801.1| phosphomevalonate kinase [Enterococcus faecium E1162]
 gi|293567763|ref|ZP_06679104.1| phosphomevalonate kinase [Enterococcus faecium E1071]
 gi|294615074|ref|ZP_06694960.1| phosphomevalonate kinase [Enterococcus faecium E1636]
 gi|294617088|ref|ZP_06696755.1| phosphomevalonate kinase [Enterococcus faecium E1679]
 gi|294620917|ref|ZP_06700118.1| phosphomevalonate kinase [Enterococcus faecium U0317]
 gi|314938975|ref|ZP_07846240.1| phosphomevalonate kinase [Enterococcus faecium TX0133a04]
 gi|314943474|ref|ZP_07850241.1| phosphomevalonate kinase [Enterococcus faecium TX0133C]
 gi|314948233|ref|ZP_07851627.1| phosphomevalonate kinase [Enterococcus faecium TX0082]
 gi|314951593|ref|ZP_07854639.1| phosphomevalonate kinase [Enterococcus faecium TX0133A]
 gi|314991544|ref|ZP_07857020.1| phosphomevalonate kinase [Enterococcus faecium TX0133B]
 gi|314994877|ref|ZP_07860004.1| phosphomevalonate kinase [Enterococcus faecium TX0133a01]
 gi|9937395|gb|AAG02447.1|AF290095_3 phosphomevalonate kinase [Enterococcus faecium]
 gi|68195187|gb|EAN09643.1| Gram positive phosphomevalonate kinase [Enterococcus faecium DO]
 gi|257813111|gb|EEV41869.1| phosphomevalonate kinase [Enterococcus faecium 1,230,933]
 gi|257817177|gb|EEV44505.1| phosphomevalonate kinase [Enterococcus faecium 1,231,502]
 gi|257821647|gb|EEV48777.1| phosphomevalonate kinase [Enterococcus faecium 1,231,501]
 gi|257827101|gb|EEV53727.1| phosphomevalonate kinase [Enterococcus faecium 1,231,410]
 gi|260075616|gb|EEW63922.1| phosphomevalonate kinase [Enterococcus faecium C68]
 gi|260078792|gb|EEW66494.1| phosphomevalonate kinase [Enterococcus faecium TC 6]
 gi|289162941|gb|EFD10790.1| phosphomevalonate kinase [Enterococcus faecium D344SRF]
 gi|291589348|gb|EFF21155.1| phosphomevalonate kinase [Enterococcus faecium E1071]
 gi|291592016|gb|EFF23639.1| phosphomevalonate kinase [Enterococcus faecium E1636]
 gi|291596646|gb|EFF27872.1| phosphomevalonate kinase [Enterococcus faecium E1679]
 gi|291599528|gb|EFF30544.1| phosphomevalonate kinase [Enterococcus faecium U0317]
 gi|291605754|gb|EFF35191.1| phosphomevalonate kinase [Enterococcus faecium E1162]
 gi|313590859|gb|EFR69704.1| phosphomevalonate kinase [Enterococcus faecium TX0133a01]
 gi|313593828|gb|EFR72673.1| phosphomevalonate kinase [Enterococcus faecium TX0133B]
 gi|313596287|gb|EFR75132.1| phosphomevalonate kinase [Enterococcus faecium TX0133A]
 gi|313597846|gb|EFR76691.1| phosphomevalonate kinase [Enterococcus faecium TX0133C]
 gi|313641684|gb|EFS06264.1| phosphomevalonate kinase [Enterococcus faecium TX0133a04]
 gi|313645366|gb|EFS09946.1| phosphomevalonate kinase [Enterococcus faecium TX0082]
          Length = 361

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I VSAPG L + GE+ V+  GH A++ A+++ V +  T+   R +    S  QY G    
Sbjct: 2   IEVSAPGKLYIAGEYAVVETGHPAVIAAVDQFVTV--TVESARKVGSIQS-AQYSGMPVR 58

Query: 63  ------SLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  L L +    F +I+ AI   +            +DLKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYILAAIRLTEKYAQEKNILLSFYDLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SS A+TVA   AL  + Y    S  EI   A    L VQ   S  D+AAS +GG I +
Sbjct: 119 SSGAVTVATVKAL-NVFYALNLSQLEIFKIAALANLAVQDNGSCGDIAASCYGGWIAF 175


>gi|15672386|ref|NP_266560.1| mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|281490946|ref|YP_003352926.1| mevalonate kinase [Lactococcus lactis subsp. lactis KF147]
 gi|12723278|gb|AAK04502.1|AE006277_2 mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|281374704|gb|ADA64224.1| Mevalonate kinase [Lactococcus lactis subsp. lactis KF147]
 gi|326405980|gb|ADZ63051.1| mevalonate kinase [Lactococcus lactis subsp. lactis CV56]
          Length = 310

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 129/301 (42%), Gaps = 37/301 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS------LD 65
           A   L+L+GEH V++G  A+         L +T+ K  +    S  GQY  +      LD
Sbjct: 11  AHSKLILIGEHSVVYGQPAIA--------LPVTILKTTVTITSSKYGQYIENNEFRRRLD 62

Query: 66  LA--MFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
           L    F      I+  ++    S   F L++ S +    GLG+SA++  AI  A      
Sbjct: 63  LMGDEFEGIRQLIMRLLSKFHSSKMPFSLEIDSNIPQGRGLGASASLATAIIRAFYDFFD 122

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY 182
            + P  D +L  A+       G SSGID+A       +  + P + I K   I P  L  
Sbjct: 123 AELPQKD-LLFYANFSENITHGKSSGIDVAT------VNSEHPLWFI-KDSTIEPFELNL 174

Query: 183 SGY--------KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
            G+           T+Q    I+ +  +  E  E  Q     +G+L+  S   L    LK
Sbjct: 175 HGFIVIGDTGVHGFTSQA---INIVREKLVEEKEKTQDSINHLGQLATDSKDFLMTDKLK 231

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                MN+    L  LGVS  +L  +V   R+    + +K++GSGLG  ++AL + + ++
Sbjct: 232 EFGHVMNKAHERLSDLGVSHPRLDNLVETARKNG-ALGAKLTGSGLGGVMVALAENEKDA 290

Query: 295 L 295
           +
Sbjct: 291 I 291


>gi|255728383|ref|XP_002549117.1| hypothetical protein CTRG_03414 [Candida tropicalis MYA-3404]
 gi|240133433|gb|EER32989.1| hypothetical protein CTRG_03414 [Candida tropicalis MYA-3404]
          Length = 431

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 148/374 (39%), Gaps = 77/374 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR-------------------- 49
           VSAPG +++ GEH  ++G  A+  A++ R  L ++   D                     
Sbjct: 8   VSAPGKVIIFGEHSAVYGKPAIAAALSLRCYLLVSPSVDANTITLKFPDIELDHSWNIND 67

Query: 50  --------LINIDSS----------------LGQYCGSLDLAM-FHPSFSFIIMAINHIK 84
                    I  DS+                L     + D  M ++  F F+ + +N   
Sbjct: 68  IPWEEIKPFIKYDSNNKPLVPPELVPEIVDKLSGLLTAFDNKMHYYACFCFLYLFVNLCD 127

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTL-------------QYHKEPSPDE 130
               G    V S L    GLGSSA+ +V +++AL  L             ++  E  PD 
Sbjct: 128 SKTPGATFVVRSTLPIGAGLGSSASTSVCLSSALALLGGWINKPSISADDKFLSEDIPDL 187

Query: 131 ILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFP-IHLIYS 183
                 +++ +    G  SGID A +  GG + +Q      + SI      FP I L+ +
Sbjct: 188 EFVDKWSLMGEKCFHGNPSGIDNAVATFGGAVMFQRNSAPEQPSIRTNMRNFPAIKLLLT 247

Query: 184 GYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-----RNKNLKVL 236
             K P  TA ++  +  +  E+   N I   + A M  L+Q + + +           +L
Sbjct: 248 NTKVPKSTAALVAGVGQLNSEF---NSITTSVLAAMEHLAQEAYKVMITPGFGKDETTIL 304

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
            + +N   GLL  LGVS   L E V  + ++  I A+K++G+G G C I L   ++    
Sbjct: 305 RKLVNMNHGLLVALGVSHPAL-ETVKIIGDKHQIGATKLTGAGGGGCAITLVNDNVEESV 363

Query: 297 YQSVNCHMHAKGID 310
            Q       ++G D
Sbjct: 364 IQEAIKEFESEGYD 377


>gi|227550899|ref|ZP_03980948.1| phosphomevalonate kinase [Enterococcus faecium TX1330]
 gi|257887850|ref|ZP_05667503.1| phosphomevalonate kinase [Enterococcus faecium 1,141,733]
 gi|257893352|ref|ZP_05673005.1| phosphomevalonate kinase [Enterococcus faecium 1,231,408]
 gi|257896532|ref|ZP_05676185.1| phosphomevalonate kinase [Enterococcus faecium Com12]
 gi|293379311|ref|ZP_06625457.1| phosphomevalonate kinase [Enterococcus faecium PC4.1]
 gi|227179997|gb|EEI60969.1| phosphomevalonate kinase [Enterococcus faecium TX1330]
 gi|257823904|gb|EEV50836.1| phosphomevalonate kinase [Enterococcus faecium 1,141,733]
 gi|257829731|gb|EEV56338.1| phosphomevalonate kinase [Enterococcus faecium 1,231,408]
 gi|257833097|gb|EEV59518.1| phosphomevalonate kinase [Enterococcus faecium Com12]
 gi|292642107|gb|EFF60271.1| phosphomevalonate kinase [Enterococcus faecium PC4.1]
          Length = 361

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I VSAPG L + GE+ V+  GH A++ A+++ V +  T+   R +    S  QY G    
Sbjct: 2   IEVSAPGKLYIAGEYAVVETGHPAVIAAVDQFVTV--TVESARKVGSIQS-AQYSGMPVR 58

Query: 63  ------SLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  L L +    F +I+ AI   +            +DLKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYILAAIRLTEKYAQEKNILLSFYDLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SS A+TVA   AL  + Y    S  EI   A    L VQ   S  D+AAS +GG I +
Sbjct: 119 SSGAVTVATVKAL-NVFYALNLSQLEIFKIAALANLAVQDNGSCGDIAASCYGGWIAF 175


>gi|257899513|ref|ZP_05679166.1| phosphomevalonate kinase [Enterococcus faecium Com15]
 gi|257837425|gb|EEV62499.1| phosphomevalonate kinase [Enterococcus faecium Com15]
          Length = 361

 Score = 62.8 bits (151), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 85/178 (47%), Gaps = 27/178 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I VSAPG L + GE+ V+  GH A++ A+++ V +  T+   R +    S  QY G    
Sbjct: 2   IEVSAPGKLYIAGEYAVVETGHPAVIAAVDQFVTV--TVESARKVGSIQS-AQYSGMPVR 58

Query: 63  ------SLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLG 104
                  L L +    F +I+ AI   +            +DLKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYILAAIRLTEKYAQEKNILLSFYDLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SS A+TVA   AL  + Y    S  EI   A    L VQ   S  D+AAS +GG I +
Sbjct: 119 SSGAVTVATVKAL-NVFYALNLSQLEIFKIAALANLAVQDNGSCGDIAASCYGGWIAF 175


>gi|323478407|gb|ADX83645.1| GHMP kinase [Sulfolobus islandicus HVE10/4]
          Length = 322

 Score = 62.8 bits (151), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 159/349 (45%), Gaps = 65/349 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD-- 65
           I VS+PG ++ +G + V+ G  + V A+NKRV   L   ++R +   +S G +  S +  
Sbjct: 2   IRVSSPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNEL 61

Query: 66  ----LAMFHPSFSFIIMAINHIKPSCGFDLKVISQ----LD-SQLGLGSSAAITVAITAA 116
               L  F   F+ +        P  G+++++ +     LD  + GLGSS+A TV++TA 
Sbjct: 62  INSVLDTFRERFTQL--------PQ-GYEIELYNDKEFILDGKKTGLGSSSAATVSLTAC 112

Query: 117 LLTLQYHKEPSPD--EILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKID 173
           L    Y    + D  EI   A     K Q GI SG D+A+++ G +I  +     +EK+D
Sbjct: 113 LY---YAINGNLDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIIYKRFT--DLEKMD 167

Query: 174 FIFP--------IHLIYSGYKTPTAQVLKKI---SYIEIEYPE----INEINQKIYALMG 218
           F +         + L ++G  + T  ++KK    S +E ++ E    I+E N     L+ 
Sbjct: 168 FYYEKLKLGNYDMVLGFTGKSSETVGLVKKFVEKSNLE-DFREIMRLIDEENNMAIKLV- 225

Query: 219 KLSQISCQA----LRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQPHIMAS 273
           KL++I        L  K L  +A+ +         +GV   SK  E + K+ E+   + +
Sbjct: 226 KLNKIDEAVEHVRLGRKYLNYIAERI---------VGVKLVSKEEEELIKIAEEEGALIA 276

Query: 274 KISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSL 322
              G+G GD + ALG    N L    V      +GI  + +  +    L
Sbjct: 277 LSPGAGGGDSIFALG----NDLS--KVREAWKRRGITTIDVKENEGLKL 319


>gi|212537675|ref|XP_002148993.1| mevalonate kinase [Penicillium marneffei ATCC 18224]
 gi|210068735|gb|EEA22826.1| mevalonate kinase [Penicillium marneffei ATCC 18224]
          Length = 558

 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 93/385 (24%), Positives = 157/385 (40%), Gaps = 85/385 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG AAL  AI+ R  +L  TL K         R I +D +    
Sbjct: 112 VSAPGKVIVFGEHAVVHGKAALAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDHTWD-- 169

Query: 61  CGSLDLAMF-HPS-----FSFII--------------MAINHIKPSCGFDLKVISQ---- 96
             SL   +F HPS     +  +                A++  KP    D++ I Q    
Sbjct: 170 IDSLPWNVFKHPSKKKMYYDLVTELDPDLVAAVQPHAAAVSTDKPD---DVRKIHQSSAA 226

Query: 97  --------------------LDSQL----GLGSSAAITVAITAA-LLTLQYHKEPSPDEI 131
                               L S +    GLGSSA+++V ++AA LL ++    P PD+ 
Sbjct: 227 QFLYLFLSLGSPESHAAIYTLRSTIPIGAGLGSSASVSVCLSAALLLQIRTLAGPHPDQP 286

Query: 132 LTTAHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYS----IEKIDFI- 175
              A   + ++            G  SG+D   S  G  + ++   YS    +  ++   
Sbjct: 287 PEEAEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVLFRRSDYSKPPTVTPLNKFP 346

Query: 176 -FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEIN----QKIYALMGKLSQISCQALRN 230
             P+ L+ +     TA  + K+  +   +PE+ E       K+     ++ + S      
Sbjct: 347 ELPLLLVNTRQSRSTAVEVAKVGRLRETHPEVTEAMLDTIDKVTMSASEMIKESDFEEDE 406

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
           + L+          GLL +LGVS  +L E + +L +  +I  +K++G+G G C I L + 
Sbjct: 407 EALEEFGALFRINHGLLVSLGVSHPRL-ERIRELVDYANIGWTKLTGAGGGGCAITLIRP 465

Query: 291 DLNSLPYQSVNCHMHAKGIDIVPIT 315
           D      + +   + A+  +    T
Sbjct: 466 DATPETLKDLEAKLAAENFEKFETT 490


>gi|322493823|emb|CBZ29112.1| putative mevalonate kinase [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 352

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 126/289 (43%), Gaps = 28/289 (9%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLR--------KDRLINIDSSLGQYCGSLD 65
           G ++L GEH V+HG  A+V  I++     L +          DR   I   + Q      
Sbjct: 40  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDRRPAIPGYIAQKRDEQK 99

Query: 66  LAMFHPSFSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
            A          + ++H+K      G  + +   L    G+G+SA+  VA + AL  L Y
Sbjct: 100 KAH--------QLVLDHLKVDLSGDGLKMFIDGPLVPSSGIGASASDVVAFSRALSEL-Y 150

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--QMPKYSIEKIDFIFPIHL 180
               + +E+  +A        G  SG D  A+ +GGLI Y  Q  K + + I F   ++L
Sbjct: 151 QLNLTDEEVNQSAFVGEGGYHGTPSGADNTAATYGGLISYRRQDGKSAFKPIAFQQRLYL 210

Query: 181 IY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
           +   +G    T +V+  +  ++ + P      +++Y     +   + +AL+  +L+ L Q
Sbjct: 211 VVVSTGITASTMKVVNDVHKMKHQQP---ARFKRLYDSYTHIVSQAREALQKGDLQRLGQ 267

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            MN    L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 268 LMNANHDLCREIDVSCRELELIVQTCRTY-GALGAKLSGTGRGGIAVAL 315


>gi|254556623|ref|YP_003063040.1| phosphomevalonate kinase [Lactobacillus plantarum JDM1]
 gi|308180569|ref|YP_003924697.1| phosphomevalonate kinase [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254045550|gb|ACT62343.1| phosphomevalonate kinase [Lactobacillus plantarum JDM1]
 gi|308046060|gb|ADN98603.1| phosphomevalonate kinase [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 363

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 156/347 (44%), Gaps = 57/347 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-----YC 61
           I V APG L + GE+ V+  G+ A++ A+++ V   ++   + + +I S   Q     + 
Sbjct: 2   ITVKAPGKLYIAGEYAVVESGYPAIIVALDQFVTATIS-PSETIGSIVSEQYQENSIVWR 60

Query: 62  GSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDS----QLGLGSS 106
              D  +F      F +I+ AIN        +    G + L + S+LDS    + GLGSS
Sbjct: 61  RQGDAMVFDNRDNPFHYILAAINLTESYAHELGRELGVYHLGINSELDSADGKKYGLGSS 120

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AA+TVA   AL    YH     +++   A    L VQG  S  D+AAS++GG I Y    
Sbjct: 121 AAVTVATVKALCQF-YHLPMDKNKLFKLAAIAHLSVQGNGSLGDIAASVYGGWIAYHSFD 179

Query: 163 ------QMPKYSIE----------KIDFIFP-----IHLIYSGYKTPTAQVLKKISYIEI 201
                 Q  + S+           KI+ + P     + + ++G    T+ ++ K++ ++ 
Sbjct: 180 RQWLHLQQAQSSLSDLLTMPWPDLKIELLTPPAALRLMIGWTGSPASTSHLVDKVALVKA 239

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-----VSDSK 256
           +  + +E    + A    L ++      + +L V+   +   + LL+ LG       ++ 
Sbjct: 240 K--QRSEYQTFLKASKACLKRM-ITGFHHSDLHVIQTELRTNRQLLQKLGDFSHVTIETP 296

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           L + + +L E     A+K SG+G GDC I L    ++  P  +   H
Sbjct: 297 LLQRMIQLAESAG-AAAKTSGAGGGDCGIVLIDQTIDPRPLLTAWAH 342


>gi|300767357|ref|ZP_07077269.1| phosphomevalonate kinase [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300495176|gb|EFK30332.1| phosphomevalonate kinase [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 371

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 156/347 (44%), Gaps = 57/347 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-----YC 61
           I V APG L + GE+ V+  G+ A++ A+++ V   ++   + + +I S   Q     + 
Sbjct: 10  ITVKAPGKLYIAGEYAVVESGYPAIIVALDQFVTATIS-PSETIGSIVSEQYQENSIVWR 68

Query: 62  GSLDLAMFHPS---FSFIIMAIN-------HIKPSCG-FDLKVISQLDS----QLGLGSS 106
              D  +F      F +I+ AIN        +    G + L + S+LDS    + GLGSS
Sbjct: 69  RQGDAMVFDNRDNPFHYILAAINLTESYAHELGRELGVYHLGINSELDSADGKKYGLGSS 128

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AA+TVA   AL    YH     +++   A    L VQG  S  D+AAS++GG I Y    
Sbjct: 129 AAVTVATVKALCQF-YHLPMDKNKLFKLAAIAHLSVQGNGSLGDIAASVYGGWIAYHSFD 187

Query: 163 ------QMPKYSIE----------KIDFIFP-----IHLIYSGYKTPTAQVLKKISYIEI 201
                 Q  + S+           KI+ + P     + + ++G    T+ ++ K++ ++ 
Sbjct: 188 RQWLHLQQAQSSLSDLLTMPWPDLKIELLTPPAALRLMIGWTGSPASTSHLVDKVALVKA 247

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-----VSDSK 256
           +  + +E    + A    L ++      + +L V+   +   + LL+ LG       ++ 
Sbjct: 248 K--QRSEYQTFLKASKACLKRM-ITGFHHSDLHVIQTELRTNRQLLQKLGDFSHVTIETP 304

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           L + + +L E     A+K SG+G GDC I L    ++  P  +   H
Sbjct: 305 LLQRMIQLAESAG-AAAKTSGAGGGDCGIVLIDQTIDPRPLLTAWAH 350


>gi|326472664|gb|EGD96673.1| mevalonate kinase [Trichophyton tonsurans CBS 112818]
          Length = 518

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 97/385 (25%), Positives = 152/385 (39%), Gaps = 94/385 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 75  VSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD-- 132

Query: 61  CGSLDLAMFH-PSFS-FIIMAINHIKPSCGFDLK-------------------------- 92
             SL   +FH PS   F   ++  + P     LK                          
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 93  -------------VISQLDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                         I  L S +    GLGSSA+++V ++ ALL LQ       H++  PD
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALL-LQVRILAGPHQDQPPD 251

Query: 130 E-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-----IEKIDFI-F 176
           E       I   A    L + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 252 EAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQM 311

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR------- 229
            + LI S     TA  + K++ ++  +P + E      +++  +   +  A R       
Sbjct: 312 KLLLINSRQPRSTAVEVAKVAALKKAHPVVTE------SILDSIDHTTESAYRLIASDDF 365

Query: 230 ----NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
               ++ +  L +      GLL +LGVS   L  I  +L +   I  +K++G+G G C I
Sbjct: 366 DEHCSEKIDHLGELFRINHGLLVSLGVSHPHLERIR-ELVDHADIGWTKLTGAGGGGCTI 424

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGID 310
            L K   N    + +   +  +G D
Sbjct: 425 TLFKAKWNEEAIEHLEEQLDDEGYD 449


>gi|322706489|gb|EFY98069.1| mevalonate kinase [Metarhizium anisopliae ARSEF 23]
          Length = 490

 Score = 62.4 bits (150), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 89/365 (24%), Positives = 152/365 (41%), Gaps = 91/365 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKD------RLINID-------- 54
           VSAPG +++ GEH V++G AA+  AI+ R  L++T L K       R  +ID        
Sbjct: 46  VSAPGKVIVFGEHSVVYGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFTDIDLVHTWNID 105

Query: 55  -------------SSLGQYCGSLD---LAMFHP-------------------SFSFIIMA 79
                         S       LD   +A   P                   +F+F+ + 
Sbjct: 106 ELPWDTFQQPSKKKSYYSLVTELDPDLVAALEPHVDVSPDSPEDIRRVHRNGAFAFLYLF 165

Query: 80  INHIKPS---CGFDLKVISQLDSQLGLGSSAAITVAITAALL-TLQYHKEPSPDEILTTA 135
           ++   PS   C + L+  S +    GLGSSA+I V ++AALL  L+    P PD+    A
Sbjct: 166 LSLGSPSFPGCLYTLR--STIPIGAGLGSSASIAVCVSAALLIQLRTLSGPHPDQPPEEA 223

Query: 136 HAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FPI 178
              + ++            G  SG+D   +  G  + +Q   Y+         DF   P+
Sbjct: 224 RLQIERINRWAFVYEMCIHGNPSGVDNTVATQGKAVVFQRLDYNKPPAVKPLWDFPELPL 283

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA----------- 227
            L+ +     TA  + K+  +   +P++      + +++  + +++  A           
Sbjct: 284 LLVDTKQPKSTAHEVAKVGKLNKMHPKL------VGSILDAMDKVASSASELIADDDFDE 337

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               +L  + + M    GLL +LGVS  +L E V +L +   I  +K++G+G G C I L
Sbjct: 338 EDEGSLMKVGELMTINHGLLVSLGVSHPRL-ERVRELVDHEGIGWTKLTGAGGGGCSITL 396

Query: 288 GKGDL 292
            + D+
Sbjct: 397 LRPDV 401


>gi|327468609|gb|EGF14088.1| mevalonate kinase [Streptococcus sanguinis SK330]
          Length = 292

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 129/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELNLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L+ LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLDKLGVSCQKADELVAVALENG-ALGAKMSGGGLGGCVIAL 265


>gi|42519130|ref|NP_965060.1| mevalonate kinase [Lactobacillus johnsonii NCC 533]
 gi|41583417|gb|AAS09026.1| mevalonate kinase [Lactobacillus johnsonii NCC 533]
          Length = 305

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 135/294 (45%), Gaps = 31/294 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           KI V A G ++L+GEH V++G+ AL   I    I       D    +D++   Y G+  D
Sbjct: 4   KIEVKAHGKVILIGEHSVVYGYDALALPIQALNITTTVEETDGPTWMDTT--HYHGAFFD 61

Query: 66  LAMFHPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL-----LT 119
               +    +I+   +  ++ +    +    ++  + G GSSA + +  T A+     LT
Sbjct: 62  APDEYDGIKYIVKTLLERVENAPNLKITYTGEIPMERGFGSSAVVALGTTKAVSQFLGLT 121

Query: 120 LQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICY----QMPKYSIEKIDF 174
           L      S  EI+  T HA ++   G +SG+D AA+++   + +      PK   +K+  
Sbjct: 122 L------SEAEIMEITNHAEMIN-HGKASGLD-AATVNSDYLVFFNKQDGPKQLSQKLGA 173

Query: 175 IFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
              I        T  A Q +KK         + +++ +K  A +G+L+  + Q   N+N 
Sbjct: 174 TLLIMDTGELGNTKVAVQSVKK-------QMDESDLKKKQIARLGELATATRQNWFNQNA 226

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + + +  N  + +L +  +S  ++  I  K+  +   + +K+SG GLG  VIAL
Sbjct: 227 EEIGKIFNEAEDILASFKLSTERIDNIC-KIANENGALGAKLSGGGLGGIVIAL 279


>gi|149246950|ref|XP_001527900.1| hypothetical protein LELG_00420 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146447854|gb|EDK42242.1| hypothetical protein LELG_00420 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 439

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 106/230 (46%), Gaps = 37/230 (16%)

Query: 88  GFDLKVISQLDSQLGLGSSAAITVAITAALLTL-QYHKEPS------------PDEILTT 134
           G+   V S L    GLGSSA+  V ++AAL  L  + K+P             P+     
Sbjct: 138 GYTFVVRSTLPIGAGLGSSASTAVCLSAALSKLGNWIKDPKLSNHDHVLESEIPELDFID 197

Query: 135 AHAIVLK--VQGISSGIDLAASIHGGLICYQM----PKYSIE-KIDFIFPIHLIYSGYKT 187
             +++ +    G  SGID A + HGG + YQ      K S+   I    PI L+ +  K 
Sbjct: 198 NWSLIGEKCFHGNPSGIDNAVATHGGAVKYQRILNSTKSSLRSSIRDFPPIKLLLTNTKV 257

Query: 188 P--TAQVLKKISYIEIEYPEINE--------INQKIYALMGKLSQISCQALRNKNLKVLA 237
           P  TA+++  +  +  E+P+I          I+++ Y +M  L Q   Q         L 
Sbjct: 258 PKSTAKLVAGVGELTKEFPDITNPILNAVEFISEQAYEVM-HLPQFGKQ-----ETATLR 311

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + +N   GLL  LGVS   L E V  + ++ ++ A+K++G+G G C I L
Sbjct: 312 KLVNMNHGLLVALGVSHPAL-ETVKIISDKYNLGATKLTGAGGGGCAITL 360



 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 7  KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT 44
          K  VSAPG +++ GEH  ++G  A+  A++ R  L +T
Sbjct: 10 KFVVSAPGKVIIFGEHAAVYGKPAIAAALSLRCFLLVT 47


>gi|71651924|ref|XP_814628.1| mevalonate kinase [Trypanosoma cruzi strain CL Brener]
 gi|70879620|gb|EAN92777.1| mevalonate kinase, putative [Trypanosoma cruzi]
          Length = 328

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 131/285 (45%), Gaps = 20/285 (7%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLGQYC--GSLDLA 67
           G ++L GEH V+HG  ALV  I++     L L K +    +++   ++  Y    + +  
Sbjct: 17  GKIILFGEHFVVHGAEALVAGIDEYTSCRLELTKGQPGICVVDGRPAVPGYIVEKAEEQR 76

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H     +   +N      G  + +   L    G+G+SA+  V+++ AL  + Y  + +
Sbjct: 77  LAH---RLVFRHLNIDTSVDGVRIHLGGPLVPTSGIGASASDVVSLSRALSEM-YGLDLT 132

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEKIDFIFPIHLIY--S 183
            DE+  +A        G  SG D  A+  GGLI Y+      +  ++    P+ L+   +
Sbjct: 133 EDEVNLSAFVGEGGYHGTPSGADNTAATFGGLISYRRVNGVSNFSRVLITRPLFLVVCST 192

Query: 184 GYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           G  T T +V+ +I  ++   P   N + ++  A +G+       A+   NL  + + MN 
Sbjct: 193 GITTSTTKVVGEIRELKENNPTWFNALLERYNACVGEAK----AAMEVGNLFRMGELMNE 248

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              L + L VS ++L  IV    E    + +K+SG+G G  V+AL
Sbjct: 249 NHKLCQELTVSCAELDTIVNFCCEN-GALGAKMSGTGRGGLVVAL 292


>gi|288905467|ref|YP_003430689.1| mevalonate kinase [Streptococcus gallolyticus UCN34]
 gi|288732193|emb|CBI13758.1| putative mevalonate kinase [Streptococcus gallolyticus UCN34]
          Length = 292

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 133/286 (46%), Gaps = 40/286 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       +  I+ D              F+ 
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIEVECHIYPAEEKIHFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  + A    +NH   S  + ++  S++  + G+GSSAA+++A   A+     + E S
Sbjct: 56  TLSTAVYAALEYLNHTDVSITYAIR--SEIPQKRGMGSSAAVSIAAIRAVFD---YFEQS 110

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D  + T   +V K + I+    SG+D    +    I + +       +D     +L+  
Sbjct: 111 ID--MDTLEILVNKAEIIAHSNPSGLDAKTCLSDKAITF-IRNIGFSTLDLDLDAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + ++K++  E       E N    A +G L++I  +A+++K+++ +   M 
Sbjct: 168 DTGIYGNTREAVEKVAQAE-------EANLPHLAALGDLTEIVQKAIQDKDIQKIGHMMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +    L+ +GVS   +S+ + KL  +   + +K+SG GLG C+IAL
Sbjct: 221 KAHAHLQAIGVS-IDVSDQLVKLSLENGALGAKMSGGGLGGCIIAL 265


>gi|315225771|ref|ZP_07867559.1| mevalonate kinase [Parascardovia denticolens DSM 10105]
 gi|315119903|gb|EFT83035.1| mevalonate kinase [Parascardovia denticolens DSM 10105]
          Length = 375

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 130/294 (44%), Gaps = 28/294 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVF---------AINKRVILYLTLRKDRLINIDSSLGQYCG 62
           A G ++L+GEH V+H   A+           A++     YL  R         +   Y G
Sbjct: 34  AHGKVILIGEHSVVHFKPAIALPLMTTAIDVAVSANGSSYLDPR------FHLTCDYYSG 87

Query: 63  SLDLAMFHPSFSFIIMAINHIK---PS--CGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
            L+ A F+ +    + A  H +   P    GFD+ ++S +  + G+GSSAA+ VA+T A+
Sbjct: 88  PLESAPFNLNNLKKLQAALHNRLCLPQKLGGFDINIVSTIPRERGMGSSAAVAVALTRAI 147

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
                    S  EI   +        G +SG+D  A+ H   + ++    +    D   P
Sbjct: 148 AAYS-GVILSEQEIFDYSQISENVAHGNASGLDSIATAHDKAVWFERGAQT-RTFDLACP 205

Query: 178 IHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQ--KIYALMGKLSQISCQALRNKNL 233
             LI   +G +  T + ++ +  + +   E  E  Q  K    +G+L+    +ALR  ++
Sbjct: 206 GVLIVADTGIRGGTREAVEDVHKL-LYSQERGEARQAAKDIDRLGELTADCARALRQGDV 264

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + L   M+    +L +L VS  +L  +V     +     +K++G G G C+IAL
Sbjct: 265 RRLGYIMDEAHEVLSSLAVSSPELDRLV-AAARRAGAAGAKLTGGGRGGCMIAL 317


>gi|5578718|gb|AAD45421.1|L77688_1 mevalonate kinase [Arabidopsis thaliana]
          Length = 376

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 85/357 (23%), Positives = 143/357 (40%), Gaps = 103/357 (28%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR------KDRLINIDSSLGQYCGSLD 65
           APG ++L GEH V+HG  A+  AI+  +  Y+TLR       DRL            +L 
Sbjct: 7   APGKIILAGEHAVVHGSTAVAAAID--LYTYVTLRFPLPSNNDRL------------TLQ 52

Query: 66  LAMFHPSFSFIIMAINHIKP------------SC-------------------------- 87
           L      FS+ +  I    P            SC                          
Sbjct: 53  LKDISLEFSWSLARIKEAIPYDSSTLCRSTPASCSEETLKSIAVLVEEQNLPKEKMWLSS 112

Query: 88  -------------GFDLKVI---SQLDSQLGLGSSAAITVAITAALLTLQYHKEP----- 126
                        GF+   +   S+L    GLGSSAA+ VA+TAALL     ++      
Sbjct: 113 GISTFLWLYTRIIGFNPATVVINSELPYGSGLGSSAALCVALTAALLASSISEKTRGNGW 172

Query: 127 -SPDEI-LTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
            S DE  L   +    +    + G  SGID   S +G +I  +     I ++    P+ +
Sbjct: 173 SSLDETNLELLNKWAFEGEKIIHGKPSGIDNTVSAYGNMI--KFCSGEITRLQSNMPLRM 230

Query: 181 IYSGYKT--PTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRN 230
           + +  +    T  ++  +S   + +P+        ++ I++++ A++    + S      
Sbjct: 231 LITNTRVGRNTKALVSGVSQRAVRHPDAMKSVFNAVDSISKELAAIIQSKDETSVTEKEE 290

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +    + + M   QGLL ++GVS S +  ++  L    H + SK++G+G G CV+ L
Sbjct: 291 R----IKELMEMNQGLLLSMGVSHSSIEAVI--LTTVKHKLVSKLTGAGGGGCVLTL 341


>gi|242063784|ref|XP_002453181.1| hypothetical protein SORBIDRAFT_04g001220 [Sorghum bicolor]
 gi|241933012|gb|EES06157.1| hypothetical protein SORBIDRAFT_04g001220 [Sorghum bicolor]
          Length = 403

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/360 (24%), Positives = 154/360 (42%), Gaps = 89/360 (24%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAIN--KRVILYLT----------------LRKD 48
           ++   APG ++L GEH V+HG AA+  AI+   R  L L                 LR  
Sbjct: 15  EVRARAPGKIILAGEHAVVHGSAAVAAAIDLYTRSSLLLRPTGEGGGADFGAVELYLRDS 74

Query: 49  RLI------NIDSSLGQYCGS-----------------------------LDLAMFHPSF 73
           RL        +  +LG+  G+                             + L+    +F
Sbjct: 75  RLTFSWPCSRLRGALGEEIGANPGAPAPCSPDQLAAIAWLLEDQEIPEAKIWLSAGLSAF 134

Query: 74  SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT------LQYHKEPS 127
            F+  +I   +P      +V S L    GLGSSAA  V+++ ALLT      +   +   
Sbjct: 135 LFLYTSILGCRPG---KAEVTSDLPMGAGLGSSAAFCVSMSGALLTAAGAVSVGASRGAE 191

Query: 128 PDEILTTAHAIVLK---------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
             E+L  A   ++          + G  SGID + S  G +I ++  K  +  ++   P+
Sbjct: 192 GWEVLEKADLELVNQWAFQGEKIIHGKPSGIDNSVSTFGKMIKFK--KGELTNLESRNPV 249

Query: 179 HLIYSGYKTP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQAL 228
            ++ +  +    T  ++  +S     +P+        +N I++++ +++ +L+     A+
Sbjct: 250 KMLITDTRVGRNTKALVAGVSERASRHPDAMASVFHAVNSISEELSSIV-ELAAEDEIAI 308

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVIAL 287
            +K  K LA+ M   QGLL+ +GVS S +  +   LR    + + SK++G+G G CV+ L
Sbjct: 309 TSKEDK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKYSLVSKLTGAGGGGCVLTL 364


>gi|163790894|ref|ZP_02185318.1| mevalonate kinase [Carnobacterium sp. AT7]
 gi|159873847|gb|EDP67927.1| mevalonate kinase [Carnobacterium sp. AT7]
          Length = 314

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 128/289 (44%), Gaps = 27/289 (9%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA--M 68
           +A G ++LMGEH V++G  A+        +       +  + +D     Y G+L  A   
Sbjct: 11  TANGKIILMGEHSVVYGEPAIAIPFPATRVEVAVTSVEGPVQLDCVY--YQGNLSAAPKQ 68

Query: 69  FHPSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
                + +   +N +      F L + S +  + G+GSSAA+ +A+  AL    +    +
Sbjct: 69  LANLIAVVESTLNELNQDLKNFKLTIDSTVPVERGMGSSAAVAIAMVRALFAY-FSTNLT 127

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI-FPI----HLIY 182
            D +L  A+       G  SG+D A      +   + P Y I+   F+ FP+    +LI 
Sbjct: 128 NDVLLALANVSETIAHGNPSGLDAA------MTSGKQPLYYIKGEPFVPFPLSMSAYLIV 181

Query: 183 --SGYKTPTAQVLKKISYIEIEYPEI--NEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
             +G K  T   +  I+ +  E P++  + I+Q     +G L++ +  A+       L  
Sbjct: 182 ADTGLKGQTRDAVASIAQLNQENPKLTMDAIHQ-----LGALAKQAKLAIEANIPVTLGL 236

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            M+     L  LGVS+  L+ +V   R     + +K++G G G C+IAL
Sbjct: 237 VMDSAHEKLSFLGVSNDTLNHLVKTARTN-GALGAKLTGGGRGGCMIAL 284


>gi|323353485|ref|ZP_08088018.1| mevalonate kinase [Streptococcus sanguinis VMC66]
 gi|322121431|gb|EFX93194.1| mevalonate kinase [Streptococcus sanguinis VMC66]
          Length = 292

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|227513349|ref|ZP_03943398.1| possible mevalonate kinase [Lactobacillus buchneri ATCC 11577]
 gi|227083222|gb|EEI18534.1| possible mevalonate kinase [Lactobacillus buchneri ATCC 11577]
          Length = 325

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 131/283 (46%), Gaps = 24/283 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKD---RLIN---IDSSLGQYCGSLDLAMF 69
           ++  GEH V++G  A+   +   V ++ +++ D   + IN    D  + +   +L     
Sbjct: 13  IIWFGEHSVVYGKPAIALPL-YNVDVHTSIKTDVTGQTINCRYFDGPISEMADNL----- 66

Query: 70  HPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
               S +I  +  I       F L++ S++ S+ G+GSSAA  VAI      L +    +
Sbjct: 67  -KGVSVLIHELLTIFNATDLNFHLEIDSKIPSERGMGSSAATAVAIVRVFFNL-FETPLT 124

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF---PIHLIYSG 184
            D +L  A        G  SG+D A +     + +   + + E+IDF      + +  SG
Sbjct: 125 RDRLLELAEVEEKITHGNPSGLDTATASSDTPVWFIRNEIN-EQIDFNLSKSSLVIADSG 183

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            K  T + +  +    ++ P   E  + +   +G++++ +  AL+  + + L + M + Q
Sbjct: 184 IKGKTGEAVSMVHDNLLDQP---EFAKPLIEQLGQIAKDARHALQISDEQRLGRLMTQSQ 240

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  KL     ++  Q   + +K++GSGLG C+I++
Sbjct: 241 YNLSKLGVSTRKLDNFC-RIAIQNGALGAKLTGSGLGGCMISI 282


>gi|322501380|emb|CBZ36459.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 329

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 128/282 (45%), Gaps = 14/282 (4%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS 72
           G ++L GEH V+HG  A+V  I++     L +      + +D       G +        
Sbjct: 17  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYI-AQKRDEQ 75

Query: 73  FSFIIMAINHIKPSCGFD-LKVI--SQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                + ++H+K     D LK++    L    G+G+SA+  VA + AL  L Y    + +
Sbjct: 76  IKAHQLVLDHLKVDLSRDGLKMLIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDE 134

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--PKYSIEKIDFIFPIHLIY--SGY 185
           E+  +A        G  SG D  A+ +GGLI Y+    K + + I F   ++L+   +G 
Sbjct: 135 EVNQSAFVGEGGYHGTPSGADNTAATYGGLISYRRHDGKSAFKPIAFQQRLYLVVVGTGI 194

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              TA+V+  +  ++ + P      +++Y     +   + +AL+  +L+ L Q MN    
Sbjct: 195 NASTAKVVNDVHKMKKQQP---AQFKRLYDNYTHIVSQAREALQKGDLQRLGQLMNANHD 251

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 252 LCRQIDVSCRELESIVQTCRTY-GALGAKLSGTGRGGIAVAL 292


>gi|225868462|ref|YP_002744410.1| mevalonate kinase [Streptococcus equi subsp. zooepidemicus]
 gi|225701738|emb|CAW99105.1| mevalonate kinase [Streptococcus equi subsp. zooepidemicus]
          Length = 292

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 134/288 (46%), Gaps = 40/288 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ AL   +           KD  I +   +      L    + P
Sbjct: 10  AHSKIILMGEHSVVYGYPALALPL-----------KD--IEVTCRIFPAAKPLAFDFYDP 56

Query: 72  SFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             + +  A+ H+    +P       ++SQ+  + G+GSSAA+++A   A+ +  Y  +P 
Sbjct: 57  LSTAVYAALEHLGCLAEP---IHYDIMSQVPQKRGMGSSAAVSIAAVRAVFS--YFGKPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            +E+L     +V K + I+    SG+D    +    I + +     + ID     +L+  
Sbjct: 112 SNELLEI---LVNKAEIIAHTNPSGLDAKTCLSDKAIKF-IRNVGFDTIDIQLNAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G +  T + + K++  E       E N    A +G L++   QA++ K+   + + M 
Sbjct: 168 DTGIQGHTREAVNKVAQFE-------EENLLHLAKLGCLTEAVEQAIKTKDCLAIGRFMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +    L+ +GVS +K  ++V    E    + +K++G GLG C+IAL +
Sbjct: 221 QAHESLKAIGVSVAKADQLVEAALEA-GALGAKMTGGGLGGCMIALAE 267


>gi|225870467|ref|YP_002746414.1| mevalonate kinase [Streptococcus equi subsp. equi 4047]
 gi|225699871|emb|CAW93757.1| mevalonate kinase [Streptococcus equi subsp. equi 4047]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 132/288 (45%), Gaps = 40/288 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ AL   +           KD  I +   +      L    + P
Sbjct: 10  AHSKIILMGEHSVVYGYPALALPL-----------KD--IEVTCRIFPAAKPLAFDFYDP 56

Query: 72  SFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             + +  A+ H+    +P       ++SQ+  + G+GSSAA+++A   A+ +  Y  +P 
Sbjct: 57  LSTAVYAALEHLGCLAEP---IHYDIMSQVPQKRGMGSSAAVSIAAVRAVFS--YFGQPL 111

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            DE+L     +V K + I+    SG+D    +    I + +     + ID     +L+  
Sbjct: 112 SDELLEI---LVNKAEIIAHTNPSGLDAKTCLSDKAIKF-IRNVGFDTIDIQLNAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G +  T + + K++  E       E N    A +G  ++   QA++  +   + + M 
Sbjct: 168 DTGIQGHTREAVNKVAQFE-------EENLPHLAKLGCFTEAVEQAIKTNDCLAIGRFMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +    L+ +GVS +K  ++V    E    + +K++G GLG C+IAL +
Sbjct: 221 QAHESLKAIGVSVAKADQLVAAALEA-GALGAKMTGGGLGGCMIALAE 267


>gi|146094774|ref|XP_001467381.1| mevalonate kinase [Leishmania infantum JPCM5]
 gi|134071746|emb|CAM70439.1| putative mevalonate kinase [Leishmania infantum JPCM5]
          Length = 329

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 128/282 (45%), Gaps = 14/282 (4%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS 72
           G ++L GEH V+HG  A+V  I++     L +      + +D       G +        
Sbjct: 17  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYI-AQKRDEQ 75

Query: 73  FSFIIMAINHIKPSCGFD-LKVI--SQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                + ++H+K     D LK++    L    G+G+SA+  VA + AL  L Y    + +
Sbjct: 76  IKAHQLVLDHLKVDLSRDGLKMLIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDE 134

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--PKYSIEKIDFIFPIHLIY--SGY 185
           E+  +A        G  SG D  A+ +GGLI Y+    K + + I F   ++L+   +G 
Sbjct: 135 EVNQSAFVGEGGYHGTPSGADNTAATYGGLISYRRHNGKSAFKPIAFQQRLYLVVVGTGI 194

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              TA+V+  +  ++ + P      +++Y     +   + +AL+  +L+ L Q MN    
Sbjct: 195 NASTAKVVNDVHKMKKQQP---AQFKRLYDNYTHIVSQAREALQKGDLQRLGQLMNANHD 251

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 252 LCRQIDVSCRELESIVQTCRTY-GALGAKLSGTGRGGIAVAL 292


>gi|332364785|gb|EGJ42554.1| mevalonate kinase [Streptococcus sanguinis SK1059]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGSKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVTAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|325693781|gb|EGD35700.1| mevalonate kinase [Streptococcus sanguinis SK150]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGSKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|321264019|ref|XP_003196727.1| cystathionine beta-lyase [Cryptococcus gattii WM276]
 gi|317463204|gb|ADV24940.1| Cystathionine beta-lyase, putative [Cryptococcus gattii WM276]
          Length = 917

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 140/351 (39%), Gaps = 73/351 (20%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR---------------- 49
             I VSAPG ++L GEH V+HG  A+  +++ R    L+ R+DR                
Sbjct: 479 EDIAVSAPGKVILFGEHAVVHGVTAIASSVDLRCFSVLSPRRDRKVGLEVPNIGVEIEWE 538

Query: 50  -------LINIDSSLGQYCGS--LDLAMFHP--------------------SFSFIIMAI 80
                  L+ + S+  ++     LD A+                       +F ++ M I
Sbjct: 539 ISKLPWNLLPVHSNGERHVADKELDTALLEAVERAVNAHVEVGKTGVGACVAFLYLYMMI 598

Query: 81  -NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE-PSPDEI------L 132
                 +        S L    GLGSSAA +  + A+ L  + H   PS D +      L
Sbjct: 599 AGEESNALSVTFTASSNLPISAGLGSSAAYSTCVAASFLLARQHLSIPSTDRLSKEDTDL 658

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMP----KYSIEKIDFIFPIHLIYSGYK 186
               A + +  + G  SGID A ++ GG + +       +  ++ +     + L+ +   
Sbjct: 659 VDGWAFLAEKILHGNPSGIDNAVAVRGGAVAFTRSVGGKQGGMDGLHGFSSVRLLLTNTF 718

Query: 187 TP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVL 236
            P  T  ++  +S   +  P+        I  I+ +  +L+G    +  +A+  K L+ L
Sbjct: 719 VPRDTKTLVAGVSAKRLAEPQAVNHILDSIQAISDEARSLLGGGKPVE-RAILVKRLEAL 777

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              +      L  LGVS   L  IV    + P  +A+K++G+G G C + L
Sbjct: 778 ---IKENHVHLVNLGVSHPSLEMIVAATAQAPFELATKLTGAGGGGCALTL 825


>gi|223934071|ref|ZP_03626021.1| mevalonate kinase [Streptococcus suis 89/1591]
 gi|223897262|gb|EEF63673.1| mevalonate kinase [Streptococcus suis 89/1591]
          Length = 311

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 135/284 (47%), Gaps = 15/284 (5%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLI---NIDSSLGQYCGSLDLA 67
           A G ++LMGEH V++G  A+    +   +I  +T + + L    +    L      +  +
Sbjct: 7   ANGKIILMGEHAVVYGQPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPKIWES 66

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H +  F +  I          +++ S + ++ G+GSSAA+ VA+  AL    Y KE +
Sbjct: 67  LKH-AIRFSLYRIG-APTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YKKELT 123

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             E+     +      G  SGID AA+  G    + +    IE  +     +L+   +G 
Sbjct: 124 DSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAYLVVADTGV 182

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + +  ++ +  + PE  ++ ++    +G L++ + + L     ++L   MN+   
Sbjct: 183 TGNTLEAISDVADLLEKKPEAIKLVEE----LGNLTRQAKEDLATGQAEILGSRMNQAHA 238

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LL+ LGVSD  L ++V  L ++   + +K++G G G C++AL +
Sbjct: 239 LLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMLALAR 281


>gi|324992169|gb|EGC24091.1| mevalonate kinase [Streptococcus sanguinis SK405]
 gi|327459485|gb|EGF05831.1| mevalonate kinase [Streptococcus sanguinis SK1]
 gi|327472893|gb|EGF18320.1| mevalonate kinase [Streptococcus sanguinis SK408]
 gi|327490684|gb|EGF22465.1| mevalonate kinase [Streptococcus sanguinis SK1058]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVSAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|308070306|ref|YP_003871911.1| galactokinase [Paenibacillus polymyxa E681]
 gi|305859585|gb|ADM71373.1| Galactokinase (Galactose kinase) [Paenibacillus polymyxa E681]
          Length = 392

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 137/325 (42%), Gaps = 50/325 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G   L  A+     L L  R D  I+  S+   Y  S+       
Sbjct: 26  APGRVNLIGEHIDYNGGYVLPAALEFGTTLILRARNDDEIHFASTNLSYEVSISRGEIGK 85

Query: 65  ---DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
              D  + +P    + +A   + PS G+DL    ++ +  GL SSA+I V    A LT++
Sbjct: 86  NKTDEWVDYPVGVLVELAEKGVYPSNGYDLLYHGEIPNGAGLSSSASIEVVTGYAFLTIE 145

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LICYQMP--KYSIEKI 172
             +E    EI   +        G++ GI D  A  +G       L+C  +   K      
Sbjct: 146 -KQETDTVEIALLSQRAENNYVGVNCGIMDQFAVANGAADHAILLMCDTLDYRKVPFRTG 204

Query: 173 DFIFPI-------HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ-IS 224
           D+   I        L+ S Y    +Q  + +S ++ + P +  + Q   A  G+L + I+
Sbjct: 205 DYKLVIGNTNKRRGLVDSAYNERRSQCAEALSILQQQEPSLEYLAQLDEARFGELQRHIA 264

Query: 225 CQALRNK-------NLKVLA--------------QAMNRQQGLLETL-GVSDSKLSEIVW 262
            + +R +       N +VLA              Q MN     L  L  VS ++L  +V 
Sbjct: 265 DETVRRRAQHVVEENARVLASVDALAANELAAFGQLMNASHDSLRDLYEVSCTELDVMVE 324

Query: 263 KLREQPHIMASKISGSGLGDCVIAL 287
           + R  P  + ++++G+G G C ++L
Sbjct: 325 EARRIPGTLGARMTGAGFGGCTVSL 349


>gi|315641784|ref|ZP_07896788.1| phosphomevalonate kinase [Enterococcus italicus DSM 15952]
 gi|315482459|gb|EFU72998.1| phosphomevalonate kinase [Enterococcus italicus DSM 15952]
          Length = 360

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 156/372 (41%), Gaps = 83/372 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL-------TLRKDRLINIDSSLGQ 59
           I VS PG L + GE+ V+  G+ A++ A+++ + + +       T+   +  ++     +
Sbjct: 2   IEVSVPGKLYIAGEYAVVEPGYPAVIVAVDQFITVKIEAATKSGTIHSQQYSDLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSSA 107
             G L L      F +I+ AI   +            +DLKV S+LD+    + GLGSS 
Sbjct: 62  RNGELVLDHRENPFHYILEAIRLTEKYAAEKGRLLAFYDLKVTSELDNSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--P 165
           A+TVA   AL  L Y  E     +   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVATVKAL-NLFYDLEMDQLTVFKISALAHLAVQGNGSCGDIAASSYGGWIAFSTFDH 180

Query: 166 KYSIEKIDFIFPI-HLI-----------------------YSGYKTPTAQVLKKISYIEI 201
           K+ ++K +  +PI HL+                       ++G    T+ ++ ++S    
Sbjct: 181 KWVLDKQE-KWPIGHLLAEPWPMLTIQPLPTPKNLRLVIGWTGSPASTSDLVDQVSQSRG 239

Query: 202 EYPEINEINQKIYALMGKLSQISCQ----ALRNKNLKVLAQAMNRQQGLLETLGVSDSKL 257
           E        QK+Y      S+   Q    A   +++  + + + + + LL       + L
Sbjct: 240 E-------KQKLYQQFLDESKDCVQTLIDAFMEEDVPTIKRMILKNRELL-------ANL 285

Query: 258 SEIVWKLREQPHIM-----------ASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           S+I   + E P +            A+K SG+G GDC I +       LP  S       
Sbjct: 286 SQITGVIIETPSLEKLCQLAISCGGAAKSSGAGGGDCGIVIADQRTGILPLMSA-----W 340

Query: 307 KGIDIVPITPSH 318
           +  DI+P+ P H
Sbjct: 341 EKADIIPL-PLH 351


>gi|303390875|ref|XP_003073668.1| mevalonate kinase [Encephalitozoon intestinalis ATCC 50506]
 gi|303302815|gb|ADM12308.1| mevalonate kinase [Encephalitozoon intestinalis ATCC 50506]
          Length = 276

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 138/303 (45%), Gaps = 49/303 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR---KDRLINIDSSLGQYCGSLDLAM 68
           +P  ++L GEHGVL G  A   AI+ ++  YL ++   +D+ + ID   G Y   +DL  
Sbjct: 7   SPLKVILFGEHGVLSG--ARCLAISIKIYGYLAMKPSPRDKAVVIDGE-GNY---IDL-- 58

Query: 69  FHPSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
                      I   K S  G D  +  +     GLG+SAA++       L L Y +   
Sbjct: 59  -----------IEKYKCSIPGSDAILFLEASLGCGLGTSAAVS-------LLLSYGR-VQ 99

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ---MPKYSIEKIDFIFPIHLIYSG 184
             ++   A AI     G +SG+D+ A   GGLI ++   + K S   +   F I +  S 
Sbjct: 100 DSKMTREALAIENMFHGKASGVDVLACYTGGLISFKQGNVQKLSTRHLSR-FKILIFNSR 158

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-RNKNLKVLAQAMNRQ 243
               T   +           ++ E+ +++Y  +GK+S+ +   L R   L+ L + + + 
Sbjct: 159 IPKNTQSAI-----------QVGELKKELYDEIGKISEEAYWLLQREFTLEELYKLIRKS 207

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           Q LL+ LGV   ++ E+V ++R+    +  KI+G+G G  ++ +   DL    +  V+  
Sbjct: 208 QDLLDELGVCPREMREVVRRMRDIG--VEVKITGAGCGGHLVTVVNKDLEIPGWTPVSID 265

Query: 304 MHA 306
           +  
Sbjct: 266 LQG 268


>gi|297812975|ref|XP_002874371.1| hypothetical protein ARALYDRAFT_489582 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297320208|gb|EFH50630.1| hypothetical protein ARALYDRAFT_489582 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 378

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 145/359 (40%), Gaps = 105/359 (29%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR--------KDRLINIDSSLGQYCGS 63
           APG ++L GEH V+HG  A+  AI+  +  Y+TLR         DRL            +
Sbjct: 7   APGKIILAGEHAVVHGSTAVAAAID--LYTYVTLRFPLQSAENSDRL------------T 52

Query: 64  LDLAMFHPSFSFIIMAINHIKP------------SC------------------------ 87
           L L      FS+ +  I    P            SC                        
Sbjct: 53  LQLKDISLEFSWSLARIKEAIPYDSSTLCRSTPTSCSQETLKSIAVLVEEQNLPKEKIWL 112

Query: 88  ---------------GFDLKVI---SQLDSQLGLGSSAAITVAITAALLTLQYHKE---- 125
                          GF+   +   S+L    GLGSSAA+ VA+TAALL      +    
Sbjct: 113 SSGISTFLWLYTRIIGFNPATVVINSELPYGSGLGSSAALCVALTAALLASSISDKTCGN 172

Query: 126 --PSPDEI-LTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
              S DE  L   +    +    + G  SGID   S +G +I  +     I ++    P+
Sbjct: 173 GWSSLDETNLELLNKWAFEGEKIIHGKPSGIDNTVSAYGNMI--KFCSGEITRLQSNMPL 230

Query: 179 HLIYSGYKT--PTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQAL 228
            ++ +  +    T  ++  +S     +P+        ++ I+Q++ A++    + S    
Sbjct: 231 RMLITNTRVGRNTKALVSGVSQRAARHPDAMNSVFNAVDSISQELAAIIQSKDETSVTE- 289

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + +++K L   M   QGLL+++GVS S +  +V    +  H + SK++G+G G CV+ L
Sbjct: 290 KEESIKEL---MEMNQGLLQSMGVSHSSIEAVVQTTVK--HKLVSKLTGAGGGGCVLTL 343


>gi|328945445|gb|EGG39597.1| mevalonate kinase [Streptococcus sanguinis SK1087]
          Length = 292

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGSKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|300214467|gb|ADJ78883.1| Mevalonate kinase [Lactobacillus salivarius CECT 5713]
          Length = 314

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 32/300 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ----- 59
            H    S+   ++L+GEH V++GH A+   + K V    +++      I SS  Q     
Sbjct: 4   FHDAKGSSHAKIILIGEHAVVYGHPAIALPL-KTVTATASIKV-----IPSSSEQTITSS 57

Query: 60  -YCGSLDLAMFHPSF---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
            Y GS+D  M          I+  ++ ++   GF+L + SQL ++ G+GSSAA+ ++I  
Sbjct: 58  YYDGSVD-DMPKNMLGIKKLILKLVSDLRIENGFELHLSSQLPAERGMGSSAAVAISIIR 116

Query: 116 ----ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
               A  T   HK     ++L+ A           SG+D   S     I + +    I  
Sbjct: 117 CFYNATDTRINHK-----KLLSYADIAEKVTHNNPSGLDATTSASDNPI-WLIRNKEITP 170

Query: 172 IDFIFPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
           I      +L+   SG K  T++ + KI   ++   EI+  ++   A +G+L+Q +   L 
Sbjct: 171 IPINLDAYLLISDSGIKGQTSEAI-KIVKDQLNTDEISTSSK--LAALGRLAQTTRDQLA 227

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           N ++  L +     Q  L +LGVS  KL  ++  +  +   + SK++G G G C I+L K
Sbjct: 228 NNDIVGLGKTFTLAQKDLISLGVSTPKLDNLI-NIALKNGSLGSKLTGGGRGGCFISLLK 286


>gi|332358633|gb|EGJ36457.1| mevalonate kinase [Streptococcus sanguinis SK1056]
          Length = 292

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGSKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELNLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|161507628|ref|YP_001577582.1| phosphomevalonate kinase [Lactobacillus helveticus DPC 4571]
 gi|160348617|gb|ABX27291.1| phosphomevalonate kinase [Lactobacillus helveticus DPC 4571]
          Length = 360

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 145/338 (42%), Gaps = 58/338 (17%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+ V + +T  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQNCPAVLVAVNQFVRVSITKSKTSTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI++ +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RQGSKMVIDNRDNPFEYILSAISYTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-- 163
           AA+TVA   A+L   ++     +E++    AI    VQG  S  D+AAS++GG + YQ  
Sbjct: 122 AAVTVATVKAIL--HFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTF 179

Query: 164 ---MPKYSIE---------------KIDFIFPIH--LIYSGYKTPTAQVLKKISYIEIEY 203
                +Y +                KI+ + P H   +  G+    A   + +       
Sbjct: 180 DKKWLQYELANKTLSDVVNEAWPGLKIELLTPPHDMKLMIGWSQKPASTSRLVDETNANK 239

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWK 263
             +N   +   A   +         + KN+ ++ + +   + LL+      +K+++I  +
Sbjct: 240 AALNTEYKNFLAASSECVLKMIVGFKAKNIALIKKQIRVNRHLLQHF----AKINQIAIE 295

Query: 264 LREQPHIM--------ASKISGSGLGDCVIALGKGDLN 293
           +     ++        A+K SG+G GDC I +   D +
Sbjct: 296 IPRLTQLIKIAEDFGGAAKTSGAGNGDCGIVITDADTD 333


>gi|254564841|ref|XP_002489531.1| Mevalonate kinase, acts in the biosynthesis of isoprenoids and
           sterols, including ergosterol [Pichia pastoris GS115]
 gi|238029327|emb|CAY67250.1| Mevalonate kinase, acts in the biosynthesis of isoprenoids and
           sterols, including ergosterol [Pichia pastoris GS115]
 gi|328349954|emb|CCA36354.1| mevalonate kinase [Pichia pastoris CBS 7435]
          Length = 413

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 151/354 (42%), Gaps = 82/354 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD----RL----INIDSSLGQ 59
             VSAPG +++ GEH  ++   A+  A++ R  L +T  +D    RL    I+ + S  +
Sbjct: 5   FVVSAPGKVIIFGEHAAVYNKPAIAAALSLRTYLLVTPNEDSELIRLEFPDIHFNKSWRK 64

Query: 60  ----------YCGSLDLAM--------------------FHPS--FSFIIMAINHIKPSC 87
                     Y G   L+                     FH S  ++F+ + I+ +  + 
Sbjct: 65  DHFPWDQKPNYNGKPSLSQELEPELVDALSLFLADITSPFHYSSAYTFLYLYISLVSKTV 124

Query: 88  -GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-KEPS--PDEILTTAHAIVLKVQ 143
            G    V S L    GLGSSA+I+V +  A   L  H  +P+   DE   +  A    ++
Sbjct: 125 PGATFSVRSTLPIGAGLGSSASISVCLATAFALLDGHISKPTIGRDERTLSESADCQFIE 184

Query: 144 GIS-----------SGIDLAASIHGGLICYQMPKYSIEKIDFI---FP-IHLIYSGYKTP 188
             S           SGID A + HGG + +Q  + S+  +      FP + L+ +  KT 
Sbjct: 185 AWSFQGEKCLHGNPSGIDNAVATHGGAVMFQRKEGSMPSVRTSMRNFPSLRLLLTNTKTA 244

Query: 189 --TAQVLKKISYIEIEYPEINE--------INQKIYALMGKLSQISCQALRNKNLKVLAQ 238
             TA ++  +S +  E+ + +E        + ++ Y LM K        L  +  + L +
Sbjct: 245 RRTATLVANVSTLVTEFAKTSEFILNAIDSLTREAYILMTK------PVLDAEARRRLRE 298

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA---SKISGSGLGDCVIALGK 289
            +    GLL +LGVS   L     K+R    ++A   +K++G+G G C I L K
Sbjct: 299 LIRINHGLLISLGVSHPSLE----KIRMTADLLALGETKLTGAGGGGCAITLLK 348


>gi|150863997|ref|XP_001382664.2| mevalonate kinase [Scheffersomyces stipitis CBS 6054]
 gi|149385253|gb|ABN64635.2| mevalonate kinase [Scheffersomyces stipitis CBS 6054]
          Length = 432

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 143/353 (40%), Gaps = 70/353 (19%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD--------------------- 48
           VSAPG +++ GEH  ++G  A+  A++ R  L +T  +D                     
Sbjct: 7   VSAPGKVIIFGEHSAVYGKPAIAAALSLRAYLLVTPSQDPDTINLSFPDINLTHSWNKND 66

Query: 49  -------RLIN---------------IDSSLGQYCGSLDLAMFHPSFSFIIMAINHI--K 84
                  + IN               I   LG     L+ ++ + +    +    H+  +
Sbjct: 67  IPWDSIVKHINLVDNLPQTSEELVPEIVDQLGSVLADLNSSLHYTACLCFLYLYTHLCNQ 126

Query: 85  PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH--------------KEPSPDE 130
              G    + S L    GLGSSA+  V + +AL  L                 KE +  +
Sbjct: 127 ELAGMSFCIRSTLPIGAGLGSSASTAVCLASALAILGNRVTSASFLQTDKILKKENNDLD 186

Query: 131 ILTTAHAIVLK-VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIFP-IHLIYSG 184
            + +   +  K   G  SGID A + HGG + +Q      + S+      FP I L+ + 
Sbjct: 187 FIDSWSLMGEKCFHGNPSGIDNAVATHGGAVMFQRMNNPAQPSVRTSMRNFPAIKLLLTN 246

Query: 185 YKTP--TAQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRN-KNLKVLAQAM 240
            K P  TA ++  +  + +EYP+  N I + +  L     QI  +     +  K L + +
Sbjct: 247 TKVPRSTADLVGGVGKLNVEYPKTSNSILEAMEHLSNTAYQIMVRPFFGAEERKKLRELV 306

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
           N   GLL  LGVS   L E V  + +   + ++K++G+G G C I L   D++
Sbjct: 307 NINHGLLVALGVSHPSL-EKVKIITDTSKLGSTKLTGAGGGGCAITLVDEDVS 358


>gi|42519132|ref|NP_965062.1| mevalonate kinase [Lactobacillus johnsonii NCC 533]
 gi|41583419|gb|AAS09028.1| mevalonate kinase [Lactobacillus johnsonii NCC 533]
 gi|329667333|gb|AEB93281.1| Phosphomevalonate kinase [Lactobacillus johnsonii DPC 6026]
          Length = 357

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 151/359 (42%), Gaps = 94/359 (26%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 2   ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 61

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQL 97
           RK   + ID+                 F +I+ AIN  +  C         +DL V S L
Sbjct: 62  RKGNQMVIDNR-------------DNPFEYILSAINFTERFCLEQKVSMSLYDLHVNSDL 108

Query: 98  DS----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAA 153
           DS    + GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AA
Sbjct: 109 DSADGKKYGLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAA 167

Query: 154 SIHGGLICYQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP-- 188
           S++GG + YQ                       +   KI  + P   ++L+    + P  
Sbjct: 168 SVYGGWLAYQTFDKAWLKKELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPAS 227

Query: 189 TAQVLKKIS----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
           T+Q++ K +    +I+ +Y    + ++K    M        +    KN+ ++ + +   +
Sbjct: 228 TSQLVDKTNAKKKFIKTQYDTFLDESRKCVLDM-------IKGFNEKNISLIQKQIRLNR 280

Query: 245 GLLET------LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
            LL+       + +   +L++++  + EQ +  A+K SG+G GDC  VIA  K D+  +
Sbjct: 281 QLLKDFASLNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEKTDIEEM 337


>gi|293572990|ref|ZP_06683932.1| mevalonate kinase [Enterococcus faecium E980]
 gi|291606892|gb|EFF36272.1| mevalonate kinase [Enterococcus faecium E980]
          Length = 314

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 133/284 (46%), Gaps = 19/284 (6%)

Query: 14  GSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS 72
           G ++LMGEH V++G  A+ F     +V  +L    + L  +D  L     S +LA    +
Sbjct: 11  GKIILMGEHAVVYGEPAIAFPFYATKVTAFL----EELDAMDDQLVSSYYSGNLAEAPHT 66

Query: 73  FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              I     H+K          L + S + ++ G+GSSAA+  A+T A     Y   P  
Sbjct: 67  LKNIKKLFIHLKKEHDIHKNLQLTIESTIPAERGMGSSAAVATAVTRAFY--DYLTLPLS 124

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            EIL     +  K+  G  SGID AA+     I Y    +  +         LI   +G 
Sbjct: 125 REILLEKVQLSEKIAHGNPSGIDAAATSSLQPI-YFTKGHPFDYFSLNIDAFLIVADTGI 183

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           K  T + +K ++++    P  +E  Q I  L G L++ + QA+   + ++LAQ M+  Q 
Sbjct: 184 KGQTREAVKDVAHLFERQP--HETGQMIQKL-GYLTKQAKQAIIENSPEMLAQTMDESQS 240

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LLE L +S+  L  ++   ++    + +K++G G G C+IAL +
Sbjct: 241 LLEKLTISNDFLDLLIQTAKD-TGALGAKLTGGGRGGCMIALAQ 283


>gi|325688646|gb|EGD30663.1| mevalonate kinase [Streptococcus sanguinis SK72]
          Length = 292

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 127/283 (44%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H  +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHFGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVSAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|15240936|ref|NP_198097.1| MK (MEVALONATE KINASE); mevalonate kinase [Arabidopsis thaliana]
 gi|30690651|ref|NP_851084.1| MK (MEVALONATE KINASE); mevalonate kinase [Arabidopsis thaliana]
 gi|1170660|sp|P46086|KIME_ARATH RecName: Full=Mevalonate kinase; Short=MK
 gi|4883990|gb|AAD31719.1|AF141853_1 mevalonate kinase [Arabidopsis thaliana]
 gi|456614|emb|CAA54820.1| mevalonate kinase [Arabidopsis thaliana]
 gi|20260532|gb|AAM13164.1| mevalonate kinase [Arabidopsis thaliana]
 gi|21536584|gb|AAM60916.1| mevalonate kinase [Arabidopsis thaliana]
 gi|25083757|gb|AAN72115.1| mevalonate kinase [Arabidopsis thaliana]
 gi|332006305|gb|AED93688.1| mevalonate kinase [Arabidopsis thaliana]
 gi|332006306|gb|AED93689.1| mevalonate kinase [Arabidopsis thaliana]
 gi|332006307|gb|AED93690.1| mevalonate kinase [Arabidopsis thaliana]
          Length = 378

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/359 (23%), Positives = 143/359 (39%), Gaps = 105/359 (29%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR--------KDRLINIDSSLGQYCGS 63
           APG ++L GEH V+HG  A+  AI+  +  Y+TLR         DRL            +
Sbjct: 7   APGKIILAGEHAVVHGSTAVAAAID--LYTYVTLRFPLPSAENNDRL------------T 52

Query: 64  LDLAMFHPSFSFIIMAINHIKP------------SC------------------------ 87
           L L      FS+ +  I    P            SC                        
Sbjct: 53  LQLKDISLEFSWSLARIKEAIPYDSSTLCRSTPASCSEETLKSIAVLVEEQNLPKEKMWL 112

Query: 88  ---------------GFDLKVI---SQLDSQLGLGSSAAITVAITAALLTLQYHKEP--- 126
                          GF+   +   S+L    GLGSSAA+ VA+TAALL     ++    
Sbjct: 113 SSGISTFLWLYTRIIGFNPATVVINSELPYGSGLGSSAALCVALTAALLASSISEKTRGN 172

Query: 127 ---SPDEI-LTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
              S DE  L   +    +    + G  SGID   S +G +I  +     I ++    P+
Sbjct: 173 GWSSLDETNLELLNKWAFEGEKIIHGKPSGIDNTVSAYGNMI--KFCSGEITRLQSNMPL 230

Query: 179 HLIYSGYKT--PTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQAL 228
            ++ +  +    T  ++  +S   + +P+        ++ I++++ A++    + S    
Sbjct: 231 RMLITNTRVGRNTKALVSGVSQRAVRHPDAMKSVFNAVDSISKELAAIIQSKDETSVTEK 290

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             +    + + M   QGLL ++GVS S +  ++  L    H + SK++G+G G CV+ L
Sbjct: 291 EER----IKELMEMNQGLLLSMGVSHSSIEAVI--LTTVKHKLVSKLTGAGGGGCVLTL 343


>gi|227831355|ref|YP_002833135.1| GHMP kinase [Sulfolobus islandicus L.S.2.15]
 gi|229580266|ref|YP_002838666.1| GHMP kinase [Sulfolobus islandicus Y.G.57.14]
 gi|229581088|ref|YP_002839487.1| GHMP kinase [Sulfolobus islandicus Y.N.15.51]
 gi|284998886|ref|YP_003420654.1| GHMP kinase [Sulfolobus islandicus L.D.8.5]
 gi|227457803|gb|ACP36490.1| GHMP kinase [Sulfolobus islandicus L.S.2.15]
 gi|228010982|gb|ACP46744.1| GHMP kinase [Sulfolobus islandicus Y.G.57.14]
 gi|228011804|gb|ACP47565.1| GHMP kinase [Sulfolobus islandicus Y.N.15.51]
 gi|284446782|gb|ADB88284.1| GHMP kinase [Sulfolobus islandicus L.D.8.5]
 gi|323475699|gb|ADX86305.1| GHMP kinase [Sulfolobus islandicus REY15A]
          Length = 322

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 147/315 (46%), Gaps = 59/315 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD-- 65
           I +SAPG ++ +G + V+ G  + V A+NKRV   L   ++R +   +S G +  S +  
Sbjct: 2   IRISAPGKILWIGSYSVVFGGISHVIAVNKRVSCRLREIQERSLIFHTSYGDFKNSGNEL 61

Query: 66  ----LAMFHPSFSFIIMAINHIKPSCGFDLKVISQ----LD-SQLGLGSSAAITVAITAA 116
               L  F   F+ +        P  G+++++ +     LD  + GLGSS+A TV++TA 
Sbjct: 62  INSVLDTFRERFTQL--------PQ-GYEIELYNDKEFILDGKKTGLGSSSAATVSLTAC 112

Query: 117 LLTLQYHKEPSPD--EILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKID 173
           L    Y      D  EI   A     K Q GI SG D+A+++ G ++  +     +EK+D
Sbjct: 113 LY---YAINGKLDLFEIHKLAQIANFKRQKGIGSGFDIASAVFGSIVYKRFT--DLEKMD 167

Query: 174 FIFP--------IHLIYSGYKTPTAQVLKKI---SYIEIEYPE----INEINQKIYALMG 218
           F +         + L ++G  + T  ++KK    S +E ++ E    I+E N     L+ 
Sbjct: 168 FYYEKLKLGNYDMVLGFTGKSSETVGLVKKFVEKSNLE-DFREIMRLIDEENNMAIRLV- 225

Query: 219 KLSQISCQA----LRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQPHIMAS 273
           KL++I        L  K L  +A+ +         +GV   SK  E + K+ E    + +
Sbjct: 226 KLNKIDEAVEHVRLGRKYLNYIAERI---------VGVKLVSKEEEELIKIAEDEGALIA 276

Query: 274 KISGSGLGDCVIALG 288
              G+G GD + ALG
Sbjct: 277 LSPGAGGGDSIFALG 291


>gi|90961662|ref|YP_535578.1| mevalonate kinase [Lactobacillus salivarius UCC118]
 gi|90820856|gb|ABD99495.1| Mevalonate kinase [Lactobacillus salivarius UCC118]
          Length = 314

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 32/300 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ----- 59
            H    S+   ++L+GEH V++GH A+   + K V    +++      I SS  Q     
Sbjct: 4   FHDAKGSSHAKIILIGEHAVVYGHPAIALPL-KTVTATASIKV-----IPSSSEQIIKSS 57

Query: 60  -YCGSLDLAMFHPSF---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
            Y GS+D  M          I+  ++ ++   GF+L + SQL ++ G+GSSAA+ ++I  
Sbjct: 58  YYDGSVD-DMPKNMLGIKKLILKLVSDLRIENGFELHLSSQLPAERGMGSSAAVAISIIR 116

Query: 116 ----ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
               A  T   HK     ++L+ A           SG+D   S     I + +    I  
Sbjct: 117 CFYNATDTRINHK-----KLLSYADIAEKVTHNNPSGLDATTSASDNPI-WLIRNKEITP 170

Query: 172 IDFIFPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
           I      +L+   SG K  T++ + KI   ++   EI+  ++   A +G+L+Q +   L 
Sbjct: 171 IPINLDAYLLISDSGIKGQTSEAI-KIVKDQLNTDEISTSSK--LAALGRLAQTTRDQLA 227

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           N ++  L +     Q  L +LGVS  KL  ++  +  +   + SK++G G G C I+L K
Sbjct: 228 NNDIVGLGKTFTLAQKDLISLGVSTPKLDNLI-TIALKNGSLGSKLTGGGRGGCFISLLK 286


>gi|260101294|ref|ZP_05751531.1| mevalonate kinase [Lactobacillus helveticus DSM 20075]
 gi|111610213|gb|ABH11598.1| GMP synthase, mevalonate kinase [Lactobacillus helveticus CNRZ32]
 gi|260084879|gb|EEW68999.1| mevalonate kinase [Lactobacillus helveticus DSM 20075]
          Length = 302

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 140/287 (48%), Gaps = 18/287 (6%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           K    A G ++++GEH V++G+ AL   I K + +  T+  +  + +D++  +Y GS  D
Sbjct: 2   KTSFLAHGKVIIIGEHSVVYGYDALAMPI-KALHIKTTVENNPEMWMDTA--RYHGSFFD 58

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKV--ISQLDSQLGLGSSAAITVAITAALLTLQYH 123
               +    +++  +   K +    LK+    ++  + G GSSAA+ +  T AL    + 
Sbjct: 59  TPSEYDGLKYVVKTMQK-KANNNEPLKITYTGEIPMERGFGSSAAVALGTTKALNQF-FS 116

Query: 124 KEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIFPIHL 180
              S  EI+  T HA ++   G +SG+D AA+++   + +   K    + +      + +
Sbjct: 117 LNMSESEIMAVTNHAEMIN-HGKASGLD-AATVNSDYLVFFNKKMGPKVLQAKLGATLFI 174

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           + +G    T + + ++S + +   E  + N K    +G+L+ ++ +A  N ++K +    
Sbjct: 175 MDTGELGNTKKAVAQVSQL-LSESEQAKTNMK---RLGELADLTKKAWINHDVKTVGNIF 230

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           N  Q +L +  +S +K+ ++  K+      +  K+SG GLG   IAL
Sbjct: 231 NEAQKILHSFNISTTKIDQLQ-KIALDNGALGFKLSGGGLGGITIAL 276


>gi|324994265|gb|EGC26179.1| mevalonate kinase [Streptococcus sanguinis SK678]
 gi|325697894|gb|EGD39778.1| mevalonate kinase [Streptococcus sanguinis SK160]
          Length = 292

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKICCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVSAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|124027753|ref|YP_001013073.1| mevalonate kinase [Hyperthermus butylicus DSM 5456]
 gi|123978447|gb|ABM80728.1| Mevalonate kinase [Hyperthermus butylicus DSM 5456]
          Length = 316

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 129/291 (44%), Gaps = 28/291 (9%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI----------NIDSSLGQY 60
           SAP  +++ GEH V+HG  AL  AI  R   Y +  +  L           N+  S  ++
Sbjct: 6   SAPAKVIVFGEHWVVHGGLALAAAIGLRARAYGSPSESGLWVFSQLYRIGENLMESCSRF 65

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           C  L          F ++A ++ +      +++ S +    GLGSSAA  +A  AA   +
Sbjct: 66  CNLLA--------GFRLVASSYGRSLWPARIRIESDIPVGAGLGSSAATALAAVAAYACV 117

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI----F 176
               EP  D +   A      V G  SG+D   +++GG I Y+      ++++F      
Sbjct: 118 G-GLEPGYDVLWRAAFEAEKVVHGNPSGVDNTVALYGGFILYRRGS-GFKRVEFRGMRDT 175

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
            + ++ SG    T   +++ +   +    +  + +++      + + +  AL   +   L
Sbjct: 176 RLLIVDSGVSRSTRIAVERFT---VRLERLGRLGRRLLETADGIVEEALAALSRGDSVRL 232

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            + M+   GLL  +GVS   L EIVW  R +   + +K++G+G+G   I L
Sbjct: 233 GELMDVAHGLLNAMGVSHPVLEEIVWIARRE-GALGAKLTGAGMGGTAIVL 282


>gi|69246577|ref|ZP_00604007.1| Mevalonate kinase [Enterococcus faecium DO]
 gi|257878885|ref|ZP_05658538.1| mevalonate kinase [Enterococcus faecium 1,230,933]
 gi|257881521|ref|ZP_05661174.1| mevalonate kinase [Enterococcus faecium 1,231,502]
 gi|257885793|ref|ZP_05665446.1| mevalonate kinase [Enterococcus faecium 1,231,501]
 gi|258615043|ref|ZP_05712813.1| mevalonate kinase [Enterococcus faecium DO]
 gi|260558444|ref|ZP_05830640.1| mevalonate kinase [Enterococcus faecium C68]
 gi|293556925|ref|ZP_06675486.1| mevalonate kinase [Enterococcus faecium E1039]
 gi|293560306|ref|ZP_06676803.1| mevalonate kinase [Enterococcus faecium E1162]
 gi|293567761|ref|ZP_06679102.1| mevalonate kinase [Enterococcus faecium E1071]
 gi|294617090|ref|ZP_06696757.1| mevalonate kinase [Enterococcus faecium E1679]
 gi|294620919|ref|ZP_06700120.1| mevalonate kinase [Enterococcus faecium U0317]
 gi|314938977|ref|ZP_07846242.1| mevalonate kinase [Enterococcus faecium TX0133a04]
 gi|314943472|ref|ZP_07850239.1| mevalonate kinase [Enterococcus faecium TX0133C]
 gi|314948235|ref|ZP_07851629.1| mevalonate kinase [Enterococcus faecium TX0082]
 gi|314951595|ref|ZP_07854641.1| mevalonate kinase [Enterococcus faecium TX0133A]
 gi|314991542|ref|ZP_07857018.1| mevalonate kinase [Enterococcus faecium TX0133B]
 gi|314994875|ref|ZP_07860002.1| mevalonate kinase [Enterococcus faecium TX0133a01]
 gi|9937393|gb|AAG02445.1|AF290095_1 mevalonate kinase [Enterococcus faecium]
 gi|68195185|gb|EAN09641.1| Mevalonate kinase [Enterococcus faecium DO]
 gi|257813113|gb|EEV41871.1| mevalonate kinase [Enterococcus faecium 1,230,933]
 gi|257817179|gb|EEV44507.1| mevalonate kinase [Enterococcus faecium 1,231,502]
 gi|257821649|gb|EEV48779.1| mevalonate kinase [Enterococcus faecium 1,231,501]
 gi|260075618|gb|EEW63924.1| mevalonate kinase [Enterococcus faecium C68]
 gi|291589346|gb|EFF21153.1| mevalonate kinase [Enterococcus faecium E1071]
 gi|291596648|gb|EFF27874.1| mevalonate kinase [Enterococcus faecium E1679]
 gi|291599530|gb|EFF30546.1| mevalonate kinase [Enterococcus faecium U0317]
 gi|291601009|gb|EFF31300.1| mevalonate kinase [Enterococcus faecium E1039]
 gi|291605756|gb|EFF35193.1| mevalonate kinase [Enterococcus faecium E1162]
 gi|313590857|gb|EFR69702.1| mevalonate kinase [Enterococcus faecium TX0133a01]
 gi|313593826|gb|EFR72671.1| mevalonate kinase [Enterococcus faecium TX0133B]
 gi|313596289|gb|EFR75134.1| mevalonate kinase [Enterococcus faecium TX0133A]
 gi|313597844|gb|EFR76689.1| mevalonate kinase [Enterococcus faecium TX0133C]
 gi|313641686|gb|EFS06266.1| mevalonate kinase [Enterococcus faecium TX0133a04]
 gi|313645368|gb|EFS09948.1| mevalonate kinase [Enterococcus faecium TX0082]
          Length = 314

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 135/285 (47%), Gaps = 21/285 (7%)

Query: 14  GSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS 72
           G ++LMGEH V++G  A+ F     +V  +L    + L  +D  L     S +LA    +
Sbjct: 11  GKIILMGEHAVVYGEPAIAFPFYATKVTAFL----EELDAMDDQLVSSYYSGNLAEAPHA 66

Query: 73  FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              I     H+K          L + S + ++ G+GSSAA+  A+T A     Y   P  
Sbjct: 67  LKNIKKLFIHLKKQHDIQKNLQLTIESTIPAERGMGSSAAVATAVTRAFY--DYLAFPLS 124

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            EIL     +  K+  G  SGID AA+     I Y    +  +         LI   +G 
Sbjct: 125 REILLENVQLSEKIAHGNPSGIDAAATSSLQPI-YFTKGHPFDYFSLNIDAFLIVADTGI 183

Query: 186 KTPTAQVLKKISYI-EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
           K  T + +K ++++ E +  E  ++ QK    +G L++ + QA+   + + LAQ M+  Q
Sbjct: 184 KGQTREAVKDVAHLFETQPHETGQMIQK----LGYLTKQAKQAIIENSPETLAQTMDESQ 239

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            LLE L +S+  L+ ++   ++    + +K++G G G C+IAL +
Sbjct: 240 SLLEKLTISNDFLNLLIQTAKD-TGALGAKLTGGGRGGCMIALAQ 283


>gi|227878669|ref|ZP_03996584.1| phosphomevalonate kinase [Lactobacillus crispatus JV-V01]
 gi|256843265|ref|ZP_05548753.1| phosphomevalonate kinase [Lactobacillus crispatus 125-2-CHN]
 gi|256850378|ref|ZP_05555806.1| phosphomevalonate kinase [Lactobacillus crispatus MV-1A-US]
 gi|262046474|ref|ZP_06019436.1| phosphomevalonate kinase [Lactobacillus crispatus MV-3A-US]
 gi|293380929|ref|ZP_06626963.1| phosphomevalonate kinase [Lactobacillus crispatus 214-1]
 gi|295693039|ref|YP_003601649.1| phosphomevalonate kinase [Lactobacillus crispatus ST1]
 gi|312978156|ref|ZP_07789900.1| phosphomevalonate kinase [Lactobacillus crispatus CTV-05]
 gi|227861733|gb|EEJ69337.1| phosphomevalonate kinase [Lactobacillus crispatus JV-V01]
 gi|256614685|gb|EEU19886.1| phosphomevalonate kinase [Lactobacillus crispatus 125-2-CHN]
 gi|256712775|gb|EEU27768.1| phosphomevalonate kinase [Lactobacillus crispatus MV-1A-US]
 gi|260573345|gb|EEX29903.1| phosphomevalonate kinase [Lactobacillus crispatus MV-3A-US]
 gi|290922504|gb|EFD99472.1| phosphomevalonate kinase [Lactobacillus crispatus 214-1]
 gi|295031145|emb|CBL50624.1| Phosphomevalonate kinase [Lactobacillus crispatus ST1]
 gi|310894874|gb|EFQ43944.1| phosphomevalonate kinase [Lactobacillus crispatus CTV-05]
          Length = 360

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 90/340 (26%), Positives = 149/340 (43%), Gaps = 56/340 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVAVNQFVRVSITKSKGATGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RQGSKMVIDNRDNPFEYILSAISFTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-- 163
           AA+TVA   A+L  +++     +E++    AI    VQG  S  D+AAS++GG + YQ  
Sbjct: 122 AAVTVATVKAIL--RFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTF 179

Query: 164 ---MPKYSIEKIDFIFPIHLIYSGYK----TPTAQVLKKISYIEIEYPE---INEINQKI 213
                K  +     +  ++  + G K    TP   +   I + +        ++E N   
Sbjct: 180 DKKWLKQELANKTLVQVVNEAWPGLKVELLTPPKDMKLMIGWSQKPASTSRLVDETNANK 239

Query: 214 YALMGKLSQI-----SC-----QALRNKNLKVLAQAMNRQQGLLE------TLGVSDSKL 257
            AL  +         +C     Q     N+ ++ Q +   + LL+       + +   +L
Sbjct: 240 AALNMEYKNFLAASRACVLKMVQGFEANNIALIKQQIRANRKLLQHFAKINQIAIEIPRL 299

Query: 258 SEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
           S+++ K+ E     A+K SG+G GDC  VI     D+ +L
Sbjct: 300 SQLI-KIAEN-FGGAAKTSGAGNGDCGIVITDANTDVEAL 337


>gi|190347630|gb|EDK39940.2| hypothetical protein PGUG_04038 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 423

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 127/291 (43%), Gaps = 40/291 (13%)

Query: 57  LGQYCGSLD-LAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAIT 114
           +G++ G ++  A +     F+ + ++   PS       + S L    GLGSSA+  V +T
Sbjct: 95  IGEFLGDIESTAHYTTCLCFLYLYLHLCDPSVASRSFCIRSTLPIGAGLGSSASAAVCLT 154

Query: 115 AALLTLQYH-KEP-----------SPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLI 160
           + L  L  H + P           +PD     + +++ +    G  SGID A + HGG +
Sbjct: 155 STLALLGGHIRSPQYSEKQRVSSENPDAEFIDSWSLMGEKCFHGNPSGIDNAVATHGGAV 214

Query: 161 CYQ------MPKYSIEKIDFIFPIHLIYSGYKTP--TAQVLKKISYIEIEYPE------- 205
            YQ      MP       +F  P+ L+ +  K P  TA+++  ++ +   +P+       
Sbjct: 215 MYQRMSAPDMPSVRTAMRNFP-PLKLLLTNTKVPRSTAELVGGVAKVNTRHPKTAGSILD 273

Query: 206 -INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKL 264
            ++ +    Y +M      S  +   ++ + L Q +N   GLL  LGVS   L +I   +
Sbjct: 274 AVSHLATDAYHIM------SHPSFAAEDRESLRQLVNINHGLLVALGVSHPALEKIK-MI 326

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
            +   I A+K++G+G G C I L   +++    + V      +G +    T
Sbjct: 327 GDTNRIGATKLTGAGGGGCAITLLNDEVSHEVLEKVENEFTQEGFETFEAT 377


>gi|125717207|ref|YP_001034340.1| mevalonate kinase [Streptococcus sanguinis SK36]
 gi|125497124|gb|ABN43790.1| Mevalonate kinase, putative [Streptococcus sanguinis SK36]
          Length = 292

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGQQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAIFIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|126324791|ref|XP_001364115.1| PREDICTED: similar to mevalonate kinase [Monodelphis domestica]
          Length = 396

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 134/321 (41%), Gaps = 76/321 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD---RLI--NIDSSLGQYCG 62
           + VSAPG ++L GEH V+HG  AL  A+N R  L +   KD   RL+  N+++S      
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAEALNLRTFLRMRPHKDGKVRLVLPNLETSREWDVS 65

Query: 63  SLDLAMFHPSF-------SFIIMAINHIKPSCGF-------------------------- 89
            L L   H SF       +     +  +K   GF                          
Sbjct: 66  KLQL--LHASFLDSGEPTAPTTEQVEKLKAFAGFMTGSSERECLAVLAFLYLYLFICRKH 123

Query: 90  ------DLKVISQLDSQLGLGSSAAITVAITAALLT-----LQYHKEPS------PDEI- 131
                 D+ V S+L +  GLGSSAA +V + AALL      +   KE +       DE+ 
Sbjct: 124 RPLPSMDIVVWSELPTGAGLGSSAAYSVCLAAALLASCEEIMNRLKEGATSARWNEDELN 183

Query: 132 LTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP- 188
           L    A + +  + G  SG+D + S  GG + +Q  K +I  +  I  + ++ +  K P 
Sbjct: 184 LINRWAFLGEKVIHGNPSGVDNSVSTWGGALRFQ--KGNISSLQRIPVLKILLTNTKVPR 241

Query: 189 -TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
            T  ++  +     ++PE        I+ I+Q+   ++G ++         +   VL + 
Sbjct: 242 STKALVASVKDRLAKFPEIMNPLLVSIDAISQECERVLGVMAATPTP----EQYMVLEEL 297

Query: 240 MNRQQGLLETLGVSDSKLSEI 260
           ++  Q  L  +GV  S L  +
Sbjct: 298 IDMNQHHLNAIGVGHSSLDRL 318


>gi|261207166|ref|ZP_05921855.1| mevalonate kinase [Enterococcus faecium TC 6]
 gi|289565287|ref|ZP_06445738.1| mevalonate kinase [Enterococcus faecium D344SRF]
 gi|294615072|ref|ZP_06694958.1| mevalonate kinase [Enterococcus faecium E1636]
 gi|260078794|gb|EEW66496.1| mevalonate kinase [Enterococcus faecium TC 6]
 gi|289162943|gb|EFD10792.1| mevalonate kinase [Enterococcus faecium D344SRF]
 gi|291592014|gb|EFF23637.1| mevalonate kinase [Enterococcus faecium E1636]
          Length = 314

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 135/285 (47%), Gaps = 21/285 (7%)

Query: 14  GSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS 72
           G ++LMGEH V++G  A+ F     +V  +L    + L  +D  L     S +LA    +
Sbjct: 11  GKIILMGEHAVVYGEPAIAFPFYATKVTAFL----EELDAMDDQLVSSYYSGNLAEAPHA 66

Query: 73  FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              I     H+K          L + S + ++ G+GSSAA+  A+T A     Y   P  
Sbjct: 67  LKNIKKLFIHLKKQHDIQKNLQLTIESTIPAERGMGSSAAVATAVTRAFY--DYLAFPLS 124

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            EIL     +  K+  G  SGID AA+     I Y    +  +         LI   +G 
Sbjct: 125 REILLENVQLSEKIAHGNPSGIDAAATSSLQPI-YFTKGHPFDYFSLNIDAFLIVADTGI 183

Query: 186 KTPTAQVLKKISYI-EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
           K  T + +K ++++ E +  E  ++ QK    +G L++ + QA+   + + LAQ M+  Q
Sbjct: 184 KGQTREAVKDVAHLFETQPHETGQMIQK----LGYLTKQAKQAIIENSPETLAQTMDESQ 239

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            LLE L +S+  L+ ++   ++    + +K++G G G C+IAL +
Sbjct: 240 SLLEKLTISNDFLNLLIQTAKD-TGALGAKLTGGGRGGCMIALAQ 283


>gi|227890750|ref|ZP_04008555.1| mevalonate kinase [Lactobacillus salivarius ATCC 11741]
 gi|227867688|gb|EEJ75109.1| mevalonate kinase [Lactobacillus salivarius ATCC 11741]
          Length = 335

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 138/300 (46%), Gaps = 32/300 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ----- 59
            H    S+   ++L+GEH V++GH A+   + K V    +++      I SS  Q     
Sbjct: 25  FHDAKGSSHAKIILIGEHAVVYGHPAIALPL-KTVTATASIKV-----IPSSSEQTITSS 78

Query: 60  -YCGSLDLAMFHPSF---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
            Y GS+D  M          I+  ++ ++   GF+L + SQL ++ G+GSSAA+ ++I  
Sbjct: 79  YYDGSVD-DMPKNMLGIKKLILKLVSDLRIENGFELHLSSQLPAERGMGSSAAVAISIIR 137

Query: 116 ----ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
               A  T   HK     ++L+ A           SG+D   S     I + +    I  
Sbjct: 138 CFYNATDTRINHK-----KLLSYADIAEKVTHNNPSGLDATTSASDNPI-WLIRNKEITP 191

Query: 172 IDFIFPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
           I      +L+   SG K  T++ + KI   ++   EI+  ++   A +G+L+Q +   L 
Sbjct: 192 IPINLDAYLLISDSGIKGQTSEAI-KIVKDQLNTDEISTSSK--LAALGRLAQTTRDQLA 248

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           N ++  L +     Q  L +LGVS  KL  ++  +  +   + SK++G G G C I+L K
Sbjct: 249 NNDIVGLGKTFTLAQKDLISLGVSTPKLDNLI-TIALKNGSLGSKLTGGGRGGCFISLLK 307


>gi|306833700|ref|ZP_07466827.1| mevalonate kinase [Streptococcus bovis ATCC 700338]
 gi|304424470|gb|EFM27609.1| mevalonate kinase [Streptococcus bovis ATCC 700338]
          Length = 292

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 132/286 (46%), Gaps = 40/286 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       +  I+ D              F+ 
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIKVECHIYPAEEKIHFD--------------FYD 55

Query: 72  SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + S  + A    +NH   S  + ++  S++  + G+GSSAA+++A   A+     + E S
Sbjct: 56  TLSTAVYAALEYLNHTDVSITYAIR--SEIPQKRGMGSSAAVSIAAIRAVFD---YFEQS 110

Query: 128 PDEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            D  + T   +V K + I+    SG+D    +    I + +       +D     +L+  
Sbjct: 111 ID--MNTLEILVNKAEIIAHSNPSGLDAKTCLSDKAITF-IRNIGFSTLDLDLDAYLVIA 167

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + ++K++  E       E N    A +G L++I  +A+++K+++ +   M 
Sbjct: 168 DTGIYGNTREAVEKVAQAE-------EANLPHLAALGDLTEIVQKAIQDKDIQKIGHMMT 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +    L+ +GVS   +S+ + KL      + +K+SG GLG C+IAL
Sbjct: 221 KAHAHLQAIGVS-IDVSDQLVKLSLGNGALGAKMSGGGLGGCIIAL 265


>gi|161507626|ref|YP_001577580.1| mevalonate kinase [Lactobacillus helveticus DPC 4571]
 gi|15212070|emb|CAC51370.1| mevalonate kinase [Lactobacillus helveticus]
 gi|160348615|gb|ABX27289.1| Mevalonate kinase [Lactobacillus helveticus DPC 4571]
          Length = 302

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 140/287 (48%), Gaps = 18/287 (6%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           K    A G ++++GEH V++G+ AL   I K + +  T+  +  + +D++  +Y GS  D
Sbjct: 2   KTSFLAHGKVIIIGEHSVVYGYDALAMPI-KALHIKTTVENNPEMWMDTA--RYHGSFFD 58

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKV--ISQLDSQLGLGSSAAITVAITAALLTLQYH 123
               +    +++  +   K +    LK+    ++  + G GSSAA+ +  T AL    + 
Sbjct: 59  TPSEYDGLKYVVKTMQK-KANNNEPLKITYTGEIPMERGFGSSAAVALGTTKALNQF-FS 116

Query: 124 KEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIFPIHL 180
              S  EI+  T HA ++   G +SG+D AA+++   + +   K    + +      + +
Sbjct: 117 LNMSESEIMAVTNHAEMIN-HGKASGLD-AATVNSDYLVFFNKKMGPKVLQAKLGATLFI 174

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           + +G    T + + ++S + +   E  + N K    +G+L+ ++ +A  N ++K +    
Sbjct: 175 MDTGELGNTKKAVAQVSQL-LSESEQAKANMK---RLGELADLTKKAWINHDVKTVGNIF 230

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           N  Q +L +  +S +K+ ++  K+      +  K+SG GLG   IAL
Sbjct: 231 NEAQKILHSFNISTTKIDQLQ-KIALDNGALGFKLSGGGLGGITIAL 276


>gi|58337454|ref|YP_194039.1| phosphomevalonate kinase [Lactobacillus acidophilus NCFM]
 gi|58254771|gb|AAV43008.1| phosphomevalonate kinase [Lactobacillus acidophilus NCFM]
          Length = 360

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T       L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAVLVAVNQFVRVSITKSNTSTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RQGSKMVIDNRDNPFEYILSAISFTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   ++  P  +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAIL--HFYGVPLNNELIYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|315149661|gb|EFT93677.1| phosphomevalonate kinase [Enterococcus faecalis TX0012]
          Length = 368

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 151/362 (41%), Gaps = 68/362 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD-------RLINIDSSLGQ 59
           I V+ PG L + GE+ V+  GH A++ A+++ V + +    D       +  ++     +
Sbjct: 2   IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETTDEGSIQSAQYSSLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLGSSA 107
             G L L +    F +++ AI           K    + LKV S+LDS    + GLGSS 
Sbjct: 62  RNGELVLDIRENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--- 164
           A+TV    AL  + Y      +EI   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVGTVKAL-NIFYDLGLENEEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFSTFDH 180

Query: 165 ----PKYSIEKID----------FIFPIHLI--------YSGYKTPTAQVLKKISYIEIE 202
                K + E +            IFP+ +         ++G    T+ ++ ++   + E
Sbjct: 181 DWVNEKVATETLTDLLAMDWPELMIFPLKVPKQLRLLIGWTGSPASTSDLVDRVHQSKEE 240

Query: 203 YPEINE---------INQKIYAL-MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
                E         +   I     GK+S I  Q  +N+ L  LA+  +    ++ET  +
Sbjct: 241 KQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQL--LAELSSLTGVVIETEAL 298

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIV 312
            +  L ++      + +  A+K SG+G GDC I + +     LP  +        GI  +
Sbjct: 299 KN--LCDLA-----ESYTGAAKSSGAGGGDCGIVIFRQKSGILPLMTA---WEKDGITPL 348

Query: 313 PI 314
           P+
Sbjct: 349 PL 350


>gi|254584070|ref|XP_002497603.1| ZYRO0F09328p [Zygosaccharomyces rouxii]
 gi|238940496|emb|CAR28670.1| ZYRO0F09328p [Zygosaccharomyces rouxii]
          Length = 418

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 141/340 (41%), Gaps = 69/340 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKD-RLINID------------- 54
           VSAPG +++ GEH  ++   A+  +++  R  L++   +D   I +D             
Sbjct: 7   VSAPGKVIIFGEHSAVYNEPAVAASVSALRTYLFVEPSEDPEEIELDFPDINFNHKWHYN 66

Query: 55  --SSLGQYCGSLDLAM--------------------------FHPSFSFIIMAI---NHI 83
             +S+ Q    L+ A                           ++ +  F  + +    HI
Sbjct: 67  DFASILQDAEGLEEARLNTRELSQKIVSQLEVVQGELRNTLYYYAALCFCYLYVCLCPHI 126

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLK-- 141
           K   G    V S L    GLGSSA+I+VA++ A+  L  H      E+  +    +    
Sbjct: 127 K---GMKFHVKSTLPIGAGLGSSASISVALSLAMAHLSGHIRADKPELSVSEKKFINTWS 183

Query: 142 ------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI-----FPIHLIYSGYKTPTA 190
                 +QG  SGID A + +G  + ++         +F+      P+ L Y+     T 
Sbjct: 184 FLGEKCIQGTPSGIDNAVATYGNAVLFKREMDGTTNFEFVEQFPQIPMVLTYTKIPRSTK 243

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ---ALRNKNLKVLAQAMNRQQGLL 247
            ++  +  + I  P    + + +   MG+L+    +   +L +KN + L + +    GLL
Sbjct: 244 TLVGNVRELVIRQP---NVIKPVLTAMGQLALRGTEILDSLDDKNYEELLELVRVNHGLL 300

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             LGVS   L E+V    +   + A+K++G+G G C++ +
Sbjct: 301 VALGVSHPGL-ELVRFECDTNALGATKLTGAGGGGCLLTI 339


>gi|256957241|ref|ZP_05561412.1| phosphomevalonate kinase [Enterococcus faecalis DS5]
 gi|257077785|ref|ZP_05572146.1| phosphomevalonate kinase [Enterococcus faecalis JH1]
 gi|294781312|ref|ZP_06746658.1| phosphomevalonate kinase [Enterococcus faecalis PC1.1]
 gi|307267977|ref|ZP_07549365.1| phosphomevalonate kinase [Enterococcus faecalis TX4248]
 gi|307275319|ref|ZP_07556462.1| phosphomevalonate kinase [Enterococcus faecalis TX2134]
 gi|9937388|gb|AAG02442.1|AF290093_3 phosphomevalonate kinase [Enterococcus faecalis]
 gi|256947737|gb|EEU64369.1| phosphomevalonate kinase [Enterococcus faecalis DS5]
 gi|256985815|gb|EEU73117.1| phosphomevalonate kinase [Enterococcus faecalis JH1]
 gi|294451648|gb|EFG20104.1| phosphomevalonate kinase [Enterococcus faecalis PC1.1]
 gi|306507953|gb|EFM77080.1| phosphomevalonate kinase [Enterococcus faecalis TX2134]
 gi|306515618|gb|EFM84145.1| phosphomevalonate kinase [Enterococcus faecalis TX4248]
 gi|315032469|gb|EFT44401.1| phosphomevalonate kinase [Enterococcus faecalis TX0017]
 gi|315034297|gb|EFT46229.1| phosphomevalonate kinase [Enterococcus faecalis TX0027]
          Length = 368

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 151/362 (41%), Gaps = 68/362 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD-------RLINIDSSLGQ 59
           I V+ PG L + GE+ V+  GH A++ A+++ V + +    D       +  ++     +
Sbjct: 2   IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETTDEGSIQSAQYSSLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLGSSA 107
             G L L +    F +++ AI           K    + LKV S+LDS    + GLGSS 
Sbjct: 62  RNGELVLDIRENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--- 164
           A+TV    AL  + Y      +EI   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVGTVKAL-NIFYDLGLENEEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFSTFDH 180

Query: 165 ----PKYSIEKID----------FIFPIHLI--------YSGYKTPTAQVLKKISYIEIE 202
                K + E +            IFP+ +         ++G    T+ ++ ++   + E
Sbjct: 181 DWVNQKVTTETLTDLLAMDWPELMIFPLKVPKQLRLLIGWTGSPASTSDLVDRVHQSKEE 240

Query: 203 YPEINE---------INQKIYAL-MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
                E         +   I     GK+S I  Q  +N+ L  LA+  +    ++ET  +
Sbjct: 241 KQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQL--LAELSSLTGVVIETEAL 298

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIV 312
            +  L ++      + +  A+K SG+G GDC I + +     LP  +        GI  +
Sbjct: 299 KN--LCDLA-----ESYTGAAKSSGAGGGDCGIVIFRQKSGILPLMTA---WEKDGITPL 348

Query: 313 PI 314
           P+
Sbjct: 349 PL 350


>gi|300214465|gb|ADJ78881.1| Phosphomevalonate kinase [Lactobacillus salivarius CECT 5713]
          Length = 355

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 86/175 (49%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLGQY 60
           I V APG L + GE+ V+  G  A++ A+++ V + L    D      +    +S   + 
Sbjct: 2   ISVKAPGKLYIAGEYAVVETGQPAILVALDQFVYVNLEKSNDLGSIISKQYKENSLYWKR 61

Query: 61  CGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDS----QLGLGSSA 107
            G+ +        F +I+ AIN ++    S G     + LK+ S+LDS    + GLGSSA
Sbjct: 62  EGNQIIFDNRDNPFHYILSAINLVEEYAQSLGKKMEFYHLKIDSELDSPDGKKYGLGSSA 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   AL    Y    S + +   A    L VQG  S  D+AAS++GG I Y
Sbjct: 122 AVTVATIKALSEF-YELNLSKEHLFKLASIAHLNVQGNGSLGDIAASVYGGWIAY 175


>gi|227904090|ref|ZP_04021895.1| phosphomevalonate kinase [Lactobacillus acidophilus ATCC 4796]
 gi|227868109|gb|EEJ75530.1| phosphomevalonate kinase [Lactobacillus acidophilus ATCC 4796]
          Length = 363

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T       L   +  + DS    
Sbjct: 5   ITEKAPGKLYIAGEYAVLEQDCPAVLVAVNQFVRVSITKSNTSTGLIHSKQYSQDSIHWV 64

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 65  RQGSKMVIDNRDNPFEYILSAISFTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 124

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   ++  P  +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 125 AAVTVATVKAIL--HFYGVPLNNELIYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 180


>gi|189193937|ref|XP_001933307.1| mevalonate kinase [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187978871|gb|EDU45497.1| mevalonate kinase [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 499

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 115/261 (44%), Gaps = 37/261 (14%)

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY------HK 124
           SF ++ M++   K P C + L+  S +    GLGSSA+I+V I+ ALL LQ       H+
Sbjct: 128 SFLYLFMSLASRKVPPCVYTLR--STIPIGAGLGSSASISVCISTALL-LQIRALSGPHQ 184

Query: 125 EPSPDE-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           +  P E       I   A    + + G  SG+D   S  G  + +Q   Y  +K   + P
Sbjct: 185 DQPPQECELNIERINRWAFVGEMCIHGNPSGVDNTVSSGGKAVLFQRRDY--DKPPLVVP 242

Query: 178 IH--------LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK-----LSQIS 224
           +H        L+ +     TA  + K++++   +P + E       L+ +     L+   
Sbjct: 243 LHSFPELPLLLVNTRQSRSTATEVAKVAHLRNVHPALTENILNAIGLVTESAHKLLTSPD 302

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
             A     LK L + +    GLL +LGVS  KL  I  ++ +   I  +K++G+G G C 
Sbjct: 303 FDATSPAALKHLGELVTINHGLLVSLGVSHPKLERIR-EIIDHTGIGWTKLTGAGGGGCA 361

Query: 285 IALGKGDLNSLPYQSVNCHMH 305
           I +    L   P    N H H
Sbjct: 362 ITI----LKPQPPALTNGHSH 378


>gi|315273196|ref|ZP_07869227.1| phosphomevalonate kinase [Listeria marthii FSL S4-120]
 gi|313616178|gb|EFR89272.1| phosphomevalonate kinase [Listeria marthii FSL S4-120]
          Length = 360

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 125/289 (43%), Gaps = 43/289 (14%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPVGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--- 163
           AA TVA+  AL+T ++H E S  +    A    L VQG  S  D+A+ ++GG I Y    
Sbjct: 123 AAATVAVINALMT-KFHPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAYTTFD 181

Query: 164 --------------------MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY 203
                                P   IE ++   P+     G+        K +S I    
Sbjct: 182 QEWVKHRLAYKSLEWFMKEPWPMLQIETLE--EPVSTFSVGWTGTPVSTGKLVSQIHAFK 239

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
            E ++  Q       ++ +   QA   KN ++L  ++   + +L+ LG 
Sbjct: 240 QEDSKNYQHFLTRNNEIMKQMIQAFHTKNEELLYASIKENRRILQALGT 288


>gi|90961660|ref|YP_535576.1| phosphomevalonate kinase [Lactobacillus salivarius UCC118]
 gi|227890748|ref|ZP_04008553.1| phosphomevalonate kinase [Lactobacillus salivarius ATCC 11741]
 gi|301300778|ref|ZP_07206962.1| phosphomevalonate kinase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|90820854|gb|ABD99493.1| Phosphomevalonate kinase [Lactobacillus salivarius UCC118]
 gi|227867686|gb|EEJ75107.1| phosphomevalonate kinase [Lactobacillus salivarius ATCC 11741]
 gi|300851628|gb|EFK79328.1| phosphomevalonate kinase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 355

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 86/175 (49%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD------RLINIDSSLGQY 60
           I V APG L + GE+ V+  G  A++ A+++ V + L    D      +    +S   + 
Sbjct: 2   ISVKAPGKLYIAGEYAVVETGQPAILVALDQFVYVNLEKSNDLGSIISKQYKENSLYWKR 61

Query: 61  CGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDS----QLGLGSSA 107
            G+ +        F +I+ AIN ++    S G     + LK+ S+LDS    + GLGSSA
Sbjct: 62  EGNQIIFDNRDNPFHYILSAINLVEEYAQSLGKKMEFYHLKIDSELDSPDGKKYGLGSSA 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   AL    Y    S + +   A    L VQG  S  D+AAS++GG I Y
Sbjct: 122 AVTVATIKALSEF-YELNLSKEHLFKLASIAHLNVQGNGSLGDIAASVYGGWIAY 175


>gi|307286709|ref|ZP_07566795.1| phosphomevalonate kinase [Enterococcus faecalis TX0109]
 gi|306502187|gb|EFM71471.1| phosphomevalonate kinase [Enterococcus faecalis TX0109]
          Length = 368

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 151/362 (41%), Gaps = 68/362 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD-------RLINIDSSLGQ 59
           I V+ PG L + GE+ V+  GH A++ A+++ V + +    D       +  ++     +
Sbjct: 2   IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETTDEGSIQSAQYSSLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLGSSA 107
             G L L +    F +++ AI           K    + LKV S+LDS    + GLGSS 
Sbjct: 62  RNGELVLDIRENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--- 164
           A+TV    AL  + Y      +EI   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVGTVKAL-NIFYDLGLENEEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFSTFDH 180

Query: 165 ----PKYSIEKID----------FIFPIHLI--------YSGYKTPTAQVLKKISYIEIE 202
                K + E +            IFP+ +         ++G    T+ ++ ++   + E
Sbjct: 181 DWVNKKVATETLTDLLAMDWPELMIFPLKVPKQLRLLIGWTGSPASTSDLVDRVHQSKEE 240

Query: 203 YPEINE---------INQKIYAL-MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
                E         +   I     GK+S I  Q  +N+ L  LA+  +    ++ET  +
Sbjct: 241 KQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQL--LAELSSLTGVVIETEAL 298

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIV 312
            +  L ++      + +  A+K SG+G GDC I + +     LP  +        GI  +
Sbjct: 299 KN--LCDLA-----ESYTGAAKSSGAGGGDCGIVIFRQKSGILPLMTA---WEKDGITPL 348

Query: 313 PI 314
           P+
Sbjct: 349 PL 350


>gi|251795042|ref|YP_003009773.1| galactokinase [Paenibacillus sp. JDR-2]
 gi|247542668|gb|ACS99686.1| galactokinase [Paenibacillus sp. JDR-2]
          Length = 390

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 133/325 (40%), Gaps = 50/325 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      A+     L +  R DR + + ++      SLD+     
Sbjct: 27  APGRVNLIGEHTDYNGGYVFPAALTFGTTLLIRKRDDRQLGLATTNFPSSKSLDIDKIAF 86

Query: 68  ------MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                 M +P      +    I+ S G+DL    ++ +  GL SSA+I V    ALLT++
Sbjct: 87  DEADDWMNYPKGIVYELGQKGIQFSSGYDLLFHGEIPNGAGLSSSASIEVVTAYALLTME 146

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG---------------LICYQMP 165
             K     +I   +     +  G+  GI D  A  +G                L+ +Q  
Sbjct: 147 -GKPTDTVQIALLSQKSENEFNGVQCGIMDQFAVANGKKDHAILLMCDTLEYELVPFQSG 205

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ-------------- 211
            Y +   +      L+ S Y    +Q  + +  ++  +PE+  + Q              
Sbjct: 206 AYKLVIGNTNKRRGLVDSAYNERRSQCEQAVVDLQAAFPELKLLGQINLEQFNANKHLIK 265

Query: 212 ------KIYALMGKLSQI--SCQALRNKNLKVLAQAMNRQQGLLETL-GVSDSKLSEIVW 262
                 +   ++ ++ ++  S  AL+  +L+   Q MN     L  L  V+ S+L  +V 
Sbjct: 266 DEVVRNRAQHVVEEIDRVLRSMDALKANDLEAFGQYMNGSHDSLRDLYEVTGSELDAMVA 325

Query: 263 KLREQPHIMASKISGSGLGDCVIAL 287
             R+ P ++ S+++G+G G C ++L
Sbjct: 326 AARQVPGVLGSRMTGAGFGGCTVSL 350


>gi|323466405|gb|ADX70092.1| Phosphomevalonate kinase [Lactobacillus helveticus H10]
          Length = 384

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 144/338 (42%), Gaps = 58/338 (17%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+ V + +T  K        +  + DS    
Sbjct: 26  ITEKAPGKLYIAGEYAVLEQNCPAVLVAVNQFVRVSITKSKTSTGLIHSKQYSQDSIHWV 85

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI++ +  C         +DL V S LDS    + GLGSS
Sbjct: 86  RQGSKMVIDNRDNPFEYILSAISYTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 145

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-- 163
           AA+TVA   A+L   ++     +E++    AI    VQG  S  D+AAS++GG + YQ  
Sbjct: 146 AAVTVATVKAIL--HFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTF 203

Query: 164 ---MPKYSIE---------------KIDFIFPIH--LIYSGYKTPTAQVLKKISYIEIEY 203
                +Y +                KI+ + P H   +  G+    A   + +       
Sbjct: 204 DKKWLQYELANKTLSDVVNEAWPGLKIELLTPPHDMKLMIGWSQKPASTSRLVDETNANK 263

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWK 263
             +N   +   A   +           KN+ ++ + +   + LL+      +K+++I  +
Sbjct: 264 AALNTEYKNFLAASSECVLKMIVGFEAKNIALIKKQIRVNRHLLQHF----AKINQIAIE 319

Query: 264 LREQPHIM--------ASKISGSGLGDCVIALGKGDLN 293
           +     ++        A+K SG+G GDC I +   D +
Sbjct: 320 IPRLTQLIKIAEDFGGAAKTSGAGNGDCGIVITDADTD 357


>gi|325689462|gb|EGD31467.1| mevalonate kinase [Streptococcus sanguinis SK115]
          Length = 292

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAIF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGQQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLAKLGVSCQKADELVSVALENG-ALGAKMSGGGLGGCVIAL 265


>gi|29375486|ref|NP_814640.1| phosphomevalonate kinase [Enterococcus faecalis V583]
 gi|227517821|ref|ZP_03947870.1| phosphomevalonate kinase [Enterococcus faecalis TX0104]
 gi|227555013|ref|ZP_03985060.1| phosphomevalonate kinase [Enterococcus faecalis HH22]
 gi|229546746|ref|ZP_04435471.1| phosphomevalonate kinase [Enterococcus faecalis TX1322]
 gi|229548838|ref|ZP_04437563.1| phosphomevalonate kinase [Enterococcus faecalis ATCC 29200]
 gi|255971352|ref|ZP_05421938.1| phosphomevalonate kinase [Enterococcus faecalis T1]
 gi|255973971|ref|ZP_05424557.1| phosphomevalonate kinase [Enterococcus faecalis T2]
 gi|256617770|ref|ZP_05474616.1| phosphomevalonate kinase [Enterococcus faecalis ATCC 4200]
 gi|256761656|ref|ZP_05502236.1| phosphomevalonate kinase [Enterococcus faecalis T3]
 gi|256854254|ref|ZP_05559618.1| phosphomevalonate kinase [Enterococcus faecalis T8]
 gi|256960026|ref|ZP_05564197.1| phosphomevalonate kinase [Enterococcus faecalis Merz96]
 gi|256964279|ref|ZP_05568450.1| phosphomevalonate kinase [Enterococcus faecalis HIP11704]
 gi|257081145|ref|ZP_05575506.1| phosphomevalonate kinase [Enterococcus faecalis E1Sol]
 gi|257083814|ref|ZP_05578175.1| phosphomevalonate kinase [Enterococcus faecalis Fly1]
 gi|257086239|ref|ZP_05580600.1| phosphomevalonate kinase [Enterococcus faecalis D6]
 gi|257089312|ref|ZP_05583673.1| phosphomevalonate kinase [Enterococcus faecalis CH188]
 gi|257415464|ref|ZP_05592458.1| phosphomevalonate kinase [Enterococcus faecalis AR01/DG]
 gi|257418496|ref|ZP_05595490.1| phosphomevalonate kinase [Enterococcus faecalis T11]
 gi|257421146|ref|ZP_05598136.1| phosphomevalonate kinase [Enterococcus faecalis X98]
 gi|293383780|ref|ZP_06629687.1| phosphomevalonate kinase [Enterococcus faecalis R712]
 gi|293388744|ref|ZP_06633237.1| phosphomevalonate kinase [Enterococcus faecalis S613]
 gi|300859770|ref|ZP_07105858.1| phosphomevalonate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|307271901|ref|ZP_07553169.1| phosphomevalonate kinase [Enterococcus faecalis TX0855]
 gi|307278403|ref|ZP_07559478.1| phosphomevalonate kinase [Enterococcus faecalis TX0860]
 gi|307290918|ref|ZP_07570808.1| phosphomevalonate kinase [Enterococcus faecalis TX0411]
 gi|312901556|ref|ZP_07760829.1| phosphomevalonate kinase [Enterococcus faecalis TX0470]
 gi|312904461|ref|ZP_07763620.1| phosphomevalonate kinase [Enterococcus faecalis TX0635]
 gi|312907004|ref|ZP_07766000.1| phosphomevalonate kinase [Enterococcus faecalis DAPTO 512]
 gi|312952831|ref|ZP_07771693.1| phosphomevalonate kinase [Enterococcus faecalis TX0102]
 gi|312978738|ref|ZP_07790465.1| phosphomevalonate kinase [Enterococcus faecalis DAPTO 516]
 gi|29342946|gb|AAO80710.1| phosphomevalonate kinase [Enterococcus faecalis V583]
 gi|227074711|gb|EEI12674.1| phosphomevalonate kinase [Enterococcus faecalis TX0104]
 gi|227175839|gb|EEI56811.1| phosphomevalonate kinase [Enterococcus faecalis HH22]
 gi|229306067|gb|EEN72063.1| phosphomevalonate kinase [Enterococcus faecalis ATCC 29200]
 gi|229308095|gb|EEN74082.1| phosphomevalonate kinase [Enterococcus faecalis TX1322]
 gi|255962370|gb|EET94846.1| phosphomevalonate kinase [Enterococcus faecalis T1]
 gi|255966843|gb|EET97465.1| phosphomevalonate kinase [Enterococcus faecalis T2]
 gi|256597297|gb|EEU16473.1| phosphomevalonate kinase [Enterococcus faecalis ATCC 4200]
 gi|256682907|gb|EEU22602.1| phosphomevalonate kinase [Enterococcus faecalis T3]
 gi|256709814|gb|EEU24858.1| phosphomevalonate kinase [Enterococcus faecalis T8]
 gi|256950522|gb|EEU67154.1| phosphomevalonate kinase [Enterococcus faecalis Merz96]
 gi|256954775|gb|EEU71407.1| phosphomevalonate kinase [Enterococcus faecalis HIP11704]
 gi|256989175|gb|EEU76477.1| phosphomevalonate kinase [Enterococcus faecalis E1Sol]
 gi|256991844|gb|EEU79146.1| phosphomevalonate kinase [Enterococcus faecalis Fly1]
 gi|256994269|gb|EEU81571.1| phosphomevalonate kinase [Enterococcus faecalis D6]
 gi|256998124|gb|EEU84644.1| phosphomevalonate kinase [Enterococcus faecalis CH188]
 gi|257157292|gb|EEU87252.1| phosphomevalonate kinase [Enterococcus faecalis ARO1/DG]
 gi|257160324|gb|EEU90284.1| phosphomevalonate kinase [Enterococcus faecalis T11]
 gi|257162970|gb|EEU92930.1| phosphomevalonate kinase [Enterococcus faecalis X98]
 gi|291078856|gb|EFE16220.1| phosphomevalonate kinase [Enterococcus faecalis R712]
 gi|291081901|gb|EFE18864.1| phosphomevalonate kinase [Enterococcus faecalis S613]
 gi|300850588|gb|EFK78337.1| phosphomevalonate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|306497988|gb|EFM67515.1| phosphomevalonate kinase [Enterococcus faecalis TX0411]
 gi|306504909|gb|EFM74104.1| phosphomevalonate kinase [Enterococcus faecalis TX0860]
 gi|306511407|gb|EFM80409.1| phosphomevalonate kinase [Enterococcus faecalis TX0855]
 gi|310626989|gb|EFQ10272.1| phosphomevalonate kinase [Enterococcus faecalis DAPTO 512]
 gi|310629347|gb|EFQ12630.1| phosphomevalonate kinase [Enterococcus faecalis TX0102]
 gi|310632159|gb|EFQ15442.1| phosphomevalonate kinase [Enterococcus faecalis TX0635]
 gi|311288445|gb|EFQ67001.1| phosphomevalonate kinase [Enterococcus faecalis DAPTO 516]
 gi|311291351|gb|EFQ69907.1| phosphomevalonate kinase [Enterococcus faecalis TX0470]
 gi|315027087|gb|EFT39019.1| phosphomevalonate kinase [Enterococcus faecalis TX2137]
 gi|315029771|gb|EFT41703.1| phosphomevalonate kinase [Enterococcus faecalis TX4000]
 gi|315145811|gb|EFT89827.1| phosphomevalonate kinase [Enterococcus faecalis TX2141]
 gi|315148059|gb|EFT92075.1| phosphomevalonate kinase [Enterococcus faecalis TX4244]
 gi|315152974|gb|EFT96990.1| phosphomevalonate kinase [Enterococcus faecalis TX0031]
 gi|315155205|gb|EFT99221.1| phosphomevalonate kinase [Enterococcus faecalis TX0043]
 gi|315157533|gb|EFU01550.1| phosphomevalonate kinase [Enterococcus faecalis TX0312]
 gi|315163039|gb|EFU07056.1| phosphomevalonate kinase [Enterococcus faecalis TX0645]
 gi|315165238|gb|EFU09255.1| phosphomevalonate kinase [Enterococcus faecalis TX1302]
 gi|315167963|gb|EFU11980.1| phosphomevalonate kinase [Enterococcus faecalis TX1341]
 gi|315172004|gb|EFU16021.1| phosphomevalonate kinase [Enterococcus faecalis TX1342]
 gi|315174855|gb|EFU18872.1| phosphomevalonate kinase [Enterococcus faecalis TX1346]
 gi|315574185|gb|EFU86376.1| phosphomevalonate kinase [Enterococcus faecalis TX0309B]
 gi|315577316|gb|EFU89507.1| phosphomevalonate kinase [Enterococcus faecalis TX0630]
 gi|315581672|gb|EFU93863.1| phosphomevalonate kinase [Enterococcus faecalis TX0309A]
 gi|323480082|gb|ADX79521.1| phosphomevalonate kinase [Enterococcus faecalis 62]
 gi|327534482|gb|AEA93316.1| phosphomevalonate kinase [Enterococcus faecalis OG1RF]
          Length = 368

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 151/362 (41%), Gaps = 68/362 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKD-------RLINIDSSLGQ 59
           I V+ PG L + GE+ V+  GH A++ A+++ V + +    D       +  ++     +
Sbjct: 2   IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETTDEGSIQSAQYSSLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLGSSA 107
             G L L +    F +++ AI           K    + LKV S+LDS    + GLGSS 
Sbjct: 62  RNGELVLDIRENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--- 164
           A+TV    AL  + Y      +EI   +    L VQG  S  D+AAS +GG I +     
Sbjct: 122 AVTVGTVKAL-NIFYDLGLENEEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFSTFDH 180

Query: 165 ----PKYSIEKID----------FIFPIHLI--------YSGYKTPTAQVLKKISYIEIE 202
                K + E +            IFP+ +         ++G    T+ ++ ++   + E
Sbjct: 181 DWVNQKVATETLTDLLAMDWPELMIFPLKVPKQLRLLIGWTGSPASTSDLVDRVHQSKEE 240

Query: 203 YPEINE---------INQKIYAL-MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
                E         +   I     GK+S I  Q  +N+ L  LA+  +    ++ET  +
Sbjct: 241 KQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQL--LAELSSLTGVVIETEAL 298

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIV 312
            +  L ++      + +  A+K SG+G GDC I + +     LP  +        GI  +
Sbjct: 299 KN--LCDLA-----ESYTGAAKSSGAGGGDCGIVIFRQKSGILPLMTA---WEKDGITPL 348

Query: 313 PI 314
           P+
Sbjct: 349 PL 350


>gi|325568463|ref|ZP_08144830.1| phosphomevalonate kinase [Enterococcus casseliflavus ATCC 12755]
 gi|325158232|gb|EGC70385.1| phosphomevalonate kinase [Enterococcus casseliflavus ATCC 12755]
          Length = 360

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT-LRKDRLI------NIDSSLGQ 59
           I +S PG L + GE+ V+  GH A++ A+++ + + +   RK+  I      ++     +
Sbjct: 2   IELSVPGKLFIAGEYAVVEPGHPAIIVAVDQFITVNVEEARKNGSIQSAQYSDLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIK--------PSCGFDLKVISQLDS----QLGLGSSA 107
             G L L      F +I+ AI   +        P   +DLKV S+LD+    + GLGSS 
Sbjct: 62  RKGELVLDHRDNPFHYILAAIRLTEKYAQEKGIPLSFYDLKVTSELDNSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   A L L Y  E         A    L VQG  S  D+AAS +GG I +
Sbjct: 122 AVTVATVKA-LNLYYQMEMDRLTQFKIAALAHLAVQGNGSCGDIAASCYGGWIAF 175


>gi|315038487|ref|YP_004032055.1| phosphomevalonate kinase [Lactobacillus amylovorus GRL 1112]
 gi|312276620|gb|ADQ59260.1| phosphomevalonate kinase [Lactobacillus amylovorus GRL 1112]
 gi|327183682|gb|AEA32129.1| phosphomevalonate kinase [Lactobacillus amylovorus GRL 1118]
          Length = 360

 Score = 60.5 bits (145), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 88/178 (49%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAVLVAVNQFVRVSITKSKTSTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKMVIDNRDNPFEYILSAISFTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   ++   + +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAIL--HFYGVKTSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|324990339|gb|EGC22277.1| mevalonate kinase [Streptococcus sanguinis SK353]
          Length = 292

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAIF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
             EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G 
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGI 171

Query: 186 KTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +  
Sbjct: 172 HGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAH 223

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 224 EKLVKLGVSCQKADELVSVALENG-ALGAKMSGGGLGGCVIAL 265


>gi|325956903|ref|YP_004292315.1| phosphomevalonate kinase [Lactobacillus acidophilus 30SC]
 gi|325333468|gb|ADZ07376.1| phosphomevalonate kinase [Lactobacillus acidophilus 30SC]
          Length = 360

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 88/178 (49%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAVLVAVNQFVRVSITKSKTSTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKMVIDNRDNPFEYILSAISFTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   ++   + +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAIL--HFYGVKTSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|309806229|ref|ZP_07700243.1| phosphomevalonate kinase [Lactobacillus iners LactinV 03V1-b]
 gi|308167376|gb|EFO69541.1| phosphomevalonate kinase [Lactobacillus iners LactinV 03V1-b]
          Length = 357

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 83/185 (44%), Gaps = 38/185 (20%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVI----------------------LYLT 44
           I   APG L + GE+ VL  H  A++ A+N+ V                       +Y +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQHCPAILVALNEFVTVSINKSQGSTGVIHSKQYSQNCIYWS 61

Query: 45  LRKDRLI--NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS--- 99
            R +++I  N D+       ++ L   +     I +AI        +DL + S+LDS   
Sbjct: 62  RRGNKMIINNRDNPFEYILSAIKLTEMYCLEKGITLAI--------YDLHINSELDSPDG 113

Query: 100 -QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG 158
            + GLGSSAA+TVA   A+L   Y  E     I   +      VQG  S  D+AAS++GG
Sbjct: 114 KKFGLGSSAAVTVATVKAILHF-YGIELDKSLIFKLSAIAHYTVQGNGSAGDIAASVYGG 172

Query: 159 LICYQ 163
            + YQ
Sbjct: 173 WLAYQ 177


>gi|124088233|ref|XP_001347016.1| Mevalonate kinase [Paramecium tetraurelia strain d4-2]
 gi|50057405|emb|CAH03389.1| Mevalonate kinase, putative [Paramecium tetraurelia]
          Length = 288

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 140/290 (48%), Gaps = 34/290 (11%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V AP  +++ GEH V++GH AL  AINK   + +   K   I I      +   L+L   
Sbjct: 3   VRAPAKIIISGEHSVVYGHKALCAAINKYTKIKIHSNKANSIEIRWG-NDWHEVLNLDSN 61

Query: 70  HPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +     +A I +IKPS    ++V S++    GLGSSA+  VA++ A+         S 
Sbjct: 62  NTNSQLAQVARILNIKPSI---IEVESEVPISSGLGSSASFAVALSKAM-------NGSI 111

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IFPIHLIYSGYKT 187
           ++ +   +    K     SG+D+  + HGG+  +Q+ K  I+K++  I  I LI SG + 
Sbjct: 112 EQAIEIENIFHGKR---GSGLDVQVTNHGGICIFQIGK-PIQKVNLPIQNILLIDSGDRK 167

Query: 188 P--TAQVLKKISYIEIEYPEINEINQKI-YALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T   + K+          N + QK    ++ ++S+++ Q ++   +K L   +    
Sbjct: 168 QKGTEGSIAKVK---------NCVEQKDGRQILNRISEVTEQIIKEGLVKEL---IYENH 215

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            LL  LG+   ++++I+   + +   + +K++G+G G   IA  K +  S
Sbjct: 216 DLLNRLGICTDRINDIIRICKREG--VPAKMTGAGDGGFCIAFPKDEQES 263


>gi|331216191|ref|XP_003320775.1| cystathionine beta-lyase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309299765|gb|EFP76356.1| cystathionine beta-lyase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 932

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 88/368 (23%), Positives = 144/368 (39%), Gaps = 95/368 (25%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVIL------YLTLRKDRLINIDSSLGQYC 61
           + VSAPG ++L GEH V++G  A+  A+N+R         Y T+    L   DS    + 
Sbjct: 469 LLVSAPGKIILFGEHAVVYGKKAIAAAVNRRCYCFVEPGGYQTIETVALCLPDSG---WS 525

Query: 62  GSLDLAMF---------------HPSFS--------------------------FIIMAI 80
           GS  +                  +P  S                          F+ +A 
Sbjct: 526 GSWPINQLPWDCVKPTGEGELHVNPQLSQALLTKVAGQADKNSVLQAAHAFLYLFMHLAT 585

Query: 81  NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE-PSPDEILTTAHAIV 139
              + S  F ++  S L    GLGSSA+ +V + +ALL    H   P+   I TT    +
Sbjct: 586 KENRRSQVFTIR--STLPIGAGLGSSASYSVCLASALLYSHQHIAIPTQKGIETTQVETI 643

Query: 140 LK--------VQGISSGIDLAASIHGGLICYQ--------MPKYSIEKIDFIFPIHLIYS 183
            +        + G  SG+D   S  GG IC+Q          + SIE+I     I ++ S
Sbjct: 644 NRWAFLGEKILHGSPSGVDNTVSSFGGAICFQKLIGENDQQKRQSIEQIQGFGAIRILIS 703

Query: 184 GYKTP--TAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISC----------- 225
             + P  T  ++  ++  + + P++     +EI +   +    + +++            
Sbjct: 704 DTQVPRDTKSLVAGVAQKKEKDPKLVQSILDEIEELTISAQESIKELAVIKQPDSKDGQN 763

Query: 226 ------QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSG 279
                 +  RNK L  L   M R   LL +LGV  S+L  +  K       + +K++G+G
Sbjct: 764 PDQELLKTKRNKILNQLGHLMARNHSLLSSLGVGHSQLDLV--KSFAANCGLETKLTGAG 821

Query: 280 LGDCVIAL 287
            G C I L
Sbjct: 822 GGGCAITL 829


>gi|295424859|ref|ZP_06817574.1| mevalonate kinase [Lactobacillus amylolyticus DSM 11664]
 gi|295065425|gb|EFG56318.1| mevalonate kinase [Lactobacillus amylolyticus DSM 11664]
          Length = 303

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 138/285 (48%), Gaps = 23/285 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL--GQYCGSLDLAMF 69
           A G ++L+GEH V++G+ AL   I K + +  T+     + +D++   G Y  + D    
Sbjct: 7   AHGKVILIGEHSVVYGYDALALPI-KALNIRTTVEDGSQMWMDTARYHGPYFEAPDE--- 62

Query: 70  HPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           +    +++  I     +P     +    ++  + GLGSSA + +  T A+    ++ + +
Sbjct: 63  YNGLKYVVKTILKKAGQPDAKLKITYTGEIPMERGLGSSATVALGTTKAMNQF-FNLQMT 121

Query: 128 PDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICY----QMPKYSIEKIDFIFPIHLIY 182
            +EI+  T HA ++   G +SG+D AA++H   + +      PK    K++    I  + 
Sbjct: 122 ENEIMAITNHAEMIN-HGKASGLD-AATVHSDYLVFFNKQAGPKKLTAKLNSTLLI--MD 177

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +G    T + + K+     E     + N+ I  L G L+  + +A   +N + + +  + 
Sbjct: 178 TGQLGNTKEAVTKVRQ---EMENSIQANKGIERL-GVLADQTKKAWIKQNQEQVGKIFDE 233

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q +L +LG+S  ++ ++  ++  Q   +  K+SG GLG  VIAL
Sbjct: 234 AQTILSSLGLSTDRIDQLN-QIAHQKGCLGFKLSGGGLGGIVIAL 277


>gi|259500610|ref|ZP_05743512.1| phosphomevalonate kinase [Lactobacillus iners DSM 13335]
 gi|302191299|ref|ZP_07267553.1| phosphomevalonate kinase [Lactobacillus iners AB-1]
 gi|309804020|ref|ZP_07698102.1| phosphomevalonate kinase [Lactobacillus iners LactinV 11V1-d]
 gi|309805046|ref|ZP_07699102.1| phosphomevalonate kinase [Lactobacillus iners LactinV 09V1-c]
 gi|309807493|ref|ZP_07701453.1| phosphomevalonate kinase [Lactobacillus iners LactinV 01V1-a]
 gi|312871754|ref|ZP_07731842.1| phosphomevalonate kinase [Lactobacillus iners LEAF 3008A-a]
 gi|312873047|ref|ZP_07733107.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2062A-h1]
 gi|312874161|ref|ZP_07734195.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2052A-d]
 gi|315653558|ref|ZP_07906478.1| phosphomevalonate kinase [Lactobacillus iners ATCC 55195]
 gi|325912082|ref|ZP_08174480.1| phosphomevalonate kinase [Lactobacillus iners UPII 143-D]
 gi|329920269|ref|ZP_08277053.1| phosphomevalonate kinase [Lactobacillus iners SPIN 1401G]
 gi|259167994|gb|EEW52489.1| phosphomevalonate kinase [Lactobacillus iners DSM 13335]
 gi|308163939|gb|EFO66204.1| phosphomevalonate kinase [Lactobacillus iners LactinV 11V1-d]
 gi|308165637|gb|EFO67864.1| phosphomevalonate kinase [Lactobacillus iners LactinV 09V1-c]
 gi|308169258|gb|EFO71316.1| phosphomevalonate kinase [Lactobacillus iners LactinV 01V1-a]
 gi|311090231|gb|EFQ48641.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2052A-d]
 gi|311091569|gb|EFQ49953.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2062A-h1]
 gi|311092696|gb|EFQ51052.1| phosphomevalonate kinase [Lactobacillus iners LEAF 3008A-a]
 gi|315488920|gb|EFU78562.1| phosphomevalonate kinase [Lactobacillus iners ATCC 55195]
 gi|325476032|gb|EGC79200.1| phosphomevalonate kinase [Lactobacillus iners UPII 143-D]
 gi|328936314|gb|EGG32762.1| phosphomevalonate kinase [Lactobacillus iners SPIN 1401G]
          Length = 357

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSS-LGQYC---- 61
           I   APG L + GE+ VL  H  A++ A+N+ V + +   +     I S    Q C    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQHCPAILVALNEFVTVSINKSQGSTGVIHSKQYSQNCIYWS 61

Query: 62  ---GSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSS 106
                + +      F +I+ AI   +  C         +DL + S+LDS    + GLGSS
Sbjct: 62  RRGNKMIINNRDNPFEYILSAIKFTEMYCLEKGITLAIYDLHINSELDSPDGKKFGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E     I   +      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILHF-YGIELDKSLIFKLSAIAHYTVQGNGSAGDIAASVYGGWLAYQ 177


>gi|257899515|ref|ZP_05679168.1| mevalonate kinase [Enterococcus faecium Com15]
 gi|257837427|gb|EEV62501.1| mevalonate kinase [Enterococcus faecium Com15]
          Length = 314

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 14  GSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS 72
           G ++LMGEH V++G  A+ F     +V  +L    + L  +D  L     S +LA    +
Sbjct: 11  GKIILMGEHAVVYGEPAIAFPFYATKVTAFL----EELDAMDDQLVSSYYSGNLAEAPHT 66

Query: 73  FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              I     H+K          L + S + ++ G+GSSAA+  A+T A     Y   P  
Sbjct: 67  LKNIKKLFIHLKKEHDIHKNLQLTIESTIPAERGMGSSAAVATAVTRAFY--DYLALPLS 124

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            EIL     +  K+  G  SGID AA+     I Y    +  +         LI   +G 
Sbjct: 125 REILLEKVQLSEKIAHGNPSGIDAAATSSLQPI-YFTKGHPFDYFSLNIDAFLIVADTGI 183

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           K  T + +K ++++    P  +E  Q I  L G L++ + QA+   + ++LAQ M+  Q 
Sbjct: 184 KGQTREAVKDVAHLFERQP--HETGQMIQKL-GYLTKQAKQAIIENSPEMLAQTMDESQS 240

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LLE L +S+  L +++ +  +    + +K++G G G C+IAL +
Sbjct: 241 LLEKLTISNDFL-DLLIQTAKGTGALGAKLTGGGRGGCMIALAQ 283


>gi|309809882|ref|ZP_07703732.1| phosphomevalonate kinase [Lactobacillus iners SPIN 2503V10-D]
 gi|308169834|gb|EFO71877.1| phosphomevalonate kinase [Lactobacillus iners SPIN 2503V10-D]
          Length = 357

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSS-LGQYC---- 61
           I   APG L + GE+ VL  H  A++ A+N+ V + +   +     I S    Q C    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQHCPAILVALNEFVTVSINKSQGSTGVIHSKQYSQNCIYWS 61

Query: 62  ---GSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSS 106
                + +      F +I+ AI   +  C         +DL + S+LDS    + GLGSS
Sbjct: 62  RRGNKMIINNRDNPFEYILSAIKFTEMYCLEKGITLAIYDLHINSELDSPDGKKFGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E     I   +      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILHF-YGIELDKSLIFKLSAIAHYTVQGNGSAGDIAASVYGGWLAYQ 177


>gi|325092272|gb|EGC45582.1| mevalonate kinase [Ajellomyces capsulatus H88]
          Length = 581

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 154/364 (42%), Gaps = 72/364 (19%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 108 VSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD-- 165

Query: 61  CGSLDLAMFH-PS---------FSFIIMAINHIKPS-CGFDLKVISQLDSQ--------- 100
             SL   +FH PS          S     +  I+P      +    +L +          
Sbjct: 166 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDELPTDSCRSVHTTI 225

Query: 101 -----LGLGSSAAITVAITAALLTLQY------HKEPSPDEILTTAHAI-------VLKV 142
                 GLGSSA+I V ++AALL LQ       H++  P+E  T    I        + +
Sbjct: 226 NHPHCAGLGSSASIAVCLSAALL-LQIRILAGPHQDQLPEEAETQIERINKWAFVGEMCI 284

Query: 143 QGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FPIHLIYSGYKTPTAQVLKKI 196
            G  SG+D   S  G  + ++   YS        +DF   P+ L+ S     T+  + K+
Sbjct: 285 HGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELPLLLVNSRQPRSTSVEVAKV 344

Query: 197 SYIEIEYPEINE-----INQKIYAL-----MGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           +     +P ++E     I+Q   +       G+  + S +A+ +       +      GL
Sbjct: 345 ANFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSEAIDH-----FGELFRINHGL 399

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L +LGVS  +L E + +L +      +K++G+G G C I L + +++    + +   +  
Sbjct: 400 LVSLGVSHPRL-ERIRELVDHTGSGWTKLTGAGGGGCAITLLRTNIDPAALKRLEKTLDD 458

Query: 307 KGID 310
           +G +
Sbjct: 459 EGFE 462


>gi|295113906|emb|CBL32543.1| phosphomevalonate kinase, ERG8-type, Gram-positive branch
           [Enterococcus sp. 7L76]
          Length = 360

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 155/372 (41%), Gaps = 83/372 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC----- 61
           I V+ PG L + GE+ V+  GH A++ A+++ V + +    D   +I S+  QY      
Sbjct: 2   IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETTDEG-SIQSA--QYSSLPIR 58

Query: 62  -----GSLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLG 104
                G L L +    F +++ AI           K    + LKV S+LDS    + GLG
Sbjct: 59  WTRRNGELVLDIRENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSSNGRKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM 164
           SS A+TV    AL  + Y      +EI   +    L VQG  S  D+AAS +GG I +  
Sbjct: 119 SSGAVTVGTVKAL-NIFYDLGLENEEIFKLSALAHLAVQGNGSCGDIAASCYGGWIAFST 177

Query: 165 -------PKYSIEKID----------FIFPIHLI--------YSGYKTPTAQVLKKISYI 199
                   K + E +            IFP+ +         ++G    T+ ++ ++   
Sbjct: 178 FDHDWVNQKVATETLTDLLAMDWPELMIFPLKIPKQLRLLIGWTGSPASTSDLVDRVHQS 237

Query: 200 EIEYPEINE---------INQKIYAL-MGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           + E     E         +   I     GK+S I  Q  +N+ L  LA+  +    ++ET
Sbjct: 238 KEEKQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQL--LAELSSLTGVVIET 295

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK------------GDLNSLPY 297
             + +  L ++      + +  A+K SG+G GDC I + +            G   + P 
Sbjct: 296 EALKN--LCDLA-----ESYTGAAKSSGAGGGDCGIVIFRQKSGIFTINDSLGKRRNYPT 348

Query: 298 QSVNCHMHAKGI 309
            +   ++ +KG+
Sbjct: 349 ATSRLYLWSKGV 360


>gi|322702827|gb|EFY94450.1| mevalonate kinase [Metarhizium anisopliae ARSEF 23]
          Length = 463

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 143/358 (39%), Gaps = 84/358 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH  + G  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 15  VSAPGKVIVFGEHAAVFGKPAIAAAISLRSYLLVTTLSKSHRIVKLNFRDIGLDHTW--K 72

Query: 61  CGSLDLAMFH----------------------------------------------PSFS 74
             +L   +FH                                               +F 
Sbjct: 73  IDTLPWGIFHRPEKKKFYYSLIDSLDPELLDAIIPHAEEVSKHLPEKQRKMHVRSATAFL 132

Query: 75  FIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAI-TAALLTLQYHKEPSPDEIL 132
           ++ +++  +  P   + L+  S +    GLGSSA+I V + TA LL ++    P PD+  
Sbjct: 133 YLFLSLGSLHSPGSIYTLR--STIPIGAGLGSSASICVCLSTALLLQIRTLAGPHPDQPA 190

Query: 133 TTAHAIVLK-----------VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFI-F 176
             A   + +           + G  SG+D A S  G  + YQ     P   I   +F   
Sbjct: 191 EEAQIQIERISRWAFVGELCIHGDPSGVDNAVSAGGQAVVYQRKGSGPPSVIPLNNFPKL 250

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK---NL 233
           P+ L+ +     TA  ++K+  +   +P +  +   I   +G+L+  +   L      ++
Sbjct: 251 PLLLVNTQQPRSTATQVEKVRELRANHPHVTGL---ILDAIGQLTSSALADLETNGMSDM 307

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             L   +    GLL +LGVS  +L  I  +L +   +  +K++G+G G C I L + D
Sbjct: 308 DRLGTMIRMNHGLLVSLGVSHPRLERIR-ELVDHADVGWTKLTGAGGGGCAITLFRPD 364


>gi|146387259|pdb|2HFU|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase In Complex
           With R-Mevalonate
 gi|146387260|pdb|2HFU|B Chain B, Crystal Structure Of L. Major Mevalonate Kinase In Complex
           With R-Mevalonate
          Length = 332

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 14/282 (4%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS 72
           G ++L GEH V+HG  A+V  I++     L +      + +D       G +        
Sbjct: 20  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYI-AQKRDEQ 78

Query: 73  FSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                + ++H+K      G  + +   L    G+G+SA+  VA + AL  L Y    + +
Sbjct: 79  IKAHQLVLDHLKVDLSGDGLKMFIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDE 137

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICY--QMPKYSIEKIDFIFPIHLIY--SGY 185
           E+  +A        G  SG D  A+ +GGLI Y  Q  K   + I F   ++L+   +G 
Sbjct: 138 EVNLSAFVGEGGYHGTPSGADNTAATYGGLILYRRQNGKSVFKPIAFQQRLYLVVVGTGI 197

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              TA+V+  +  ++ + P      +++Y     +   + +AL+  +L+ L Q MN    
Sbjct: 198 NASTAKVVNDVHKMKQQQP---VQFKRLYDNYTHIVSQAREALQKGDLQRLGQLMNANHD 254

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 255 LCRQIDVSCRELESIVQTCRTY-GALGAKLSGTGRGGIAVAL 295


>gi|157873048|ref|XP_001685041.1| mevalonate kinase [Leishmania major strain Friedlin]
 gi|68128112|emb|CAJ08243.1| putative mevalonate kinase [Leishmania major strain Friedlin]
          Length = 329

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 14/282 (4%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS 72
           G ++L GEH V+HG  A+V  I++     L +      + +D       G +        
Sbjct: 17  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYI-AQKRDEQ 75

Query: 73  FSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                + ++H+K      G  + +   L    G+G+SA+  VA + AL  L Y    + +
Sbjct: 76  IKAHQLVLDHLKVDLSGDGLKMFIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDE 134

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICY--QMPKYSIEKIDFIFPIHLIY--SGY 185
           E+  +A        G  SG D  A+ +GGLI Y  Q  K   + I F   ++L+   +G 
Sbjct: 135 EVNLSAFVGEGGYHGTPSGADNTAATYGGLILYRRQNGKSVFKPIAFQQRLYLVVVGTGI 194

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              TA+V+  +  ++ + P      +++Y     +   + +AL+  +L+ L Q MN    
Sbjct: 195 NASTAKVVNDVHKMKQQQP---VQFKRLYDNYTHIVSQAREALQKGDLQRLGQLMNANHD 251

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 252 LCRQIDVSCRELESIVQTCRTY-GALGAKLSGTGRGGIAVAL 292


>gi|227550901|ref|ZP_03980950.1| possible Mevalonate kinase [Enterococcus faecium TX1330]
 gi|257887848|ref|ZP_05667501.1| mevalonate kinase [Enterococcus faecium 1,141,733]
 gi|257893354|ref|ZP_05673007.1| mevalonate kinase [Enterococcus faecium 1,231,408]
 gi|257896534|ref|ZP_05676187.1| mevalonate kinase [Enterococcus faecium Com12]
 gi|293379313|ref|ZP_06625459.1| mevalonate kinase [Enterococcus faecium PC4.1]
 gi|227179999|gb|EEI60971.1| possible Mevalonate kinase [Enterococcus faecium TX1330]
 gi|257823902|gb|EEV50834.1| mevalonate kinase [Enterococcus faecium 1,141,733]
 gi|257829733|gb|EEV56340.1| mevalonate kinase [Enterococcus faecium 1,231,408]
 gi|257833099|gb|EEV59520.1| mevalonate kinase [Enterococcus faecium Com12]
 gi|292642109|gb|EFF60273.1| mevalonate kinase [Enterococcus faecium PC4.1]
          Length = 314

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 132/284 (46%), Gaps = 19/284 (6%)

Query: 14  GSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS 72
           G ++LMGEH V++G  A+ F     +V  +L    + L  +D  L     S +LA    +
Sbjct: 11  GKIILMGEHAVVYGEPAIAFPFYATKVTAFL----EELDAMDDQLVSSYYSGNLAEAPHT 66

Query: 73  FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              I     H+K          L + S + ++ G+GSSAA+  A+T A     Y   P  
Sbjct: 67  LKNIKKLFIHLKKEHDIHKNLQLTIESTIPAERGMGSSAAVATAVTRAF--YDYLALPLS 124

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            EIL     +  K+  G  SGID AA+     I Y    +  +         LI   +G 
Sbjct: 125 REILLENVQLSEKIAHGNPSGIDAAATSSLQPI-YFTKGHPFDYFSLNIDAFLIVADTGI 183

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           K  T + +K ++++    P  +E  Q I  L G L++ + QA+   +  +LAQ M+  Q 
Sbjct: 184 KGQTREAVKDVAHLFERQP--HETGQMIQKL-GYLTKQAKQAIIENSPGMLAQTMDESQS 240

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LLE L +S+  L  ++   ++    + +K++G G G C+IAL +
Sbjct: 241 LLEKLTISNDFLDLLIQTAKDTG-ALGAKLTGGGRGGCMIALAQ 283


>gi|116492692|ref|YP_804427.1| mevalonate kinase [Pediococcus pentosaceus ATCC 25745]
 gi|116102842|gb|ABJ67985.1| mevalonate kinase [Pediococcus pentosaceus ATCC 25745]
          Length = 306

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 132/291 (45%), Gaps = 20/291 (6%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           + +I  S+   ++L+GEH V++G  A+   I        T  K +  N D  +     + 
Sbjct: 1   MEEIIKSSNSKIILIGEHSVVYGQPAIALPIRN----VKTTVKIQPTNGDIQIKSRYFNG 56

Query: 65  DLAMFHPSF----SFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            L   H +     + I   +N + +P+    + + S + ++ G+GSSA+  VA+  AL  
Sbjct: 57  SLKDIHSNLLGIKNLIKQTLNELNRPNTNLLITIDSDVPAERGMGSSASTAVALVRALYA 116

Query: 120 LQYHKEPSPDEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
             Y + P     L     I  K+  G  SG+D A +     I ++    +I+ +      
Sbjct: 117 --YFEHPLTRTTLLKTVDISEKIIHGKPSGLDSATASANNPIWFKK-DGTIKPLPINVDA 173

Query: 179 HLIYS--GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
           +LI S  G K  T++ ++ I   ++ +   + +   +   +G+L+  +   LR  ++  L
Sbjct: 174 YLIISDSGIKGKTSEAVE-IVKNKLRFDSDSRL---LIEKLGELTSQTATVLRQNDVSTL 229

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            + +      L  LGVS   + +++ K+      + SK++G GLG CVI+L
Sbjct: 230 GKILTEAHTNLRQLGVSHPAVEKLI-KIANDSGALGSKLTGGGLGGCVISL 279


>gi|268319451|ref|YP_003293107.1| phosphomevalonate kinase [Lactobacillus johnsonii FI9785]
 gi|262397826|emb|CAX66840.1| phosphomevalonate kinase [Lactobacillus johnsonii FI9785]
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 87/351 (24%), Positives = 147/351 (41%), Gaps = 78/351 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 2   ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 61

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 62  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 116

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 117 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 175

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 176 YQTFDKAWLKTELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 235

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET--- 249
           +    +I  +Y    + ++K    M        +    KN+ ++ + +   + LL+    
Sbjct: 236 NAKKKFIRTQYDTFLDESRKCVLDM-------IRGFNEKNISLIQKQIRLNRQLLKDFAS 288

Query: 250 ---LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
              + +   +L++++  + EQ +  A+K SG+G GDC  VIA  K D+  +
Sbjct: 289 LNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEKTDIEEM 337


>gi|329947848|ref|ZP_08294780.1| mevalonate kinase [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328523472|gb|EGF50570.1| mevalonate kinase [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 320

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 125/285 (43%), Gaps = 23/285 (8%)

Query: 17  VLMGEHGVLHGHAALVFAINK---RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           +L+GEH V++GH A+   ++    R        +  L ++D     Y G +  +   P F
Sbjct: 19  ILLGEHSVVYGHPAVAMPLHDLQMRATATPVTGRSVLHSLD-----YSGPMSSS--GPGF 71

Query: 74  SFIIMAINHIKPSCG-----FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + I+ A    +   G     F++   S    + GLGSSAA   A+  A+L     +E S 
Sbjct: 72  ACIVRAFEAAREFSGHLEQPFEIVTTSDFPHERGLGSSAAAAGAVIRAVLD-ACRREASA 130

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS--IEKIDFIFPIHLIYSGYK 186
           DE             G  SG+D AA+     I +Q  +     ++I+    + +  SG  
Sbjct: 131 DEFFALTQMAEQIAHGKPSGLDAAATSSPNPIRFQGGQMRPLTQRIEGARLV-IADSGIH 189

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T + +  +     + P  + I   I  L G+L+Q+   AL + + + L  AMN    +
Sbjct: 190 GRTREAVGGLRERYEKDP--DGIGPGINRL-GELAQVGIAALDDGDAQALGSAMNEAHEV 246

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           L  L +S   L  +    R+    + SK++G GLG CVIAL  G+
Sbjct: 247 LARLELSLPVLDRLTTAARDA-GALGSKLTGGGLGGCVIALADGE 290


>gi|227890031|ref|ZP_04007836.1| phosphomevalonate kinase [Lactobacillus johnsonii ATCC 33200]
 gi|227849475|gb|EEJ59561.1| phosphomevalonate kinase [Lactobacillus johnsonii ATCC 33200]
          Length = 367

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 87/351 (24%), Positives = 147/351 (41%), Gaps = 78/351 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 12  ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 71

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 72  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 126

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 127 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 185

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 186 YQTFDKAWLKTELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 245

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET--- 249
           +    +I  +Y    + ++K    M        +    KN+ ++ + +   + LL+    
Sbjct: 246 NAKKKFIRTQYDTFLDESRKCVLDM-------IRGFNEKNISLIQKQIRLNRQLLKDFAS 298

Query: 250 ---LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
              + +   +L++++  + EQ +  A+K SG+G GDC  VIA  K D+  +
Sbjct: 299 LNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEKTDIEEM 347


>gi|327459083|gb|EGF05431.1| mevalonate kinase [Streptococcus sanguinis SK1057]
          Length = 292

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 125/277 (45%), Gaps = 30/277 (10%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F      
Sbjct: 14  IILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLFAE-----DTLSMAVF------ 62

Query: 76  IIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVA-ITAALLTLQYHKEPSPDEILT 133
               + H+ +       +V S +  + G+GSSAA+++A I A     +   +    EIL 
Sbjct: 63  --ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVFDYFEEELDGQTLEILA 120

Query: 134 TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPTAQ 191
               ++  +    SG+D    +    I + +  +   +I+      L+   +G    T +
Sbjct: 121 NRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLAAFLVIADTGIHGHTRE 177

Query: 192 VLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
            ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +    L  L
Sbjct: 178 AIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAHEKLAKL 229

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           GVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 230 GVSCQKADELVAAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|325067069|ref|ZP_08125742.1| mevalonate kinase [Actinomyces oris K20]
          Length = 320

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 123/285 (43%), Gaps = 23/285 (8%)

Query: 17  VLMGEHGVLHGHAALVFAINK---RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           +L+GEH V++GH A+   +     R     T     L ++D     Y G LD A     F
Sbjct: 19  ILLGEHSVVYGHPAVAVPLQDLRMRATASPTSGPSTLSSLD-----YSGPLDQAGSR--F 71

Query: 74  SFIIMAINHIKPSCG-----FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +  A    +   G     FD+  +S    + GLGSSAA   AI  A+L     +E S 
Sbjct: 72  ASVARAFEVAREFSGGLVQAFDITTVSDFPHERGLGSSAAAAGAIIRAVLD-ACGREASS 130

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS--IEKIDFIFPIHLIYSGYK 186
           DE+            G  SG+D AA+     I +Q  +     ++ID  F + +  SG  
Sbjct: 131 DELFALTQMAEQIAHGKPSGLDAAATCSPCPIRFQGGQMRPLSQRIDNAFLV-IADSGIH 189

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T + +  +       P  + I  +I  L G L+Q +  AL   +   L  AM+    +
Sbjct: 190 GSTREAVGGLRRRYESDP--DNIGPRINRL-GALTQNAIMALDQADAPALGVAMDEAHAV 246

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           L  L +S   L ++    R     + +K++G GLG CVIAL  G+
Sbjct: 247 LTELSLSLPILDDLTEAARSA-GALGAKLTGGGLGGCVIALVTGE 290


>gi|146414678|ref|XP_001483309.1| hypothetical protein PGUG_04038 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 423

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 108/244 (44%), Gaps = 38/244 (15%)

Query: 102 GLGSSAAITVAITAALLTLQYH-KEP-----------SPDEILTTAHAIVLK--VQGISS 147
           GLGSSA+  V +T+ L  L  H + P           +PD     + +++ +    G  S
Sbjct: 142 GLGSSASAAVCLTSTLALLGGHIRSPQYSEKQRVSSENPDAEFIDSWSLMGEKCFHGNPS 201

Query: 148 GIDLAASIHGGLICYQ------MPKYSIEKIDFIFPIHLIYSGYKTP--TAQVLKKISYI 199
           GID A + HGG + YQ      MP       +F  P+ L+ +  K P  TA+++  ++ +
Sbjct: 202 GIDNAVATHGGAVMYQRMLAPDMPSVRTAMRNFP-PLKLLLTNTKVPRSTAELVGGVAKV 260

Query: 200 EIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG 251
              +P+        ++ +    Y +M      S  +   ++ + L Q +N   GLL  LG
Sbjct: 261 NTRHPKTAGSILDAVSHLATDAYHIM------SHPSFAAEDRESLRQLVNINHGLLVALG 314

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI 311
           VS   L +I   + +   I A+K++G+G G C I L   +++    + V      +G + 
Sbjct: 315 VSHPALEKIK-MIGDTNRIGATKLTGAGGGGCAITLLNDEVSHEVLEKVENEFTQEGFET 373

Query: 312 VPIT 315
              T
Sbjct: 374 FEAT 377


>gi|307352920|ref|YP_003893971.1| mevalonate kinase [Methanoplanus petrolearius DSM 11571]
 gi|307156153|gb|ADN35533.1| mevalonate kinase [Methanoplanus petrolearius DSM 11571]
          Length = 299

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 133/283 (46%), Gaps = 40/283 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN-IDSSLGQYCGSLDLAMF 69
           SAPG + L GEH V++G   +  AI  RV   +T+RK R  + I+S   + C        
Sbjct: 5   SAPGKVFLFGEHAVVYGKPGIAMAIKPRV--SVTVRKVRNPSKINSPYIENC-------- 54

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                F +  +          + + SQL S  GLGSSAA+TVA  +A +  +++      
Sbjct: 55  -----FELTGVTG-------SVYIHSQLPSSSGLGSSAAVTVATLSA-INDEFNLSLEKK 101

Query: 130 EILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSI---EKIDFIFPIHLIYSGY 185
           +I   A+ +  KVQ G +S  D   S +GGLI  +  K  I   E  + +    L+    
Sbjct: 102 DIADIAYQVEKKVQRGRASPTDTFVSTYGGLILIKDNKRRILPPENFNIVIGNTLV---- 157

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-KNLKVLAQAMNRQQ 244
              T+++++ +       P +      +  ++  +  ++ +++ N  NLKVL + M+   
Sbjct: 158 SHKTSELVEMVGEFRRTNPLV------VDPILNAIEAVTIRSMHNFNNLKVLGRYMDVNH 211

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            LLE LGV    L+ +V   R       +K++G+G G C+IAL
Sbjct: 212 SLLEALGVGHPALTRLVNAARSG-GAYGAKMTGAGGGGCMIAL 253


>gi|262281875|ref|ZP_06059644.1| mevalonate kinase [Streptococcus sp. 2_1_36FAA]
 gi|262262329|gb|EEY81026.1| mevalonate kinase [Streptococcus sp. 2_1_36FAA]
          Length = 292

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 129/287 (44%), Gaps = 42/287 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N   +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNHIEVTCRVFSSERPWALYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
                   + H+     K SC    +V S +  + G+GSSAA+++A   A+    Y +E 
Sbjct: 63  ------ACLEHLGQQGAKISC----QVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEE 110

Query: 127 SPD---EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
             D   EIL     ++  +    SG+D    +    I + +  +   +I+      L+  
Sbjct: 111 LDDQTLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLLIA 167

Query: 183 -SGYKTPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G    T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM
Sbjct: 168 DTGIHGHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAM 219

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +    L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 220 TKAHEKLARLGVSCQKADELVETALENG-ALGAKMSGGGLGGCVIAL 265


>gi|42523133|ref|NP_968513.1| hypothetical protein Bd1630 [Bdellovibrio bacteriovorus HD100]
 gi|39575338|emb|CAE79506.1| mvk [Bdellovibrio bacteriovorus HD100]
          Length = 295

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 138/297 (46%), Gaps = 21/297 (7%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G  ++ GEH VL G  A+VF I  R +     R ++ + +   +G +   L L ++    
Sbjct: 11  GKCIIAGEHAVLRGVPAVVFPIQSRNLDLSYSRGEQPLEL-RLVGDHGKELQLLVWG--- 66

Query: 74  SFIIMAINHIKPSCGFDLKVISQLDSQL----GLGSSAAITVAITAALLTLQYHKEPSPD 129
             ++     +K     DLK    L+S +    G+G+SAA+ VA+T  L  L Y  E   +
Sbjct: 67  --VLEKACELKGIKRSDLKGTLLLESSIPVGAGMGASAALCVALTRWLGYLGYVVE---E 121

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHG-GLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           +    A  +     G SSG+D+A ++ G GL   +  +       +    ++ YSG +  
Sbjct: 122 DYYEFARNLENLFHGESSGVDIAVALSGEGLRFVRNGEKKPLTPAWKPHWYISYSGKRGV 181

Query: 189 TAQVLKKISYIEIEYPEINE-INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           T   + K+  + ++ P + E I+Q++   +G L + + +      L VLA+A+       
Sbjct: 182 TVDAVNKVKDLLLKNPTVGEKIDQQMAEAVGIL-ETALKMDEKTGLPVLAKALTLAGDCF 240

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
           E   +++ + ++ +  L+EQ   +A K +GSG G  V++L      SLP   +   +
Sbjct: 241 EKWDLNEGEPAKHIAWLKEQ-GALAVKPTGSGGGGYVLSL----WTSLPPAEIQSQL 292


>gi|162447657|ref|YP_001620789.1| phosphomevalonate kinase [Acholeplasma laidlawii PG-8A]
 gi|161985764|gb|ABX81413.1| phosphomevalonate kinase [Acholeplasma laidlawii PG-8A]
          Length = 346

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 90/174 (51%), Gaps = 23/174 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-- 64
           I +  PG L ++GE+ V+  G+ A++ A++K   +++ +++D      S +G +   L  
Sbjct: 2   ISLKIPGKLFIIGEYSVIKPGNEAVIVAVDK--FIHVRVKEDSDYQFSSEMGHFRWMLSD 59

Query: 65  DLAMF------HPSFSFII----MAINHIKPSCGFDLKVISQLDSQ----LGLGSSAAIT 110
            L +F      H   +  I    M   HI P   + +++ S+L S+     GLGSS A+ 
Sbjct: 60  QLPVFVYDTLTHAKAAVYIAHKYMKYKHITPKS-YSIQLFSELTSKDNIKYGLGSSGAVI 118

Query: 111 VAITAALLTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           VA+   +L   +H  E S  ++   +    +++  I+SG +LAASI+GG + YQ
Sbjct: 119 VAVIKGIL--NFHGIEISKLDLFKLSVLAQIEISDITSGGELAASIYGGWVFYQ 170


>gi|313890619|ref|ZP_07824247.1| mevalonate kinase [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121136|gb|EFR44247.1| mevalonate kinase [Streptococcus pseudoporcinus SPIN 20026]
          Length = 292

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 131/283 (46%), Gaps = 32/283 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G  A+   +    +  L       +  D     +  +L  A++  
Sbjct: 10  AHSKIILMGEHSVVYGFPAIALPLKDIEVTCLIQEAKEKLQFD-----FYDTLSTAIY-S 63

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           +  F+ +     KP      ++ISQ+  + G+GSSAA+++A   A+    Y  +P  D +
Sbjct: 64  ALDFLQI---KDKP---ISYEIISQVPQKRGMGSSAAVSIAAIRAV--FDYFDQPINDAL 115

Query: 132 LTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
           L     +V K + I+    SG+D    +    I + +     E +      +L+   +G 
Sbjct: 116 L---EVLVNKAEIIAHTNPSGLDAKTCLSDHAITF-IRNVGFESLTINLDAYLVIADTGI 171

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + + K++  E       E N      +G+L++   +A+ +K+ + + +AM +   
Sbjct: 172 HGHTREAVDKVAKFE-------ESNLPHLTCLGQLTEEVYRAIISKDREAMGRAMTQAHQ 224

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
            L+ +GVS  + S+++ +       + +K+SG GLG C+IAL 
Sbjct: 225 ELKAIGVSIEQ-SDLLVQEALAHQALGAKMSGGGLGGCIIALA 266


>gi|257877199|ref|ZP_05656852.1| phosphomevalonate kinase [Enterococcus casseliflavus EC20]
 gi|257811365|gb|EEV40185.1| phosphomevalonate kinase [Enterococcus casseliflavus EC20]
          Length = 360

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT-LRKDRLI------NIDSSLGQ 59
           I +S PG L + GE+ V+  GH A++ A+++ + + +   RK+  I      ++     +
Sbjct: 2   IELSVPGKLFIAGEYAVVEPGHPAIIVAVDQFITVTVEEARKNGSIQSAQYSDLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIK--------PSCGFDLKVISQLDS----QLGLGSSA 107
             G L L      F +I+ AI   +        P   +DLKV S+LD+    + GLGSS 
Sbjct: 62  RKGELVLDHRDNPFHYILAAIRLTEKYAQEKGIPLSFYDLKVTSELDNSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   A L L Y  +         A    L VQG  S  D+AAS +GG I +
Sbjct: 122 AVTVATVKA-LNLYYQMDMDRLTQFKIAALAHLAVQGNGSCGDIAASCYGGWIAF 175


>gi|310643493|ref|YP_003948251.1| galactokinase [Paenibacillus polymyxa SC2]
 gi|309248443|gb|ADO58010.1| Galactokinase [Paenibacillus polymyxa SC2]
          Length = 399

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 136/325 (41%), Gaps = 50/325 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G   L  A+     L L  R D  I+  S+   Y  S+       
Sbjct: 33  APGRVNLIGEHIDYNGGYVLPAALEFGTTLILRARNDDQIHFASTNLSYEVSIPRGEIGK 92

Query: 65  ---DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
              D  + +P    + +A   + PS G+DL    ++ +  GL SSA+I V    A LT +
Sbjct: 93  SKTDEWVDYPVGVLVELAEKGVYPSSGYDLLYHGEIPNGAGLSSSASIEVVTGYAFLTTE 152

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LIC---------YQMP 165
             K  + +  L +  A    V G++ GI D  A  +G       L+C         ++  
Sbjct: 153 KQKTDTVEIALLSQRAENNYV-GVNCGIMDQFAVANGAANHAILLMCDTLEYRKVPFRTG 211

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS-QIS 224
            Y +   +      L+ S Y    +Q  + +S ++ + P +  + Q   A  G L   I+
Sbjct: 212 AYKLVIGNTNKRRGLVDSAYNERRSQCAEALSILQQQEPSLEYLAQLDEARFGGLQHHIA 271

Query: 225 CQALRNK-------NLKVLA--------------QAMNRQQGLLETL-GVSDSKLSEIVW 262
            + +R +       N +VLA              Q MN     L  L  VS ++L  +V 
Sbjct: 272 DETVRRRAQHVVEENARVLASVEALAANELAAFGQLMNASHDSLRDLYEVSCTELDVMVE 331

Query: 263 KLREQPHIMASKISGSGLGDCVIAL 287
           + R  P  + ++++G+G G C ++L
Sbjct: 332 EARRIPGTLGARMTGAGFGGCTVSL 356


>gi|260101296|ref|ZP_05751533.1| phosphomevalonate kinase [Lactobacillus helveticus DSM 20075]
 gi|260084881|gb|EEW69001.1| phosphomevalonate kinase [Lactobacillus helveticus DSM 20075]
          Length = 387

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 144/338 (42%), Gaps = 58/338 (17%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+ V + +T       L   +  + DS    
Sbjct: 29  ITEKAPGKLYIAGEYAVLEQNCPAVLVAVNQFVRVSITKSNTSTGLIHSKQYSQDSIHWV 88

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI++ +  C         +DL V S LDS    + GLGSS
Sbjct: 89  RQGSKMVIDNRDNPFEYILSAISYTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 148

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-- 163
           AA+TVA   A+L   ++     +E++    AI    VQG  S  D+AAS++GG + YQ  
Sbjct: 149 AAVTVATVKAIL--HFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTF 206

Query: 164 ---MPKYSIE---------------KIDFIFPIH--LIYSGYKTPTAQVLKKISYIEIEY 203
                +Y +                KI+ + P H   +  G+    A   + +       
Sbjct: 207 DKKWLQYELANKTLSDVVNEAWPGLKIELLTPPHDMKLMIGWSQKPASTSRLVDETNANK 266

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWK 263
             +N   +   A   +           KN+ ++ + +   + LL+      +K+++I  +
Sbjct: 267 AALNTEYKNFLAASSECVLKMIVGFEAKNIALIKKQIRVNRHLLQHF----AKINQIAIE 322

Query: 264 LREQPHIM--------ASKISGSGLGDCVIALGKGDLN 293
           +     ++        A+K SG+G GDC I +   D +
Sbjct: 323 IPRLTQLIKIAEDFGGAAKTSGAGNGDCGIVITDADTD 360


>gi|16802060|ref|NP_463545.1| hypothetical protein lmo0012 [Listeria monocytogenes EGD-e]
 gi|258611418|ref|ZP_05711502.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258612253|ref|ZP_05711814.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293596647|ref|ZP_06684297.1| phosphomevalonate kinase [Listeria monocytogenes J2818]
 gi|16409371|emb|CAC98227.1| lmo0012 [Listeria monocytogenes EGD-e]
 gi|258599814|gb|EEW13139.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|258610106|gb|EEW22714.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|293591125|gb|EFF99459.1| phosphomevalonate kinase [Listeria monocytogenes J2818]
          Length = 359

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 18/178 (10%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSS 56
           M Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ 
Sbjct: 1   MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENP 60

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLG 104
           +    G  +L      ++F   AIN       S G +L         ++I Q  ++ GLG
Sbjct: 61  VSWPVGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMIIETELIDQSGAKYGLG 119

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SSAA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 120 SSAAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 176


>gi|312875550|ref|ZP_07735551.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2053A-b]
 gi|325912583|ref|ZP_08174966.1| phosphomevalonate kinase [Lactobacillus iners UPII 60-B]
 gi|311088804|gb|EFQ47247.1| phosphomevalonate kinase [Lactobacillus iners LEAF 2053A-b]
 gi|325478004|gb|EGC81133.1| phosphomevalonate kinase [Lactobacillus iners UPII 60-B]
          Length = 357

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 82/185 (44%), Gaps = 38/185 (20%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVI----------------------LYLT 44
           I   APG L + GE+ VL  H  A++ A+N+ V                       +Y +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQHCPAILVALNEFVTVSINKSHGSTGVIHSKQYSQNCIYWS 61

Query: 45  LRKDRLI--NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS--- 99
            R +++I  N D+       ++     +     I +AI        +DL + S+LDS   
Sbjct: 62  RRGNKMIINNRDNPFEYILSAIKFTEMYCLEKGITLAI--------YDLHINSELDSPDG 113

Query: 100 -QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG 158
            + GLGSSAA+TVA   A+L   Y  E     I   +      VQG  S  D+AAS++GG
Sbjct: 114 KKFGLGSSAAVTVATVKAILHF-YGIELDKSLIFKLSAIAHYTVQGNGSAGDIAASVYGG 172

Query: 159 LICYQ 163
            + YQ
Sbjct: 173 WLAYQ 177


>gi|73663431|ref|YP_302212.1| mevalonate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72495946|dbj|BAE19267.1| mevalonate kinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 307

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 111/255 (43%), Gaps = 13/255 (5%)

Query: 11  SAPGSLVLMGEHGVLHGHAALV--FAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
            A G ++L+GEH V  G  A+   F   K      +L       I S +  Y G L  A 
Sbjct: 8   EANGKVILIGEHAVTFGEPAIAIPFTTGKVKAKIESLETTNASYIKSDV--YDGELQKAP 65

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            H   + I   I   K +    + + + L    GLGSSAA+ VA   A  +  Y  EP  
Sbjct: 66  EHLK-AVITRFIEKYKIATPIKVSIDTNLPPSRGLGSSAAMAVAFVRA--SFDYLDEPLS 122

Query: 129 DEILTTAHAIVLKV-QGISSGIDLAASIHGGLICYQMPKY-SIEKIDFIFPIHLIYSGYK 186
           DE+L        ++  G  SGID    +    + ++  K  +++ +D    + +I +G +
Sbjct: 123 DEMLIEEANWAERIAHGKPSGIDTQTIVSNKPVWFKQGKVTTLKPLDLNGYMVVIDTGVR 182

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T Q ++ +  +     E +    +    +GKL   + +++ + N + LA+  N  Q  
Sbjct: 183 GSTKQAVEDVHQL----CEGDSTYLQYVEHIGKLVHEASESIEHHNFEQLAKVFNLCQKN 238

Query: 247 LETLGVSDSKLSEIV 261
           L TL VS  K+ EI+
Sbjct: 239 LRTLTVSHDKIEEIL 253


>gi|257867120|ref|ZP_05646773.1| phosphomevalonate kinase [Enterococcus casseliflavus EC30]
 gi|257873455|ref|ZP_05653108.1| phosphomevalonate kinase [Enterococcus casseliflavus EC10]
 gi|257801176|gb|EEV30106.1| phosphomevalonate kinase [Enterococcus casseliflavus EC30]
 gi|257807619|gb|EEV36441.1| phosphomevalonate kinase [Enterococcus casseliflavus EC10]
          Length = 360

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT-LRKDRLI------NIDSSLGQ 59
           I +S PG L + GE+ V+  GH A++ A+++ + + +   RK+  I      ++     +
Sbjct: 2   IELSVPGKLFIAGEYAVVEPGHPAIIVAVDQFITVTVEEARKNGSIQSAQYSDLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIK--------PSCGFDLKVISQLDS----QLGLGSSA 107
             G L L      F +I+ AI   +        P   +DLKV S+LD+    + GLGSS 
Sbjct: 62  RKGELVLDHRDNPFHYILAAIRLTEKYAQEKGIPLSFYDLKVTSELDNSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   A L L Y  +         A    L VQG  S  D+AAS +GG I +
Sbjct: 122 AVTVATVKA-LNLYYQMDMDRLTQFKIAALAHLAVQGNGSCGDIAASCYGGWIAF 175


>gi|323466407|gb|ADX70094.1| GMP synthase, mevalonate kinase [Lactobacillus helveticus H10]
          Length = 302

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 139/287 (48%), Gaps = 18/287 (6%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-LD 65
           K    A G ++++GEH V++G+ AL   I K + +  T+  +  + +D++  +Y GS  D
Sbjct: 2   KTSFLAHGKVIIIGEHSVVYGYDALAMPI-KALHIKTTVENNPEMWMDTA--RYHGSFFD 58

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKV--ISQLDSQLGLGSSAAITVAITAALLTLQYH 123
               +    +++  +   K +    LK+    ++  + G GSSA + +  T AL    + 
Sbjct: 59  TPSEYDGLKYVVKTMQK-KANNNEPLKITYTGEIPMERGFGSSATVALGTTKALNQF-FS 116

Query: 124 KEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIFPIHL 180
              S  EI+  T HA ++   G +SG+D AA+++   + +   K    + +      + +
Sbjct: 117 LNMSESEIMAVTNHAEMIN-HGKASGLD-AATVNSDYLVFFNKKMGPKVLQAKLGATLFI 174

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           + +G    T + + ++S + +   E  + N K    +G+L+ ++ +A  N ++K +    
Sbjct: 175 MDTGELGNTKKAVAQVSQL-LSESEQAKANMK---RLGELADLTKKAWINHDVKTVGNIF 230

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           N  Q +L +  +S +K+ ++  K+      +  K+SG GLG   IAL
Sbjct: 231 NEAQKILHSFNISTTKIDQLQ-KIALDNGALGFKLSGGGLGGITIAL 276


>gi|313885715|ref|ZP_07819464.1| mevalonate kinase [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619080|gb|EFR30520.1| mevalonate kinase [Eremococcus coleocola ACS-139-V-Col8]
          Length = 328

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 134/296 (45%), Gaps = 38/296 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN--IDSSLGQYCGSLDLAMF 69
           A   ++LMGEH V++ + A+       V + + ++ +++    I SS+  Y G L     
Sbjct: 24  AHSKIILMGEHAVVYDYPAIAIPFTS-VQVRVKVQANQIGRDFIQSSI--YTGPL--TTV 78

Query: 70  HPSFSFIIMAINHIKPSCGFD-----LKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
                 I   +N  + S  FD     +K+ S + +  G+GSSAA++VA+  A+    Y  
Sbjct: 79  PKQMENIQALVNLTRDSFQFDRKALLIKIDSDIPAGRGMGSSAAVSVALVRAI--CDYFN 136

Query: 125 EPSPDEILTTAHAIVLKVQGI----SSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH- 179
               D  L   H +V + + I    +SG+D   +     + Y+  +       F FP+  
Sbjct: 137 YSISDYQL---HLLVNQAEAIAHESTSGLDTLITASDKPVIYRKSQKP-----FNFPLDL 188

Query: 180 -----LIYSGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNL 233
                L  SG +  T Q + ++  ++++  E + E+ + I    G   + +  A+++KN 
Sbjct: 189 NAYLVLADSGMEGRTQQAVSRVLQLKLQQKEFVAELMESI----GNFVEQAYTAIQDKNP 244

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
             L + M      L  LGVS+ +L  I+         + +K++G G+G CVI L +
Sbjct: 245 AELGRLMTYNHYYLNQLGVSNERLDRII-NASWMAGALGAKLTGGGMGGCVITLAE 299


>gi|187918544|ref|YP_001884107.1| mevalonate kinase [Borrelia hermsii DAH]
 gi|119861392|gb|AAX17187.1| mevalonate kinase [Borrelia hermsii DAH]
          Length = 297

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 138/310 (44%), Gaps = 31/310 (10%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +  P  ++ +GEH  ++G       I   + LY+      L+   S+  +Y G   L + 
Sbjct: 4   IKKPSKILFLGEHSAVYGFPV----IGATIPLYM-----HLVYTFSASWRYLGVPFLKI- 53

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                FI    N ++P    +  + SQ+   LG GSSA++++     +++   H E S  
Sbjct: 54  DEVIHFINKRFNKVRP---IEFLIFSQIPVGLGFGSSASLSLCFAEYIVS---HDEYSTY 107

Query: 130 EILTTAHAIVLKVQGISSGID-LAASIHGGLICYQ----MPKYSIEKIDFIFPIHLIYSG 184
           + +  A  I     G SSG+D L   + G          +    I   +F F I  +   
Sbjct: 108 DKILLAREIENIFHGRSSGMDVLLVELDGTFYLESRNGALSYLRISFCNFYFLIGAVRR- 166

Query: 185 YKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
            +  T +++  +SY I ++  +  EI +K    +G +++ S  A   +++ +LA  MN  
Sbjct: 167 -ECATNEIISDLSYRISLDNDQF-EIIKK----LGWIARDSYVAFEKRDIALLANNMNVA 220

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG-DLNSLPYQSVNC 302
              L +LG+S   L  ++ + R +   +A K+SG+G G   I L +  +  SL  + +N 
Sbjct: 221 NNCLNSLGLSSGVLDYVIERGR-KFKALAGKLSGAGRGGAFILLFQNKNEASLCLEELNK 279

Query: 303 HMHAKGIDIV 312
            +    ID++
Sbjct: 280 DLDKNNIDLI 289


>gi|312277963|gb|ADQ62620.1| Mevalonate kinase [Streptococcus thermophilus ND03]
          Length = 292

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 133/279 (47%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAAETPLTLKAQDP 56

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S + 
Sbjct: 57  LTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELSQET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       E+I+     +L+   +G    
Sbjct: 116 LEMLVHQAETIAHSKPSGLDAKTCLSDHAISF-TRNIGFEEIEVNLGAYLVIADTGIHGN 174

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+    ++   ++++NQ     +G+LSQ + +AL+ K+ K+L Q M++    L+
Sbjct: 175 TREAVEKVEANGLDA--LSDLNQ-----LGELSQKAERALKAKDQKLLGQLMSQAHNHLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 228 SLGVS-CDLSDLLVATALEHGALGAKMSGGGLGGCIIAL 265


>gi|116627443|ref|YP_820062.1| mevalonate kinase [Streptococcus thermophilus LMD-9]
 gi|116100720|gb|ABJ65866.1| mevalonate kinase [Streptococcus thermophilus LMD-9]
          Length = 286

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 133/279 (47%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 4   AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAAETPLTLKAQDP 50

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S + 
Sbjct: 51  LTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELSQET 109

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       E+I+     +L+   +G    
Sbjct: 110 LEMLVHQAETIAHSKPSGLDAKTCLSDHAISF-TRNIGFEEIEVNLGAYLVIADTGIHGN 168

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+    ++   ++++NQ     +G+LSQ + +AL+ K+ K+L Q M++    L+
Sbjct: 169 TREAVEKVEANGLDA--LSDLNQ-----LGELSQKAERALKAKDQKLLGQLMSQAHNHLK 221

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 222 SLGVS-CDLSDLLVATALEHGALGAKMSGGGLGGCIIAL 259


>gi|300361740|ref|ZP_07057917.1| phosphomevalonate kinase [Lactobacillus gasseri JV-V03]
 gi|300354359|gb|EFJ70230.1| phosphomevalonate kinase [Lactobacillus gasseri JV-V03]
          Length = 367

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 88/345 (25%), Positives = 147/345 (42%), Gaps = 66/345 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 12  ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 71

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 72  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 126

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 127 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 185

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 186 YQTFDKAWLKQELATKSLSDVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 245

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
           +    +I+ +Y    E +++    M K       AL  K +++  Q + +    L  + +
Sbjct: 246 NAKKKFIKTQYDTFLEQSRQCVLDMIKGFNEKNIALIQKQIRLNRQLL-KDFAALNHIAI 304

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
              +L++++  + EQ +  A+K SG+G GDC  VIA  + D+  +
Sbjct: 305 EIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEQTDIEEM 347


>gi|227892525|ref|ZP_04010330.1| phosphomevalonate kinase [Lactobacillus ultunensis DSM 16047]
 gi|227865646|gb|EEJ73067.1| phosphomevalonate kinase [Lactobacillus ultunensis DSM 16047]
          Length = 360

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 87/178 (48%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+N+ V + +T  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAVLVAVNQFVRVSITKSKTSTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RQGSKMVIDNRDNPFEYILSAISFTEQYCLEQNIKMKVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   ++     +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAIL--HFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|328958133|ref|YP_004375519.1| phosphomevalonate kinase [Carnobacterium sp. 17-4]
 gi|328674457|gb|AEB30503.1| phosphomevalonate kinase [Carnobacterium sp. 17-4]
          Length = 358

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/339 (27%), Positives = 146/339 (43%), Gaps = 73/339 (21%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I  SAPG L + GE+ V+  GH A++ A+++ + + L  + +R+ +I S   QY      
Sbjct: 2   IEASAPGKLYIAGEYAVVEPGHPAILVAVDQFITVSLE-QSERVGSITSF--QYGNLPIL 58

Query: 63  ------SLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLG 104
                  L L      F +I+ AI           K    + L V S+LDS    + GLG
Sbjct: 59  WKRENDRLVLDKRENPFHYILAAIRLTEEYAKEQGKELSFYHLTVDSELDSSQGKKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM 164
           SSAA+TVA   AL    Y  E S + I   A    L V+   S  D+AAS++GG + +  
Sbjct: 119 SSAAVTVATVQALCRF-YGIEDSKNVIFKLAALAHLSVKSNGSCGDVAASVYGGWLAFTT 177

Query: 165 --PKYSIEK---------IDFIFPIHLIYSGYKTP-------------------TAQVLK 194
             P++ +E+         I+  +P HL ++    P                     +V  
Sbjct: 178 FDPEWVLEQKEHSTVKELIEMKWP-HLSFTPLTPPKDLRLVIGWTGSPASTSHLVDEVTN 236

Query: 195 KISYIEIEYPEINE-----INQKIYALMGK-LSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           K S   I Y    +     +N  I+A   + +++I  Q  +N+ L  L Q        +E
Sbjct: 237 KRSQDAIAYDTFLKESKHCVNAMIHAFQERNVTEIQRQIRKNRQL--LLQMSQDTSVTIE 294

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           T  +  +KL  +  + +      A+K SG+G GDC I +
Sbjct: 295 TPAL--TKLCAMAEEFK-----GAAKSSGAGGGDCGIVI 326


>gi|332363139|gb|EGJ40924.1| mevalonate kinase [Streptococcus sanguinis SK49]
          Length = 292

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 126/281 (44%), Gaps = 30/281 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N+  +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNRIEVTCQVFPSERAWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVA-ITAALLTLQYHKEPSPD 129
                   + H+ +       +V S +  + G+GSSAA+++A I A     +   +    
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVFDYFEEELDGQTL 116

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKT 187
           EIL     ++  +    SG+D    +    I + +  +   +I+      L+   +G   
Sbjct: 117 EILANRAEMIAHMN--PSGLDAKTCLSDVAIKF-IRNFGFSEIELDLDAFLVIADTGIHG 173

Query: 188 PTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
            T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +    
Sbjct: 174 HTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAHEK 225

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 226 LAKLGVSCQKADELVSAALENG-ALGAKMSGGGLGGCVIAL 265


>gi|226222651|ref|YP_002756758.1| mevalonate kinase [Listeria monocytogenes Clip81459]
 gi|293596253|ref|ZP_06684160.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|293596796|ref|ZP_06684342.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|300763375|ref|ZP_07073373.1| phosphomevalonate kinase [Listeria monocytogenes FSL N1-017]
 gi|225875113|emb|CAS03801.1| Putative mevalonate kinase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|293582402|gb|EFF94434.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293594006|gb|EFG01767.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|300515652|gb|EFK42701.1| phosphomevalonate kinase [Listeria monocytogenes FSL N1-017]
          Length = 359

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 18/178 (10%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSS 56
           M Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ 
Sbjct: 1   MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENP 60

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLG 104
           +    G  +L      ++F   AIN       S G +L         ++I Q  ++ GLG
Sbjct: 61  VSWPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLG 119

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SSAA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 120 SSAAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 176


>gi|332261280|ref|XP_003279702.1| PREDICTED: LOW QUALITY PROTEIN: mevalonate kinase-like [Nomascus
           leucogenys]
          Length = 398

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 91/368 (24%), Positives = 149/368 (40%), Gaps = 74/368 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  A+N R  L L    +                   RL
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 67

Query: 51  INIDSS------------------LGQYCGSLDLAMFHPSFSFIIMAINHIKPSC----- 87
            ++D+S                  + +  G  D      +++ +       +P C     
Sbjct: 68  QSLDTSFLDQGECPHTPPSEQVEKVREVAGLPDDCAVTTAWAGLAFLYLIPRPFCRKQRA 127

Query: 88  --GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTT 134
               D+ V S+L    GLGSSAA +V++ AALLT+   + P+P            E L  
Sbjct: 128 LPSLDIVVWSELPPGAGLGSSAAYSVSLAAALLTV-CEEIPNPLKDGDCVNRWTKEDLEL 186

Query: 135 AHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
            +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     T 
Sbjct: 187 INKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRPPALQILLTNTKVPRNTR 246

Query: 191 QVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + ++ 
Sbjct: 247 ALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELIDM 302

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC 302
            Q  L  LGV  + L ++    R   H + SK++G+G G C I L K  L     ++   
Sbjct: 303 NQHHLNALGVGHASLDQLCQVTRA--HGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQ 360

Query: 303 HMHAKGID 310
            + + G D
Sbjct: 361 ALTSCGFD 368


>gi|295424861|ref|ZP_06817576.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065427|gb|EFG56320.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
          Length = 360

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRK-------DRLINIDSSLGQ 59
           I   APG L + GE+ VL     AL+ A+N+ V + ++  K        +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPALLVAVNQFVRVSISKSKTGTGLIHSKQYSQDSIHWI 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RQGSRMVIDNRDNPFEYILSAISFTERYCLEQNIKMNVYDLHVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AAITVA   A+L  +++     +E++    AI    VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAITVATVKAIL--RFYGVKLNNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|290892050|ref|ZP_06555047.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290558644|gb|EFD92161.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 359

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 18/178 (10%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSS 56
           M Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ 
Sbjct: 1   MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENP 60

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLG 104
           +    G  +L      ++F   AIN       S G +L         ++I Q  ++ GLG
Sbjct: 61  VSWPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLG 119

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SSAA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 120 SSAAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 176


>gi|256617772|ref|ZP_05474618.1| mevalonate kinase [Enterococcus faecalis ATCC 4200]
 gi|257089314|ref|ZP_05583675.1| mevalonate kinase [Enterococcus faecalis CH188]
 gi|312904463|ref|ZP_07763622.1| mevalonate kinase [Enterococcus faecalis TX0635]
 gi|256597299|gb|EEU16475.1| mevalonate kinase [Enterococcus faecalis ATCC 4200]
 gi|256998126|gb|EEU84646.1| mevalonate kinase [Enterococcus faecalis CH188]
 gi|310632161|gb|EFQ15444.1| mevalonate kinase [Enterococcus faecalis TX0635]
 gi|315577314|gb|EFU89505.1| mevalonate kinase [Enterococcus faecalis TX0630]
          Length = 314

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + GSL D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGSLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQNDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|261405465|ref|YP_003241706.1| galactokinase [Paenibacillus sp. Y412MC10]
 gi|261281928|gb|ACX63899.1| galactokinase [Paenibacillus sp. Y412MC10]
          Length = 392

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 140/338 (41%), Gaps = 55/338 (16%)

Query: 2   GQCLHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----- 55
           G+  HK+ + +APG + L+GEH   +G   L  A+     L +  R D  ++  S     
Sbjct: 15  GESQHKVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDNKVSFSSTNIPY 74

Query: 56  ----SLGQ-YCGSLDLAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAA 108
               SL + Y   +D    +P    +I  +N I    S G+DL     + +  GL SSA+
Sbjct: 75  ELTISLDEDYGYKIDQWTDYPVG--VITELNKIGCGLSSGYDLLYHGDIPNGAGLSSSAS 132

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------- 158
           I V    A L ++  KE    EI   +  +     G++SGI    ++  G          
Sbjct: 133 IEVVTAYAFLKME-GKETDTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMC 191

Query: 159 ------LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEIN---EI 209
                 L+ ++   Y I   +      L+ S Y    ++  + +  ++ E P ++   ++
Sbjct: 192 DTLEYELVPFRTGAYKIVISNTNKRRGLVDSKYNERRSECDRALEILQKELPALSYLAQL 251

Query: 210 NQKIYALMGKLSQ-------------------ISCQALRNKNLKVLAQAMNRQQGLLETL 250
           N   +A +    Q                    S +AL+  NL+V  Q MN+    L  L
Sbjct: 252 NPDQFATLRDSIQDETVRRRAQHVVEENQRVLDSVKALKEGNLEVFGQYMNQSHDSLRYL 311

Query: 251 -GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             V+  +L  +V + +  P  + S+++G+G G C ++L
Sbjct: 312 YEVTGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSL 349


>gi|227524492|ref|ZP_03954541.1| possible mevalonate kinase [Lactobacillus hilgardii ATCC 8290]
 gi|227088362|gb|EEI23674.1| possible mevalonate kinase [Lactobacillus hilgardii ATCC 8290]
          Length = 325

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 99/205 (48%), Gaps = 15/205 (7%)

Query: 89  FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG 148
           F L++ S++ S+ G+GSSAA  VAI      L +    + D +L  A        G  SG
Sbjct: 87  FHLEIDSKIPSERGMGSSAATAVAIVRVFFNL-FEAPLTRDRLLELAEVEEKITHGNPSG 145

Query: 149 IDLAASIHGGLICYQMPKYSIEKIDFIF---PIHLIYSGYKTPTAQVLKKISYIEIEYPE 205
           +D A +     + +   + + E+IDF      + +  SG K  T + +  +    ++ PE
Sbjct: 146 LDTATASSDTPVWFIRNEIN-EQIDFNLSKSSLVIADSGIKGKTGEAVSMVHDNLLDQPE 204

Query: 206 INEINQKIYALMGKLSQISCQ---ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVW 262
             +       L+ +L+QI+     AL+  + + L + M + Q  L  LGVS  KL     
Sbjct: 205 FAK------PLIEQLAQIAKDARHALQISDEQRLGRLMTQSQYNLSKLGVSTRKLDNFC- 257

Query: 263 KLREQPHIMASKISGSGLGDCVIAL 287
           ++  Q   + +K++GSGLG C+I++
Sbjct: 258 RIAIQNGALGAKLTGSGLGGCMISI 282


>gi|300361738|ref|ZP_07057915.1| mevalonate kinase [Lactobacillus gasseri JV-V03]
 gi|300354357|gb|EFJ70228.1| mevalonate kinase [Lactobacillus gasseri JV-V03]
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 135/304 (44%), Gaps = 51/304 (16%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--L 64
           K+ + A G ++L+GEH V++G+ AL   I             + +NI +++ +  G   +
Sbjct: 4   KVEIKAHGKVILIGEHSVVYGYNALALPI-------------QALNISTTVEKTAGPTWM 50

Query: 65  DLAMFHPSF----------SFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
           D   +H +F           +I+   +  +  +    +    ++  + GLGSSA + +  
Sbjct: 51  DTNHYHGAFFDAPDEYDGIKYIVKTMLAKVADAPNVKITYSGEIPIERGLGSSAVVALGT 110

Query: 114 TAAL-----LTLQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQM--- 164
           T AL     L L +      DEI+  T HA ++   G +SG+D A      L+ +     
Sbjct: 111 TKALSQFLNLNLDH------DEIMKITNHAEMIN-HGKASGLDAATVSSDYLVFFNKQDG 163

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
           P+   +K+     I        T  A Q +KK         + +++ +K  A +G+L+  
Sbjct: 164 PQQLSQKLGATLLIMDTGELGNTKVAVQAVKK-------QMDESDLKKKQIARLGELATA 216

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
           + +    +N K + +  N  Q +L +  +S  K+  I  K+  +   + +K+SG GLG  
Sbjct: 217 TQENWLKQNAKEIGKIFNEAQSILASFDLSTKKIDNIC-KIANENGALGTKLSGGGLGGI 275

Query: 284 VIAL 287
           VIAL
Sbjct: 276 VIAL 279


>gi|298253294|ref|ZP_06977086.1| isopentenyl pyrophosphate isomerase [Gardnerella vaginalis 5-1]
 gi|297532689|gb|EFH71575.1| isopentenyl pyrophosphate isomerase [Gardnerella vaginalis 5-1]
          Length = 779

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 149/374 (39%), Gaps = 104/374 (27%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-------LRKDRLINIDSSLGQYCGS 63
           SAPG L + GE+ V+ G AA+V A+N+ V + ++       LR++   N  SS   YCG 
Sbjct: 7   SAPGKLYIAGEYAVVDGCAAIVAAVNRYVTVSISDETLNEELRENLQKNAPSSR-NYCGV 65

Query: 64  L--DLAMFHP-----------------SFSFIIMAI----NHIKPSCG-------FDLKV 93
           +  D   + P                  +++++ A+     +    C        +++ +
Sbjct: 66  ITSDAEKYKPLLWARTSDGSIEIQNDGKYAYVLAAMCVVDAYASEECAPNINRKSYNVHI 125

Query: 94  ISQLDS-----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG 148
            S+LD      + GLGSSAA+TVA+  AL    Y    S  EI   A      V+   SG
Sbjct: 126 FSELDDVKTGRKYGLGSSAAVTVAVIRALCKW-YGLNLSTPEICKLALIASSSVKKSGSG 184

Query: 149 IDLAASIHGGLICYQ----------------------------MPKYSIEKIDFIFPIHL 180
            D+AAS +GG I Y+                             P+  +++++    + L
Sbjct: 185 GDVAASSYGGWIMYRAYSREWLEAELTLVKSGCSDFGELLYKKWPRLEVKRLNVDKSLKL 244

Query: 181 IYSGYKTPTAQVLKKISYIE--------------IEYPEINEINQKI-YALMGKLSQISC 225
           +  G+    A   K +S +E              +E    +  NQ   Y    K S+I  
Sbjct: 245 LV-GWTGSPASSAKLVSSVESSVKTSAEGSTESSVETSAFDNKNQLFTYEDFCKQSEICV 303

Query: 226 Q----ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA--------S 273
           Q    A+    +  ++    + + LL+ L    S L+  V +  E    +         +
Sbjct: 304 QKLARAIEKFEISEISSGFAQNRALLQKL----SALTGTVIETHELTKFIEIATCAGVPA 359

Query: 274 KISGSGLGDCVIAL 287
           K SG+G GDC IAL
Sbjct: 360 KTSGAGGGDCAIAL 373


>gi|238854240|ref|ZP_04644584.1| mevalonate kinase [Lactobacillus gasseri 202-4]
 gi|282852206|ref|ZP_06261558.1| mevalonate kinase [Lactobacillus gasseri 224-1]
 gi|311110683|ref|ZP_07712080.1| mevalonate kinase [Lactobacillus gasseri MV-22]
 gi|238833051|gb|EEQ25344.1| mevalonate kinase [Lactobacillus gasseri 202-4]
 gi|282556625|gb|EFB62235.1| mevalonate kinase [Lactobacillus gasseri 224-1]
 gi|311065837|gb|EFQ46177.1| mevalonate kinase [Lactobacillus gasseri MV-22]
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 137/305 (44%), Gaps = 53/305 (17%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--L 64
           K+ V A G ++L+GEH V++G+ AL   I             + +NI +++ +  G   +
Sbjct: 4   KVEVKAHGKVILIGEHSVVYGYNALALPI-------------QALNISTTVEETAGPTWM 50

Query: 65  DLAMFHPSFSFI----------IMAINHIKPSCGFDLKVI--SQLDSQLGLGSSAAITVA 112
           D   +H +F F+          I+     K +   D+K+    ++  + GLGSSA + + 
Sbjct: 51  DTNHYHGAF-FVAPDEYDGIKYIVKTMLAKVADAPDVKITYSGEIPIERGLGSSAVVALG 109

Query: 113 ITAAL-----LTLQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQM-- 164
            T AL     L L +      DEI+  T HA ++   G +SG+D A      L+ +    
Sbjct: 110 TTKALSQFLNLNLDH------DEIMEITNHAEMIN-HGKASGLDAATVSSDYLVFFNKQD 162

Query: 165 -PKYSIEKIDFIFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            P+   +K+     I        T  A Q +KK         + +++ +K  A +G+L+ 
Sbjct: 163 GPQQLSQKLGATLLIMDTGELGNTKVAVQAVKK-------QMDESDLKKKQIARLGELAT 215

Query: 223 ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
            + +    +N + + +  N  Q +L +  +S  K+  I  K+      + +K+SG GLG 
Sbjct: 216 ATQENWLKQNAEEIGKIFNEAQSILASFDLSTEKIDNIC-KIANDNGALGTKLSGGGLGG 274

Query: 283 CVIAL 287
            VIAL
Sbjct: 275 IVIAL 279


>gi|116629674|ref|YP_814846.1| mevalonate kinase [Lactobacillus gasseri ATCC 33323]
 gi|116095256|gb|ABJ60408.1| mevalonate kinase [Lactobacillus gasseri ATCC 33323]
          Length = 322

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 137/305 (44%), Gaps = 53/305 (17%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--L 64
           K+ V A G ++L+GEH V++G+ AL   I             + +NI +++ +  G   +
Sbjct: 21  KVEVKAHGKVILIGEHSVVYGYNALALPI-------------QALNISTTVEETAGPTWM 67

Query: 65  DLAMFHPSFSFI----------IMAINHIKPSCGFDLKVI--SQLDSQLGLGSSAAITVA 112
           D   +H +F F+          I+     K +   D+K+    ++  + GLGSSA + + 
Sbjct: 68  DTNHYHGAF-FVAPDEYDGIKYIVKTMLAKVADAPDVKITYSGEIPIERGLGSSAVVALG 126

Query: 113 ITAAL-----LTLQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQM-- 164
            T AL     L L +      DEI+  T HA ++   G +SG+D A      L+ +    
Sbjct: 127 TTKALSQFLNLNLDH------DEIMEITNHAEMIN-HGKASGLDAATVSSDYLVFFNKQD 179

Query: 165 -PKYSIEKIDFIFPIHLIYSGYKTPTA-QVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            P+   +K+     I        T  A Q +KK         + +++ +K  A +G+L+ 
Sbjct: 180 GPQQLSQKLGATLLIMDTGELGNTKVAVQAVKK-------QMDESDLKKKQIARLGELAT 232

Query: 223 ISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
            + +    +N + + +  N  Q +L +  +S  K+  I  K+      + +K+SG GLG 
Sbjct: 233 ATQENWLKQNAEEIGKIFNEAQSILASFDLSTEKIDNIC-KIANDNGALGTKLSGGGLGG 291

Query: 283 CVIAL 287
            VIAL
Sbjct: 292 IVIAL 296


>gi|312901554|ref|ZP_07760827.1| mevalonate kinase [Enterococcus faecalis TX0470]
 gi|311291349|gb|EFQ69905.1| mevalonate kinase [Enterococcus faecalis TX0470]
          Length = 314

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + GSL D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGSLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|326798763|ref|YP_004316582.1| galactokinase [Sphingobacterium sp. 21]
 gi|326549527|gb|ADZ77912.1| Galactokinase [Sphingobacterium sp. 21]
          Length = 394

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 145/354 (40%), Gaps = 57/354 (16%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCGSL 64
           V +PG + L+GEH   +    L  AINK V  YL + K+     RL  ID S   +  ++
Sbjct: 22  VRSPGRVNLIGEHTDYNEGLVLPAAINKNV--YLAIAKNNTDKVRLYAIDLS-DSFETTV 78

Query: 65  D----LAMFHPSFSFII---MAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           D         P +   +   + +N+   + GFD+     +    GL SSAA+  A   AL
Sbjct: 79  DAIKKTDKLWPDYILGVIEQLQLNNYAINEGFDIAFSGDIPQGAGLSSSAALECATAFAL 138

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG---LICYQMPKYSIEKID 173
            TL +    S  +I   + A   +  G++ G+ D  AS+ G    L+      YS E I 
Sbjct: 139 STL-FELHISKLDIALLSQAAENQFVGVNCGLMDQFASVFGKEQHLVKLDCADYSYEYIP 197

Query: 174 F------IFPIH------LIYSGYKTPTAQVLKKISYIEIEYPEINE------------- 208
           F      I  +       L  S Y     Q  + +  I   +P +               
Sbjct: 198 FKTSDIKILLLDTQVKHSLASSAYNERREQCEEGVRLISRHHPSVTSLRHATEEMLLKYV 257

Query: 209 --INQKIY-------ALMGKLSQISCQALRNKNLKVLAQAM-NRQQGLLETLGVSDSKLS 258
             +++ +Y       A + +L Q++C+ L+  + K   Q M    +GL +   VS  +L 
Sbjct: 258 KPVDEIVYRRCSYVVAEIARL-QLACEDLKKDDFKAFGQRMFETHEGLEKQYEVSCKELD 316

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGD-LNSLPYQSVNCHMHAKGIDI 311
            +V  ++   +++ +++ G G G C I L K D    +  Q    +    GI+I
Sbjct: 317 LLVQLVKGNQYVLGARMMGGGFGGCTINLVKADKAEEVAQQVAAAYKEQTGIEI 370


>gi|157150364|ref|YP_001449558.1| mevalonate kinase [Streptococcus gordonii str. Challis substr. CH1]
 gi|157075158|gb|ABV09841.1| mevalonate kinase [Streptococcus gordonii str. Challis substr. CH1]
          Length = 292

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 128/282 (45%), Gaps = 32/282 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++G+ A+   +N   +       +R   + +       +L +A+F  
Sbjct: 10  AHSKIILMGEHSVVYGYPAISLPLNHIEVTCRVFPSERPWTLYAE-----DTLSMAVF-- 62

Query: 72  SFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD- 129
                   + H+ +       +V S +  + G+GSSAA+++A   A+    Y +E   D 
Sbjct: 63  ------ACLEHLGRQGAKIRCQVESMVPEKRGMGSSAAVSIAAIRAVF--DYFEEELDDQ 114

Query: 130 --EILTTAHAIVLKVQGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYK 186
             EIL     ++  +    SG+D    +    I + +   +S  K+D    + +  +G  
Sbjct: 115 TLEILANRAEMIAHMN--PSGLDAKTCLSDVAIKFIRNFGFSEIKLDLDAFLLIADTGIH 172

Query: 187 TPTAQVLKKI-SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
             T + ++ + S  +   P + E        +G L++I  +A+  K+L  + QAM +   
Sbjct: 173 GHTREAIRAVESQGQKALPLLQE--------LGNLTKILEKAISIKDLMTMGQAMTKAHE 224

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            L  LGVS  K  E+V    E    + +K+SG GLG CVIAL
Sbjct: 225 KLARLGVSCQKADELVAVAIENG-ALGAKMSGGGLGGCVIAL 265


>gi|322372483|ref|ZP_08047019.1| mevalonate kinase [Streptococcus sp. C150]
 gi|321277525|gb|EFX54594.1| mevalonate kinase [Streptococcus sp. C150]
          Length = 292

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 133/279 (47%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAADTPLTLKAQDP 56

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S + 
Sbjct: 57  LTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FEQELSRET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       ++I+     +L+   +G    
Sbjct: 116 LEMLVHQAETIAHSKPSGLDAKTCLSDRAISF-TRNIGFKEIEVDLGAYLVIADTGIHGN 174

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+  I ++   ++++NQ     +G+LSQ +  AL+ K+ ++L Q M++    L+
Sbjct: 175 TREAVEKVEAIGLDA--LSDLNQ-----LGELSQRAEGALKAKDQELLGQLMSQAHNHLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 228 SLGVS-CDLSDLLIATALEQGALGAKMSGGGLGGCIIAL 265


>gi|229542020|ref|ZP_04431080.1| phosphomevalonate kinase [Bacillus coagulans 36D1]
 gi|229326440|gb|EEN92115.1| phosphomevalonate kinase [Bacillus coagulans 36D1]
          Length = 366

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 86/187 (45%), Gaps = 25/187 (13%)

Query: 10  VSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINID------SSLGQYCG 62
           V APG L++ GE+ V+  G  A+V A+++ + + +    + L ++       ++     G
Sbjct: 8   VKAPGKLMIAGEYAVIEPGCPAVVAAVDRYITIEVKESTENLFSLPQIGIPHAAWRVENG 67

Query: 63  SLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS-----QLGLGSSAAI 109
            +          FI  A+            P     + V S+LD      + GLGSSAAI
Sbjct: 68  EVRFDHDDSKLRFIQNALAVFYRLLMEKSIPLRPLHITVTSELDDPATGQKYGLGSSAAI 127

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
             A+ AALL        + + I   A    LK QG  SG DLAAS++GG++     KY+ 
Sbjct: 128 LSAVLAALLHAHQGMPDTKEAIFKLAAVAHLKTQGNGSGADLAASVYGGML-----KYAA 182

Query: 170 EKIDFIF 176
            + D+IF
Sbjct: 183 FRPDWIF 189


>gi|309790492|ref|ZP_07685052.1| mevalonate kinase [Oscillochloris trichoides DG6]
 gi|308227479|gb|EFO81147.1| mevalonate kinase [Oscillochloris trichoides DG6]
          Length = 317

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 120/293 (40%), Gaps = 15/293 (5%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL----TLRKDRLINIDSSLGQYCGS 63
           I  SAP  ++L GEH V++   A+   +   V  Y     T     L  +   LG+   S
Sbjct: 2   ITTSAPAKIILCGEHAVVYNRPAIALPLGD-VRAYAEATPTAPGTGLYFVAPDLGETW-S 59

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQL--GLGSSAAITVAITAALLTLQ 121
                 HP        ++H+  +   DL +  + D  +  G+GS AAI  A+  A+    
Sbjct: 60  FSSDPQHPLSELAATVLDHLG-AAAPDLTITLRSDIPIAGGMGSGAAIGAALVRAVAQAL 118

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM-PKYS--IEKIDFIFPI 178
            H  P P E+    +A   +  G  SGID     +   I +Q  P  +  I  I    P+
Sbjct: 119 GHNLP-PAEVSALVYASEGRYHGTPSGIDNTVIAYEQAIWFQRRPDTAPLIAPIRVATPL 177

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
            L+       +A         E    E      +  A+   ++Q    AL   +L  L Q
Sbjct: 178 TLVIGDTGVRSATHRPVCDLRERWQAEPATYEARFDAVAAVVTQAR-AALAAGDLAALGQ 236

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
            MN  Q LLE LG+S  +L  +V   R Q   + +K+SG+G G  +IAL   D
Sbjct: 237 IMNTNQTLLEELGISSPELDCLVHAAR-QAGALGAKLSGAGWGGVMIALAHSD 288


>gi|284803253|ref|YP_003415118.1| hypothetical protein LM5578_3010 [Listeria monocytogenes 08-5578]
 gi|284996394|ref|YP_003418162.1| hypothetical protein LM5923_2959 [Listeria monocytogenes 08-5923]
 gi|284058815|gb|ADB69756.1| hypothetical protein LM5578_3010 [Listeria monocytogenes 08-5578]
 gi|284061861|gb|ADB72800.1| hypothetical protein LM5923_2959 [Listeria monocytogenes 08-5923]
          Length = 360

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPVGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMIIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|109098670|ref|XP_001105815.1| PREDICTED: mevalonate kinase isoform 3 [Macaca mulatta]
          Length = 396

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 95/370 (25%), Positives = 154/370 (41%), Gaps = 76/370 (20%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD------------------- 48
           + VSAPG ++L GEH V+HG  AL  A+N R  L L    +                   
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGKVDLSLPNIGIKWAWDVA 65

Query: 49  RLINIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIK 84
           RL  +D+S                 L +  G  D       LA+   +F ++ ++I   +
Sbjct: 66  RLQLLDTSFLEQGDATTPTPELVEKLKEVAGLPDDCAVTESLAVL--AFLYLYLSICRKQ 123

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            +    D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L
Sbjct: 124 RALPSLDIVVWSELPHGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDRVNRWTKEDL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + YQ  K S  K      I L  +     
Sbjct: 183 ELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPALQILLTNTKVPRN 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + +
Sbjct: 243 TRTLVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           +  Q  L  LGV  + L ++    R   H + SK++G+G G C I L K  L     ++ 
Sbjct: 299 DMNQHHLNALGVGHASLDQLCQVTRA--HGLHSKLTGAGGGGCGITLLKPGLEQPEVEAT 356

Query: 301 NCHMHAKGID 310
              + + G D
Sbjct: 357 KQALTSCGFD 366


>gi|13592007|ref|NP_112325.1| mevalonate kinase [Rattus norvegicus]
 gi|125406|sp|P17256|KIME_RAT RecName: Full=Mevalonate kinase; Short=MK
 gi|20151083|pdb|1KVK|A Chain A, The Structure Of Binary Complex Between A Mammalian
           Mevalonate Kinase And Atp: Insights Into The Reaction
           Mechanism And Human Inherited Disease
 gi|192988178|pdb|2R42|A Chain A, The Biochemical And Structural Basis For Feedback
           Inhibition Of Mevalonate Kinase And Isoprenoid
           Metabolism
 gi|205378|gb|AAA41588.1| mevalonate kinase (EC 2.7.1.36) [Rattus norvegicus]
 gi|149063614|gb|EDM13937.1| mevalonate kinase, isoform CRA_a [Rattus norvegicus]
          Length = 395

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 127/321 (39%), Gaps = 76/321 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID---SSLGQYCGSL 64
           + VSAPG ++L GEH V+HG  AL  A+N R  L L  + +  ++++     + Q     
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVA 65

Query: 65  DLAMFHPSF-------SFIIMAINHIKPSCGF---------------------------- 89
            L +    F       +  +  +  +K   G                             
Sbjct: 66  TLQLLDTGFLEQGDVPAPTLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQRT 125

Query: 90  ----DLKVISQLDSQLGLGSSAAITVAITAALLT-LQYHKEP---------SPDEILTTA 135
               D+ V S+L    GLGSSAA +V + AALLT  +    P          P+E L + 
Sbjct: 126 LPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEEDLKSI 185

Query: 136 HAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP--T 189
           +    +    + G  SG+D + S  GG + YQ  K S   +  +  + ++ +  K P  T
Sbjct: 186 NKWAYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMS--SLKRLPALQILLTNTKVPRST 243

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR----------NKNLKVLAQA 239
             ++  +    I++PEI      +  L+  +  IS +  R           +   VL + 
Sbjct: 244 KALVAGVRSRLIKFPEI------MAPLLTSIDAISLECERVLGEMAAAPVPEQYLVLEEL 297

Query: 240 MNRQQGLLETLGVSDSKLSEI 260
           M+  Q  L  LGV  + L ++
Sbjct: 298 MDMNQHHLNALGVGHASLDQL 318


>gi|23097682|ref|NP_691148.1| phosphomevalonate kinase [Oceanobacillus iheyensis HTE831]
 gi|22775905|dbj|BAC12183.1| phosphomevalonate kinase [Oceanobacillus iheyensis HTE831]
          Length = 369

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 143/335 (42%), Gaps = 60/335 (17%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAAL-VFAINKRVILYLTLRKDRLINI------DSSLG 58
            ++ V  PG L++ GE  VL  +  L V A+N+ V   +T  ++  +++      D +  
Sbjct: 4   RQLTVKVPGKLMIAGEFAVLEPYQKLAVMAVNRYVYATITDAENYTLSLEDFGLHDIAWS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAI----NHIKPSC----GFDLKVISQLDS----QLGLGSS 106
              G++++      FSF+  AI     +++        F L   S+LD     + GLGSS
Sbjct: 64  YQTGTVNIESDDERFSFVKDAIYITCTYLEEKSIGIPSFHLSTRSELDDASGVKYGLGSS 123

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY---- 162
           AAI  ++ +A+L     +  + + I   A    +  QG  SG D+AAS +GG   Y    
Sbjct: 124 AAIVTSVVSAILRFVAPRYATKEIIFRLAALSHVCTQGNGSGADIAASTYGGFRQYSSFQ 183

Query: 163 --------------------QMPKYSIEKI---DFIFPIHLIYSGYKTPTAQVLKKISYI 199
                               +   Y  E I   DF+  + + ++G    T  ++++I  +
Sbjct: 184 ADWLLNTYKNASTISEVVDMEWKYYQSENIRIPDFL-NVCVGWTGTAASTKNLVQQIRLL 242

Query: 200 EIEYPEINE-INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG------V 252
           ++   +  E   Q     +G    +    + ++NL +L   + + +  L  +G      +
Sbjct: 243 KVSDSDAYEHFLQSSKEAVG----LFLDGMNSENLSMLMDGVRKNRQALAHVGQKAKTPI 298

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             S L+++   L EQ    A K SG+G GDC IA 
Sbjct: 299 ETSMLTKLC-DLAEQLG-GAGKPSGAGGGDCGIAF 331


>gi|238854238|ref|ZP_04644582.1| phosphomevalonate kinase [Lactobacillus gasseri 202-4]
 gi|282852204|ref|ZP_06261556.1| phosphomevalonate kinase [Lactobacillus gasseri 224-1]
 gi|238833049|gb|EEQ25342.1| phosphomevalonate kinase [Lactobacillus gasseri 202-4]
 gi|282556623|gb|EFB62233.1| phosphomevalonate kinase [Lactobacillus gasseri 224-1]
          Length = 357

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 147/351 (41%), Gaps = 78/351 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 2   ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 61

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 62  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 116

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 117 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 175

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 176 YQTFDKVWLKKELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 235

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA--MNRQQ----GL 246
           +    +I+ +Y    E +++    M             KN+ ++ +   +NRQ       
Sbjct: 236 NAKKKFIKTQYDTFLEQSRQCVLDM-------ITGFNEKNIALIQKQIRLNRQLLKDFAT 288

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
           L  + +   +L++++  + EQ +  A+K SG+G GDC  VIA  + D+  +
Sbjct: 289 LNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEQTDIEEM 337


>gi|116629676|ref|YP_814848.1| phosphomevalonate kinase [Lactobacillus gasseri ATCC 33323]
 gi|116095258|gb|ABJ60410.1| phosphomevalonate kinase [Lactobacillus gasseri ATCC 33323]
          Length = 380

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 147/351 (41%), Gaps = 78/351 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 25  ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 84

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 85  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 139

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 140 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 198

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 199 YQTFDKVWLKKELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 258

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA--MNRQQ----GL 246
           +    +I+ +Y    E +++    M             KN+ ++ +   +NRQ       
Sbjct: 259 NAKKKFIKTQYDTFLEQSRQCVLDM-------ITGFNEKNIALIQKQIRLNRQLLKDFAT 311

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
           L  + +   +L++++  + EQ +  A+K SG+G GDC  VIA  + D+  +
Sbjct: 312 LNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEQTDIEEM 360


>gi|261327744|emb|CBH10721.1| mevalonate kinase, putative [Trypanosoma brucei gambiense DAL972]
          Length = 329

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 134/284 (47%), Gaps = 17/284 (5%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR-----LINIDSSLGQYCGSLDLAM 68
           G ++L GEH V++G  ++V  IN+     ++  K +     +I+   ++  Y        
Sbjct: 17  GKVILFGEHFVVYGAESIVAGINEYTTCEISRLKHKPNVVEVIDERPAVPGYIKEKREEQ 76

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              +   ++  +N      G  +K+   L    G+G+SA+  V+++ AL  L Y    S 
Sbjct: 77  -RVAHGLVLRHLNIDTSKDGLLVKLGGPLVPSSGIGASASDVVSLSRALNEL-YTLNLSE 134

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--MPKYSIEKIDFIFPIHLIY--SG 184
           + +  +A+A      G  SG+D  A+ +GG+I ++  + K    ++    P+ +I   +G
Sbjct: 135 EAVNRSAYAGECGYHGTPSGVDNTAATYGGIILFRRALKKSVFSRLALGKPLSIIVCSTG 194

Query: 185 YKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
               T +V+  ++ ++   P   +++ ++  A + +      +AL++ NL+ + + MN  
Sbjct: 195 ITASTTKVVADVARLKAAQPSWFDDLFEQYNACVREAK----KALQSGNLRRVGELMNIN 250

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L + L VS  +L  I    R     + +K+SG+G G  V+AL
Sbjct: 251 HTLCQKLTVSCPELDAIATCCR-TFGALGAKMSGTGRGGLVVAL 293


>gi|116492690|ref|YP_804425.1| phosphomevalonate kinase [Pediococcus pentosaceus ATCC 25745]
 gi|116102840|gb|ABJ67983.1| phosphomevalonate kinase [Pediococcus pentosaceus ATCC 25745]
          Length = 360

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 91/363 (25%), Positives = 157/363 (43%), Gaps = 71/363 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDS--------SLG 58
           I   APG L + GE+ ++  G+ A++ AIN+ V   L   K  + NI S        S  
Sbjct: 2   ITEKAPGKLYIAGEYAIVEPGNNAVLVAINQFVTASLEPSKLTVGNIISKQYQNNVLSWR 61

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
           +    L +      + +I+ AI+ I+            ++L + S LDS    + GLGSS
Sbjct: 62  RRGSELVVDNRDNPYHYILSAISIIEELAVLLNRKLKTYNLYINSDLDSSDGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-- 163
           AA+TVA    +   +++  P   E+L    +I  L VQG  S  D+AAS++GG I YQ  
Sbjct: 122 AAVTVATIKVVA--KFYNIPLTKELLFKLASIAHLDVQGNGSLGDIAASVYGGWIAYQSF 179

Query: 164 ------------------MPKYSIEKIDFIFP-----IHLIYSGYKTPTAQVLKKI---S 197
                                +   KI+ + P     +++ ++G    T+ ++ ++   S
Sbjct: 180 NRDWLNSMRRTKDLETILRTPWPQLKIELLTPPSDLRLYIGWTGSPASTSDLVDQVATTS 239

Query: 198 YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL----GVS 253
           Y E +    +E   K  + + K+        R+ ++ V+ + +   + LL+ L    GVS
Sbjct: 240 YQETD--SYHEFLTKNASCINKM----IDGFRDADITVIQREITNNRHLLQELSLFSGVS 293

Query: 254 DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI--DI 311
               +   +    +    A+K SG+G GDC I +       +P  +    M A+    DI
Sbjct: 294 IETTTLTNFCDIAEKFDGAAKSSGAGGGDCGIVI-------MPNSTKTAKMFAEWEKHDI 346

Query: 312 VPI 314
            P+
Sbjct: 347 KPL 349


>gi|329926768|ref|ZP_08281176.1| galactokinase [Paenibacillus sp. HGF5]
 gi|328938968|gb|EGG35336.1| galactokinase [Paenibacillus sp. HGF5]
          Length = 392

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 143/338 (42%), Gaps = 55/338 (16%)

Query: 2   GQCLHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----- 55
           G+  HK+ + +APG + L+GEH   +G   L  A+     L +  R D  ++  S     
Sbjct: 15  GESQHKVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDNKVSFSSTNIPY 74

Query: 56  ----SLGQ-YCGSLDLAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAA 108
               SL + Y   +D    +P    +I  +N I    S G+DL     + +  GL SSA+
Sbjct: 75  ELTISLDEDYGYKIDQWTDYPVG--VITELNKIGCGLSSGYDLLYHGDIPNGAGLSSSAS 132

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG--------- 158
           I V    A L ++  KE    EI   +  +     G++SGI D  A  +G          
Sbjct: 133 IEVVTAYAFLKME-GKETDTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMC 191

Query: 159 ------LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEIN---EI 209
                 L+ ++   Y I   +      L+ S Y    ++  + +  ++ E P ++   ++
Sbjct: 192 DTLEYELVPFRTGAYKIVISNTNKRRGLVDSKYNERRSECDRALEILQKELPALSYLAQL 251

Query: 210 NQKIYALM---------GKLSQ----------ISCQALRNKNLKVLAQAMNRQQGLLETL 250
           N   +A +          + +Q           S +AL+  NL+V  Q MN+    L  L
Sbjct: 252 NPDQFATLRDSIRDETVRRRAQHVVEENQRVLDSVKALKEGNLEVFGQYMNQSHDSLRYL 311

Query: 251 -GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             V+  +L  +V + +  P  + S+++G+G G C ++L
Sbjct: 312 YEVTGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSL 349


>gi|311110681|ref|ZP_07712078.1| phosphomevalonate kinase [Lactobacillus gasseri MV-22]
 gi|311065835|gb|EFQ46175.1| phosphomevalonate kinase [Lactobacillus gasseri MV-22]
          Length = 367

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 147/351 (41%), Gaps = 78/351 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT---------------------L 45
           I   APG L + GE+ VL  +  A++ A+N+ V + +                      +
Sbjct: 12  ITEQAPGKLYIAGEYAVLEQNCPAILVAVNEFVRVSIAKSTGTSGLIHSKQYSQDSIHWI 71

Query: 46  RKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QL 101
           RK   + ID+    +   L    F   F      +    P   +DL V S LDS    + 
Sbjct: 72  RKGNQMVIDNRDNPFEYILSAIKFTERF-----CLEQKVPMSLYDLHVNSDLDSADGKKY 126

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           GLGSSAA+TVA   A+L   Y    + D I   +      VQG  S  D+AAS++GG + 
Sbjct: 127 GLGSSAAVTVATVKAILNF-YGLHCTKDLIFKLSAISHYSVQGNGSAGDIAASVYGGWLA 185

Query: 162 YQM--------------------PKYSIEKIDFIFP---IHLIYSGYKTP--TAQVLKKI 196
           YQ                       +   KI  + P   ++L+    + P  T+Q++ K 
Sbjct: 186 YQTFDKVWLKKELATKSLSEVLNEAWPGLKIQLLTPPEGLNLVIGWSQKPASTSQLVDKT 245

Query: 197 S----YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA--MNRQQ----GL 246
           +    +I+ +Y    E +++    M             KN+ ++ +   +NRQ       
Sbjct: 246 NAKKKFIKTQYDTFLEQSRQCVLDM-------ITGFNEKNIALIQKQIRLNRQLLKDFAT 298

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC--VIALGKGDLNSL 295
           L  + +   +L++++  + EQ +  A+K SG+G GDC  VIA  + D+  +
Sbjct: 299 LNHIAIEIPRLTKLI-NIAEQFN-GAAKTSGAGNGDCGIVIADEQTDIEEM 347


>gi|16799091|ref|NP_469359.1| hypothetical protein lin0012 [Listeria innocua Clip11262]
 gi|16412433|emb|CAC95245.1| lin0012 [Listeria innocua Clip11262]
 gi|328468333|gb|EGF39339.1| phosphomevalonate kinase [Listeria monocytogenes 1816]
 gi|328476153|gb|EGF46859.1| phosphomevalonate kinase [Listeria monocytogenes 220]
          Length = 360

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|307569535|emb|CAR82714.1| phosphomevalonate kinase [Listeria monocytogenes L99]
          Length = 360

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELSPVKMVIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|55822529|ref|YP_140970.1| mevalonate kinase [Streptococcus thermophilus CNRZ1066]
 gi|55738514|gb|AAV62155.1| mevalonate kinase [Streptococcus thermophilus CNRZ1066]
          Length = 292

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 132/279 (47%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAAETPLTLKAQDP 56

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S + 
Sbjct: 57  LTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELSQET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       E+I+     +L+   +G    
Sbjct: 116 LEMLVHQAETIAHSKPSGLDAKTCLSDHAISF-TRNIGFEEIEVNLGAYLVIADTGIHGN 174

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+    ++   ++++NQ     +G+LSQ +  AL+ K+ K+L Q M++    L+
Sbjct: 175 TREAVEKVEANGLDA--LSDLNQ-----LGELSQKAEWALKAKDQKLLGQLMSQAHNHLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 228 SLGVS-CDLSDLLVATALEHGALGAKMSGGGLGGCIIAL 265


>gi|301771736|ref|XP_002921282.1| PREDICTED: mevalonate kinase-like [Ailuropoda melanoleuca]
          Length = 396

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 122/320 (38%), Gaps = 78/320 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCGSL 64
           +SAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI          L
Sbjct: 8   LSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGKVCLNLPNIGVKRAWDVARL 67

Query: 65  DLAMFHPSFSFIIMA---------INHIKPSCGF-------------------------- 89
            L       SF+            +  +K   GF                          
Sbjct: 68  QLQ----DTSFLEQGNAAAPTPEQVEKLKEVAGFPEDGANPECLAVLAFLYLYLSICRKQ 123

Query: 90  ------DLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLK-- 141
                 D+ V SQL +  GLGSSAA +V +  ALLT    + P+P +   +A     +  
Sbjct: 124 RALPSLDITVWSQLPTGAGLGSSAAYSVCMATALLT-ACEEIPNPRKDGESASRWTGEDL 182

Query: 142 -------------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
                        + G  SG+D A S  GG++ +Q  K S  K      I L  +     
Sbjct: 183 ELINKWAFQGERMIHGNPSGVDNAVSTWGGVVRFQQGKISSLKRPPALRILLTNTKVPRS 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        IN I+ +   ++G++      A   ++  VL + +
Sbjct: 243 TKALVASVQSRLLKFPEIVSPLLTSINAISLECERMLGEME----AAPAPEHYLVLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|301300755|ref|ZP_07206939.1| mevalonate kinase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|300851605|gb|EFK79305.1| mevalonate kinase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 314

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 137/300 (45%), Gaps = 32/300 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ----- 59
            H    S+   ++L+GEH V++GH A+   + K V    +++      I SS  Q     
Sbjct: 4   FHDAKGSSHAKIILIGEHAVVYGHPAIALPL-KTVTATASIKV-----IPSSSEQIIKSS 57

Query: 60  -YCGSLDLAMFHPSF---SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
            Y GS+D  M          I+  ++ ++   GF+L + SQL ++ G+GSSAA+ ++I  
Sbjct: 58  YYDGSVD-DMPKNMLGIKKLILKLVSDLRIENGFELHLSSQLPAERGMGSSAAVAISIIR 116

Query: 116 ----ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
               A  T   HK     ++L+ A           SG+D   S     I + +    I  
Sbjct: 117 CFYNATDTRINHK-----KLLSYADIAEKVTHNNPSGLDATTSASDNPI-WLIRNKEITP 170

Query: 172 IDFIFPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
           I      +L+   SG K  T++ + KI   ++   EI+  ++   A +G+L+Q +   L 
Sbjct: 171 IPINLDAYLLISDSGIKGQTSEAI-KIVKDQLNTDEISTSSK--LAALGRLAQTTRDQLA 227

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           N ++  L +     Q  L +L VS  KL  ++  +  +   + SK++G G G C I+L K
Sbjct: 228 NNDIVGLGKIFTLAQKDLISLDVSTPKLDNLI-TIALKNGSLGSKLTGGGRGGCFISLLK 286


>gi|256960028|ref|ZP_05564199.1| mevalonate kinase [Enterococcus faecalis Merz96]
 gi|293383782|ref|ZP_06629689.1| mevalonate kinase [Enterococcus faecalis R712]
 gi|293388742|ref|ZP_06633235.1| mevalonate kinase [Enterococcus faecalis S613]
 gi|312907002|ref|ZP_07765998.1| mevalonate kinase [Enterococcus faecalis DAPTO 512]
 gi|312978740|ref|ZP_07790467.1| mevalonate kinase [Enterococcus faecalis DAPTO 516]
 gi|256950524|gb|EEU67156.1| mevalonate kinase [Enterococcus faecalis Merz96]
 gi|291078858|gb|EFE16222.1| mevalonate kinase [Enterococcus faecalis R712]
 gi|291081899|gb|EFE18862.1| mevalonate kinase [Enterococcus faecalis S613]
 gi|310626987|gb|EFQ10270.1| mevalonate kinase [Enterococcus faecalis DAPTO 512]
 gi|311288447|gb|EFQ67003.1| mevalonate kinase [Enterococcus faecalis DAPTO 516]
          Length = 314

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 126/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L ++   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSQEHGALGAKLTGGGRGGCMIAL 283


>gi|61555394|gb|AAX46707.1| mevalonate kinase [Bos taurus]
          Length = 363

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 97/233 (41%), Gaps = 62/233 (26%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINI----------- 53
           VSAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI           
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGRVGLNLPNIGVRRAWDVASL 67

Query: 54  ---DSSLGQYCGSLDLAMFH----------P------------SFSFIIMAI---NHIKP 85
              D+S   +  S  L   H          P            +F ++ ++I     + P
Sbjct: 68  QLLDTSFLGHGDSAALTAKHVEKLKEVAGFPKDCVDPEHLAVLAFLYLYLSICQSQRVLP 127

Query: 86  SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTT 134
           S   D+ V S+L +  GLGSSAA +V + AALLT    + P+P           +E L  
Sbjct: 128 S--LDITVWSELPTGAGLGSSAAYSVCLAAALLT-ACEEIPNPLKDGEAAGRWTEENLEL 184

Query: 135 AHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYS 183
            +    +    + G  SG+D A S  GG + YQ  K S  K   +  I LI +
Sbjct: 185 INKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPVLKILLINT 237


>gi|116871435|ref|YP_848216.1| phosphomevalonate kinase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116740313|emb|CAK19431.1| phosphomevalonate kinase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 360

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSDRNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPVGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|55820638|ref|YP_139080.1| mevalonate kinase [Streptococcus thermophilus LMG 18311]
 gi|55736623|gb|AAV60265.1| mevalonate kinase [Streptococcus thermophilus LMG 18311]
          Length = 292

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 133/280 (47%), Gaps = 28/280 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A   ++LMGEH V++GH AL   +    V+  +   +  L+              L    
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPLKDIEVVCQIQAAETPLM--------------LKAQD 55

Query: 71  PSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
           P  + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S +
Sbjct: 56  PLTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELSQE 114

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKT 187
            +    H          SG+D    +    I +       E+I+     +L+   +G   
Sbjct: 115 TLEMLVHQSETIAHSKPSGLDAKTCLSDHAISF-TRNIGFEEIEVNLGAYLVIADTGIHG 173

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T + ++K+    ++   ++++NQ     +G+LSQ + +AL+ K+ K+L Q M++    L
Sbjct: 174 NTREAVEKVEANGLDA--LSDLNQ-----LGELSQKAERALKAKDQKLLGQLMSQAHNHL 226

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           ++LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 227 KSLGVS-CDLSDLLVATALEHGALGAKMSGGGLGGCIIAL 265


>gi|322823777|gb|EFZ29434.1| mevalonate kinase, putative [Trypanosoma cruzi]
          Length = 328

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 132/288 (45%), Gaps = 26/288 (9%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLGQYC--GSLDLA 67
           G ++L GEH V++G  ALV  I++     L L K +    +++   ++  Y    + +  
Sbjct: 17  GKIILFGEHFVVYGAEALVAGIDEYTSCRLELTKGQPGICVVDGRPAVPGYIVEKAEEQR 76

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H     +   +N      G  + +   L    G+G+SA+  V+++ AL  + Y  + +
Sbjct: 77  LAH---RLVFRHLNIDTSVDGVRIHLGGPLVPTSGIGASASDVVSLSRALSEM-YGLDLT 132

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEKIDFIFPIHLIY--S 183
            DE+  +A        G  SG D  A+  GGLI Y+      +  ++    P+ L+   +
Sbjct: 133 EDEVNLSAFVGEGGYHGTPSGADNTAATFGGLISYRRVNGVSNFCRVLITRPLFLVVCST 192

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIY-ALMGKLSQISCQ---ALRNKNLKVLAQA 239
           G  T T +V+ +I        E+ E N   + AL+G+ +    +   A+   NL  + + 
Sbjct: 193 GITTSTTKVVGEIR-------ELKENNPTWFNALLGRYNACVGEAKAAMEVGNLFRMGEL 245

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           MN    L + L VS ++L  IV    E    + +K+SG+G G  V+AL
Sbjct: 246 MNENHKLCQELTVSCAELDTIVNFCCEN-GALGAKMSGTGRGGLVVAL 292


>gi|291413954|ref|XP_002723230.1| PREDICTED: mevalonate kinase [Oryctolagus cuniculus]
          Length = 405

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 98/373 (26%), Positives = 150/373 (40%), Gaps = 82/373 (21%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-------------------TLRKD 48
           + VSAPG ++L GEH V+HG  AL  A+N R  L L                        
Sbjct: 15  LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSHGQVGLHLPNIGSKRAWDVA 74

Query: 49  RLINIDSS-----------------LGQYCG-SLD------LAMFHPSFSFIIMAI---N 81
           RL  +D+S                 L +  G S+D      LA+   +F ++ ++I    
Sbjct: 75  RLQQLDTSFLEQGDVSTPTPEQVEKLKEVAGLSVDGAGPEHLAVL--AFLYLYLSICRKQ 132

Query: 82  HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-QYHKEPSPDEILTTAHA--- 137
              PS   D+ V S+L +  GLGSSAA +V + AALLT  +    P  D    +  A   
Sbjct: 133 RALPS--LDIVVWSELPTGAGLGSSAAYSVCLAAALLTACEDIPNPQKDGFCVSRWAKDD 190

Query: 138 --IVLK--------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
             ++ K        + G  SG+D A S  GG + YQ  K S  +      I L  +    
Sbjct: 191 LELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISALQRPPTLQILLTNTKVPR 250

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR----------NKNLKVLA 237
            T  ++  +    +++PEI      +  L+  +  IS +  R           +   VL 
Sbjct: 251 STKALVAGVRSRLLKFPEI------VAPLLTSIDAISLECERVLGDMAVAATPEQYLVLE 304

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
           + ++  Q  L  LGV  + L  +        H + SK++G+G G C I L K DL     
Sbjct: 305 ELIDMNQHHLNALGVGHASLDRLC--QVTMAHGLHSKLTGAGGGGCGITLLKPDLERAEV 362

Query: 298 QSVNCHMHAKGID 310
           ++    +   G D
Sbjct: 363 EATKQALTGCGFD 375


>gi|71397724|ref|XP_802528.1| mevalonate kinase [Trypanosoma cruzi strain CL Brener]
 gi|70863707|gb|EAN81082.1| mevalonate kinase, putative [Trypanosoma cruzi]
          Length = 362

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 131/285 (45%), Gaps = 20/285 (7%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLGQYC--GSLDLA 67
           G ++L GEH V++G  ALV  I++     L L K +    +++   ++  Y    + +  
Sbjct: 53  GKIILFGEHFVVYGAEALVAGIDEYTSCRLELTKGQPGICVVDGRPAVPGYIVEKAEEQR 112

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           + H     +   +N      G  + +   L    G+G+SA+  V+++ AL  + Y  + +
Sbjct: 113 LAH---RLVFRHLNIDTSVDGVRIHLGGPLVPTSGIGASASDVVSLSRALSEM-YGLDLT 168

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEKIDFIFPIHLIY--S 183
            DE+  +A        G  SG D  A+  GGLI Y+      +  ++    P+ L+   +
Sbjct: 169 EDEVNLSAFVGEGGYHGTPSGADNTAATFGGLISYRRVNGVSNFCRVLITRPLFLVVCST 228

Query: 184 GYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           G  T T +V+ +I  ++   P   N + ++  A +G+       A+   N+  + + MN 
Sbjct: 229 GITTSTTKVVGEIRELKENNPTWFNALLERYNACVGEAK----AAMEVGNVFRVGELMNE 284

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              L + L VS ++L  IV    E    + +K+SG+G G  V+AL
Sbjct: 285 NHKLCQELTVSCAELDTIVNFCCENG-ALGAKMSGTGRGGLVVAL 328


>gi|315149663|gb|EFT93679.1| mevalonate kinase [Enterococcus faecalis TX0012]
          Length = 314

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 125/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   Y G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--YTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLSVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|326771744|ref|ZP_08231029.1| mevalonate kinase [Actinomyces viscosus C505]
 gi|326637877|gb|EGE38778.1| mevalonate kinase [Actinomyces viscosus C505]
          Length = 320

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 119/288 (41%), Gaps = 29/288 (10%)

Query: 17  VLMGEHGVLHGHAALVFAINK---RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           +L+GEH V++GH A+   +     R     T     L ++D     Y G L  A   P F
Sbjct: 19  ILLGEHSVVYGHPAVAVPLQDLRMRATARPTSGPSTLTSLD-----YSGPLTQA--GPRF 71

Query: 74  SFIIMAINHIKPSCG-----FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +  A    +   G      ++  +S    + GLGSSAA   AI  A+L     +E + 
Sbjct: 72  ASVARAFEVAREFSGCLDQALEITTVSDFPHERGLGSSAAAAGAIIRAVLD-ACGREAAA 130

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY-----SIEKIDFIFPIHLIYS 183
           DE+            G  SG+D AA+     I +Q  +       IE    I     I+ 
Sbjct: 131 DELFALTQMAEQIAHGKPSGLDAAATCSPCPIRFQGGQMRPLSQRIENASLIIADSGIHG 190

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
             +     + ++         + + I  +I  L G L+Q +  AL   +   L  AM+  
Sbjct: 191 STREAVGGLRRRYEN------DPDNIGPRINRL-GALTQNAIMALDQADAPALGVAMDEA 243

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             +L  LG+S   L ++    R     + +K++G GLG CVIAL  G+
Sbjct: 244 HAVLTELGLSLPILDDLTEAARSA-GALGAKLTGGGLGGCVIALATGE 290


>gi|313611827|gb|EFR86309.1| phosphomevalonate kinase [Listeria monocytogenes FSL F2-208]
          Length = 249

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSS
Sbjct: 64  WPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|29653947|ref|NP_819639.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 493]
 gi|161830446|ref|YP_001596534.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 331]
 gi|164686049|ref|ZP_01947593.2| putative phopshomevalonate kinase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165918995|ref|ZP_02219081.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 334]
 gi|212218970|ref|YP_002305757.1| mevalonate kinase [Coxiella burnetii CbuK_Q154]
 gi|29541210|gb|AAO90153.1| mevalonate kinase [Coxiella burnetii RSA 493]
 gi|161762313|gb|ABX77955.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 331]
 gi|164601605|gb|EAX31785.2| putative phopshomevalonate kinase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|165917320|gb|EDR35924.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 334]
 gi|212013232|gb|ACJ20612.1| mevalonate kinase [Coxiella burnetii CbuK_Q154]
          Length = 340

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 130/307 (42%), Gaps = 50/307 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRV---------------ILYLTLRKD----RLIN 52
            P  L+L GEH V++GH AL  AIN+ +                + +  R++     L N
Sbjct: 10  TPAKLILSGEHAVVYGHPALSVAINRYMEATVRWSLPLHFSFHFMGIDFRREVTLQALRN 69

Query: 53  IDSSLG-QY----CGSLDLAM-----FHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQ 100
           +   L  QY     G L +       F  S    I  ++ +K     G D+   S +   
Sbjct: 70  LKRKLKKQYHKYSLGHLSIREVLQKPFELSLFTFINVLDRLKNKLPTGIDIVTDSNIPVG 129

Query: 101 LGLGSSAAITVAITAAL---LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG 157
            G+GSSAA  V++  AL   L +  H E   D +     +  L+  G SSG+D+    HG
Sbjct: 130 CGMGSSAASVVSLIYALTQFLGMDLHLE---DYLSLGVESENLQ-HGYSSGLDVHTVYHG 185

Query: 158 GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM 217
           G + Y+  ++    I   FP+ LI +G   P +   + IS     +      N KI    
Sbjct: 186 GCLRYEKGQFEKRPIP-DFPMQLIQTG--CPQSSTGECISEAAPFFK-----NSKIGEDF 237

Query: 218 GKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
             ++    QAL+N N   +   +     LL ++GV   K++  V  + +     A+KI G
Sbjct: 238 SAVTNALDQALQNHNNDSIKGCIRENHRLLRSIGVVPDKINNFVIDVEKLGG--AAKICG 295

Query: 278 SG--LGD 282
           +G  +GD
Sbjct: 296 AGSVVGD 302


>gi|258611653|ref|ZP_05711585.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|258605121|gb|EEW17729.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
          Length = 359

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 90/178 (50%), Gaps = 18/178 (10%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSS 56
           M Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ 
Sbjct: 1   MYQMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENP 60

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLG 104
           +    G  +L      ++F   AIN       S G +L         ++I Q  ++ GLG
Sbjct: 61  VSWPIGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLG 119

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           SSAA TVA+   L+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 120 SSAAATVAVINTLMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 176


>gi|212212908|ref|YP_002303844.1| mevalonate kinase [Coxiella burnetii CbuG_Q212]
 gi|212011318|gb|ACJ18699.1| mevalonate kinase [Coxiella burnetii CbuG_Q212]
          Length = 340

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 130/307 (42%), Gaps = 50/307 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRV---------------ILYLTLRKD----RLIN 52
            P  L+L GEH V++GH AL  AIN+ +                + +  R++     L N
Sbjct: 10  TPAKLILSGEHAVVYGHPALSVAINRYMEATVRWSLPLHFSFHFMGIDFRREVTLQALRN 69

Query: 53  IDSSLG-QY----CGSLDLAM-----FHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQ 100
           +   L  QY     G L +       F  S    I  ++ +K     G D+   S +   
Sbjct: 70  LKRKLKKQYHKYSLGHLSIREVLQKPFELSLFTFINVLDRLKNKLPTGIDIVTDSNIPVG 129

Query: 101 LGLGSSAAITVAITAAL---LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG 157
            G+GSSAA  V++  AL   L +  H E   D +     +  L+  G SSG+D+    HG
Sbjct: 130 CGMGSSAASVVSLIYALTQFLGMDLHLE---DYLSLGVESENLQ-HGYSSGLDVHTVYHG 185

Query: 158 GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM 217
           G + Y+  ++    I   FP+ LI +G   P +   + IS     +      N KI    
Sbjct: 186 GCLRYEKGQFEKRPIP-DFPMQLIQTG--CPQSSTGECISEAAPFFK-----NSKIGEDF 237

Query: 218 GKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
             ++    QAL+N N   +   +     LL ++GV   K++  V  + +     A+KI G
Sbjct: 238 SAVTNALDQALQNHNNDSIKGCIRENHRLLRSIGVVPDKINNFVIDVEKLGG--AAKICG 295

Query: 278 SG--LGD 282
           +G  +GD
Sbjct: 296 AGSLVGD 302


>gi|299820832|ref|ZP_07052721.1| mevalonate kinase [Listeria grayi DSM 20601]
 gi|299817853|gb|EFI85088.1| mevalonate kinase [Listeria grayi DSM 20601]
          Length = 322

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 129/287 (44%), Gaps = 34/287 (11%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------DLAMF 69
           ++L GEH V++G  A+     + +I        +     S+  Q+  +       ++  F
Sbjct: 10  MILFGEHAVVYGEPAISVPFTQALI--------KTEVSPSTENQFASTFFTGPIEEMPPF 61

Query: 70  HPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
                 +I++I  +  +P     +KV+S +    GLGSSAA+  ++T  L    Y K+ +
Sbjct: 62  LDGIKRLILSIQKLLEQPEP-LTVKVLSDVPVGRGLGSSAAVATSVTRGLYNY-YEKKLT 119

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
            + +L   +       G +SG+D    +    + Y   K ++E I F   +  +   +G 
Sbjct: 120 EEMLLKLVNHAEDAAHGNASGVDAITVVTEKPVWYAKGK-NMETIHFAGELTFVVADTGI 178

Query: 186 KTPTAQVLKKISYI----EIEY-PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            + T   +  +  +     +EY P I E+   I   M +L + +   +R      + +AM
Sbjct: 179 PSETKAAVADVGVLCKKEPLEYMPLIKELGG-ISREMKELLETNIDKIR------IGEAM 231

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           NR Q +L+ L VSD KL  ++ ++        +K++G G G C+I++
Sbjct: 232 NRSQSILKKLTVSDPKLENLI-QVALSAGAYGAKLTGGGRGGCMISI 277


>gi|260584342|ref|ZP_05852089.1| phosphomevalonate kinase [Granulicatella elegans ATCC 700633]
 gi|260157860|gb|EEW92929.1| phosphomevalonate kinase [Granulicatella elegans ATCC 700633]
          Length = 370

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 146/336 (43%), Gaps = 66/336 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSS--------LG 58
           I  +APG L + GE+ V+  G  AL+ A+N+ + + LTL  + +  I S+          
Sbjct: 3   IQATAPGKLFIAGEYAVVTPGQPALIAAVNRYLTVDLTLSLEEVGTIYSTQQPDLTLHWK 62

Query: 59  QYCGSLDLAMFHPSFSFIIMAI----NHIKPSCGFD-----LKVISQLDS-----QLGLG 104
           +  G L +   +  F+ +  AI     + K    ++     LKV SQLD      + GLG
Sbjct: 63  RKQGLLQIIEENHPFTLMTTAIEVAETYAKQRNSWNEELYHLKVTSQLDDVHSNIKFGLG 122

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGGLICY- 162
           SS A+ VA   A+L  Q+H  P    ++    AI   + G +  + D+A+S  GG+I Y 
Sbjct: 123 SSGAVVVATIDAIL--QWHHIPVEPLLVYKLAAITNTLLGSNGSLGDIASSAFGGIILYQ 180

Query: 163 ---------QMPKYSIEKID-------FIFPIHLI--------YSGYKTPTAQVLKKISY 198
                    Q+ ++SI ++         I P+ L         ++  K  T+  +  +++
Sbjct: 181 RIDTTWIKEQLQQHSIAEVVNKEWTGLVIQPLSLPTTLKMLVGWTKEKADTSSFVSSVTH 240

Query: 199 IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV------ 252
              +  +     Q +      L+QI+  AL  +N +   Q +   + LL           
Sbjct: 241 TRTQAEKDAYYQQFLKQNTTILNQITT-ALTEENTEAFLQGITDNRALLLDFAKEMNIIL 299

Query: 253 ---SDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
              S +KL +I   L+E     ++K SG+G GDC I
Sbjct: 300 ETPSLTKLCQI--GLQEN---ASAKTSGAGGGDCGI 330


>gi|73995337|ref|XP_543435.2| PREDICTED: similar to Mevalonate kinase (MK) [Canis familiaris]
          Length = 409

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 149/376 (39%), Gaps = 88/376 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCGSL 64
           VSAPG ++L GEH V+HG  AL  A+N R  L L    +      L NI          L
Sbjct: 17  VSAPGKVILHGEHAVVHGKIALAVALNLRTFLRLQPHSNGKMCLNLPNIGVKRAWDVARL 76

Query: 65  ---DLAMFHP-------------------------------------SFSFIIMAI---N 81
              D +   P                                     +F ++ ++I    
Sbjct: 77  QLQDTSFLEPGNATGDAAAPTSEQVEKLKEVAGIPKDGADPECLAVLAFLYLYLSICRKQ 136

Query: 82  HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLK 141
              PS   D+ V S+L +  GLGSSAA +V + AALLT      P+P     +A    ++
Sbjct: 137 RTLPS--LDITVWSELPTGAGLGSSAAYSVCLAAALLT-ACEAIPNPQNNGESASRWTME 193

Query: 142 ---------------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
                          + G  SG+D   S  GG + YQ  K  I  I  +  + ++ +  K
Sbjct: 194 DLELINKWAFQGERMIHGNPSGVDNTISTWGGALRYQQGK--ISSIKRLPALKILLTNTK 251

Query: 187 TP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN----------KNLK 234
            P  T  ++  +    +++PEI      +  L+  ++ IS +  R           ++  
Sbjct: 252 VPRSTKALVASVRSRLLKFPEI------VAPLLTSINAISLECERTLEEMASAPAPEHYL 305

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
           VL + ++  Q  L  LGV  + L ++        H + SK++G+G G C I L + DL  
Sbjct: 306 VLEELIDINQHHLNALGVGHASLDQLC--QVTMAHGLHSKLTGAGGGGCGITLLRPDLEQ 363

Query: 295 LPYQSVNCHMHAKGID 310
              +++   + + G D
Sbjct: 364 PKVEAMKQALTSCGFD 379


>gi|313123653|ref|YP_004033912.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280216|gb|ADQ60935.1| Phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 360

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+++ V + +        L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  + S D I   +      VQG  S  D+AAS++GG I YQ
Sbjct: 122 AAVTVATVKAILRF-YGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQ 177


>gi|325686245|gb|EGD28288.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 360

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+++ V + +        L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  + S D I   +      VQG  S  D+AAS++GG I YQ
Sbjct: 122 AAVTVATVKAILRF-YGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQ 177


>gi|319440915|ref|ZP_07990071.1| putative mevalonate kinase [Corynebacterium variabile DSM 44702]
          Length = 309

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 129/301 (42%), Gaps = 20/301 (6%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++L GEH V++GH A+   +    ++      D    + S LG + G +  A     FS 
Sbjct: 4   IILFGEHSVVYGHPAIAMPLRTLRMIARVEPTDGPGTL-SGLG-WTGPITEAPAR--FSS 59

Query: 76  IIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
           I+ A          P  G ++   S+   + GLGSSAA   A+  A+L   +    +P E
Sbjct: 60  IVKAAEVASDFAGHPGAGLNISTESEFPPERGLGSSAAAAGAVIRAVLD-AFDTPATPRE 118

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +            G  SG+D  A+     + +Q  + +  +      I +  SG +  T 
Sbjct: 119 LFDLTQEAETVAHGRPSGLDAVATSAEAPVHFQAGQATDLEFSPDAWIVIADSGVEGSTR 178

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKNLKVLAQAMNRQQGLL 247
           + +  +       P+I      I AL+ +L +I+ +    LR  +++ +   M    G+L
Sbjct: 179 ETVGHVRGRFEAEPDI------ITALLNRLGEITDEVVVDLRTGDVQGMGARMTEAHGIL 232

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             LGVS+++L  +V         + +K++G G G CVIAL   + ++   +       A+
Sbjct: 233 GQLGVSNTQLDALV-TASLGAGALGAKLTGGGRGGCVIALAATEEDAENVEKALVDAGAR 291

Query: 308 G 308
           G
Sbjct: 292 G 292


>gi|300812406|ref|ZP_07092836.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496573|gb|EFK31665.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 360

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+++ V + +        L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  + S D I   +      VQG  S  D+AAS++GG I YQ
Sbjct: 122 AAVTVATVKAILRF-YGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQ 177


>gi|104773997|ref|YP_618977.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103423078|emb|CAI97799.1| Phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|325125702|gb|ADY85032.1| Phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 360

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+++ V + +        L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  + S D I   +      VQG  S  D+AAS++GG I YQ
Sbjct: 122 AAVTVATVKAILRF-YGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQ 177


>gi|323339818|ref|ZP_08080087.1| phosphomevalonate kinase [Lactobacillus ruminis ATCC 25644]
 gi|323092691|gb|EFZ35294.1| phosphomevalonate kinase [Lactobacillus ruminis ATCC 25644]
          Length = 359

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 141/352 (40%), Gaps = 81/352 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--- 63
           I V APG L + GE+ V+  G  A++  +NK V + +   KD    I     QY  S   
Sbjct: 5   IKVKAPGKLYIAGEYAVVETGCPAILVGLNKYVYVSIEDSKDFGTIISK---QYENSTVI 61

Query: 64  -------LDLAMFHPSFSFIIMAINHI---------KPSCGFDLKVISQLDS----QLGL 103
                  + +      F +I+  I            K  C +DLK+ S+LDS    + GL
Sbjct: 62  WKRRGEHMVIDNRDNPFEYILSGIRITEQYAQELGKKMRC-YDLKIDSELDSPSGKKYGL 120

Query: 104 GSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           GSSAA+TVA   AL    Y    + D++   A     +VQG  S  D+A S+ GG + Y 
Sbjct: 121 GSSAAVTVATVKALCQY-YGLNVTLDQLFKLAAIAHFEVQGNGSLGDIATSVFGGWLEYH 179

Query: 164 -----------------------MPKYSIEKIDFIFPIHLI--YSGYKTPTAQVLKKISY 198
                                   P   I+ +     ++L+  ++G    T+ ++ K+  
Sbjct: 180 SFDRQWLKTARHNYSLSELLAKTWPGLKIKSLPVFDRLNLLIGWTGSPASTSNLVDKVEL 239

Query: 199 IEIEYPEINEINQKIYALMGKLSQISCQ---ALRNKNLKVLAQAMNRQQGLLETLGVSDS 255
            +       E  +K    + + S+   Q   + +  +L  + Q + + + LLE L     
Sbjct: 240 SK------EERRKKYLEFVHESSKCVEQMEASFQKHDLPGIQQCLRKNRNLLENL----- 288

Query: 256 KLSEIVWKLREQPHIM-----------ASKISGSGLGDCVIALGKGDLNSLP 296
              EI     E P +            A+K SG+G GDC I L    +++ P
Sbjct: 289 --HEITGVEIETPTLKYLIKSAERFGGAAKTSGAGGGDCGIVLIDSSIDTTP 338


>gi|47097295|ref|ZP_00234853.1| phosphomevalonate kinase [Listeria monocytogenes str. 1/2a F6854]
 gi|224498296|ref|ZP_03666645.1| hypothetical protein LmonF1_00815 [Listeria monocytogenes Finland
           1988]
 gi|224503064|ref|ZP_03671371.1| hypothetical protein LmonFR_11176 [Listeria monocytogenes FSL
           R2-561]
 gi|254899673|ref|ZP_05259597.1| hypothetical protein LmonJ_07666 [Listeria monocytogenes J0161]
 gi|255029405|ref|ZP_05301356.1| hypothetical protein LmonL_10398 [Listeria monocytogenes LO28]
 gi|47014340|gb|EAL05315.1| phosphomevalonate kinase [Listeria monocytogenes str. 1/2a F6854]
          Length = 356

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPV 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMIIETELIDQSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|450346|emb|CAA53059.1| unnamed protein product [Homo sapiens]
          Length = 557

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 132/320 (41%), Gaps = 78/320 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   RL
Sbjct: 169 VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 228

Query: 51  INIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIK-- 84
            ++D+S                 L +  G  D       LA+   +F ++ ++I   +  
Sbjct: 229 QSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQRA 286

Query: 85  -PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            PS   D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L
Sbjct: 287 LPS--LDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDL 343

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     
Sbjct: 344 ELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRN 403

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + +
Sbjct: 404 TRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELI 459

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 460 DMNQHHLNALGVGHASLDQL 479


>gi|116514013|ref|YP_812919.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|116093328|gb|ABJ58481.1| phosphomevalonate kinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
          Length = 360

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL     A++ A+++ V + +        L   +  + DS    
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHWV 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
             GS + +      F +I+ AI+  +  C         +DL V S LDS    + GLGSS
Sbjct: 62  RRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  + S D I   +      VQG  S  D+AAS++GG I YQ
Sbjct: 122 AAVTVATVKAILRF-YGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQ 177


>gi|322390284|ref|ZP_08063813.1| mevalonate kinase [Streptococcus parasanguinis ATCC 903]
 gi|321143015|gb|EFX38464.1| mevalonate kinase [Streptococcus parasanguinis ATCC 903]
          Length = 294

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 130/294 (44%), Gaps = 52/294 (17%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR---LINIDSSLGQYCGSLDLAM 68
           A   ++L+GEH V++G+ A+   ++   +    +  D    L   D+        L +A+
Sbjct: 12  AHSKIILIGEHAVVYGYPAIALPLHHIEVTCQIIPADSPWILFEDDT--------LSMAV 63

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           F    S   + I   +  C    ++ S +  + G+GSSAA+++A   A+    Y++E   
Sbjct: 64  F---ASLEHLGIREARIRC----RIQSMVPEKRGMGSSAAVSIAAIRAVF--DYYQEKLD 114

Query: 129 DEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL---- 180
           DE L     +V + + I+    SG+D    +    I +      I  + F +P+ L    
Sbjct: 115 DETLEV---LVNRAETIAHMNPSGLDAKTCLSDQAIKF------IRNVGF-YPLELGIKA 164

Query: 181 ----IYSGYKTPTAQVLKKISYIEIEY-PEINEINQKIYALMGKLSQISCQALRNKNLKV 235
                 +G    T + ++K+     E  P  +EI        G+L+Q   +AL+  +L  
Sbjct: 165 SLVIADTGIHGNTREAIQKVEAKGQEVLPHFHEI--------GQLTQQVEEALKMNDLTN 216

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L QA+      L  +GVS  K   +V    E    + +K+SG GLG CVIAL K
Sbjct: 217 LGQALTTCHEHLRAVGVSCEKADHLVAVALENG-ALGAKMSGGGLGGCVIALVK 269


>gi|255016733|ref|ZP_05288859.1| hypothetical protein LmonF_00681 [Listeria monocytogenes FSL
           F2-515]
          Length = 356

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPV 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMIIETELIDQSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|203284586|ref|YP_002222326.1| mevalonate kinase [Borrelia duttonii Ly]
 gi|201084029|gb|ACH93620.1| mevalonate kinase [Borrelia duttonii Ly]
          Length = 297

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 128/290 (44%), Gaps = 38/290 (13%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +     ++ +GEH  ++G   +   I   + L  T   D          +Y G   L + 
Sbjct: 4   IKKSSKILFLGEHSAVYGFPVIGATIPFYMYLVYTFSTD---------WRYFGEPSLKI- 53

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
               SFI    + ++P    +  + SQ+   LG GSSA++++     +++   H E +  
Sbjct: 54  DEIISFINRNFSKVRP---IEFLIFSQIPVGLGFGSSASLSLCFAEYIVS---HDEYNAY 107

Query: 130 EILTTAHAIVLKVQGISSGID-LAASIHG--------GLICYQMPKYSIEKIDFIFPIHL 180
           + +  A  I     G SSG+D L   ++G        G+  Y+     IE  +F F +  
Sbjct: 108 DKIVLARKIENIFHGKSSGMDILLVELNGTFYLENKNGIFSYK----KIEFCNFYFLVGA 163

Query: 181 IYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +    +  T++++  ++Y I +E  + + I +     +G + + S  A   +++ +LA  
Sbjct: 164 VKR--ECETSKIISDLNYKISVENNQFDIIER-----LGYIVEDSYAAFNKRDIDLLANN 216

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +N     L +L +S + L  I+ + RE   I A K+SG+G G   I L K
Sbjct: 217 INIANKYLNSLELSSNILDYIIARGREFKAI-AGKLSGAGRGGAFILLFK 265


>gi|191638486|ref|YP_001987652.1| Mevalonate kinase [Lactobacillus casei BL23]
 gi|190712788|emb|CAQ66794.1| Mevalonate kinase [Lactobacillus casei BL23]
 gi|327382521|gb|AEA53997.1| Mevalonate kinase [Lactobacillus casei LC2W]
 gi|327385718|gb|AEA57192.1| Mevalonate kinase [Lactobacillus casei BD-II]
          Length = 311

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 23/287 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVIL--YLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           ++L+GEH V++G  A+   + K V L   +T + D    + SS   + G+L+      +F
Sbjct: 12  IILLGEHAVVYGEPAIALPV-KSVGLSARVTPQPDGRQTVTSSF--FTGNLNAGQLT-NF 67

Query: 74  SFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           S I M I  +       + GF L + S L S+ G+GSSAA  VA+  A     +    S 
Sbjct: 68  SGIAMLIRRLLIFFNAKNQGFHLTITSALPSERGMGSSAATAVAVVRAFYD-AFQTSLSH 126

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE---KIDFIFPIHLIYSGY 185
           D +L  A      + G  SG+D A +        + P++ +        + P + +    
Sbjct: 127 DTLLNWAAVSEKALHGNPSGLDAATA------SAERPQWFVRGKAPRSIMMPRNGVLLIA 180

Query: 186 KTPTAQVLK-KISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            T  A   K  +  +     +  ++ + +   +G   + +  AL   ++  L Q  NR Q
Sbjct: 181 DTGVAGQTKIAVGAVADRLKQDPKMYRPLIKDIGDTVRQAALALAQDDIITLGQLFNRDQ 240

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             L  LGVS   L  ++  +        +K++GSG+G C+IAL   D
Sbjct: 241 ADLSALGVSSPDLDRLI-NVAIDNGAYGAKLTGSGMGGCMIALAASD 286


>gi|168053413|ref|XP_001779131.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669491|gb|EDQ56077.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 406

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 120/280 (42%), Gaps = 60/280 (21%)

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE----PS 127
           +F F+  +I  ++P+    ++V S+L    GLGSSAA  VA+T ALL      E    PS
Sbjct: 125 AFLFLYTSILGLQPAT---VRVSSELPVGAGLGSSAAYCVALTTALLAYSREIELPQLPS 181

Query: 128 PDEILTTAHAIVLKVQ-------------------GISSGIDLAASIHGGLICYQMPKYS 168
             E ++T   I   V                    G  SGID   S +G ++ ++  K  
Sbjct: 182 VGEEVSTDRKIWFDVDEKKVDLVNKWAFEGERIIHGRPSGIDNTVSTYGYVVKFK--KGQ 239

Query: 169 IEKIDFIFPIHLIYSGYKT--PTAQVLKKISYIEIEYP--------EINEINQKIY---- 214
           I ++    P+ ++ +  +    T  ++  +    + +P         I+EI +++     
Sbjct: 240 ITRLHTQMPLRMLLTNTQVGRNTKALVAGVGERALRHPAAMGAIFKAIDEIAEEVVTILQ 299

Query: 215 -----ALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPH 269
                A +GK+ +I  Q L + N           QGLL+ +GVS   +  I        +
Sbjct: 300 TPPETARLGKIQEIRLQELVDMN-----------QGLLQGIGVSHLSIESICQIT--AAY 346

Query: 270 IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
            ++SK++G+G G CV+ L    L+S   + V   +  KG 
Sbjct: 347 RLSSKLTGAGGGGCVLTLLPHKLSSTSVELVKVDIEGKGF 386


>gi|254830695|ref|ZP_05235350.1| hypothetical protein Lmon1_05024 [Listeria monocytogenes 10403S]
 gi|255025415|ref|ZP_05297401.1| hypothetical protein LmonocytFSL_02129 [Listeria monocytogenes FSL
           J2-003]
          Length = 356

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPV 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMIIETELIDQSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|203288120|ref|YP_002223135.1| mevalonate kinase [Borrelia recurrentis A1]
 gi|201085340|gb|ACH94914.1| mevalonate kinase [Borrelia recurrentis A1]
          Length = 297

 Score = 56.6 bits (135), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 128/290 (44%), Gaps = 38/290 (13%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +     ++ +GEH  ++G   +   I   + L  T   D          +Y G   L + 
Sbjct: 4   IKKSSKILFLGEHSAVYGFPVIGATIPFYMYLVYTFSTD---------WRYLGEPSLKI- 53

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
               SFI    + ++P    +  + SQ+   LG GSSA++++     +++   H E +  
Sbjct: 54  DEIISFINRNFSKVRP---IEFLIFSQIPVGLGFGSSASLSLCFAEYIVS---HDEYNAY 107

Query: 130 EILTTAHAIVLKVQGISSGID-LAASIHG--------GLICYQMPKYSIEKIDFIFPIHL 180
           + +  A  I     G SSG+D L   ++G        G+  Y+     IE  +F F +  
Sbjct: 108 DKIVLARKIENIFHGKSSGMDILLVELNGTFYLENKNGIFSYK----KIEFCNFYFLVGA 163

Query: 181 IYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +    +  T++++  ++Y I +E  + + I +     +G + + S  A   +++ +LA  
Sbjct: 164 VKR--ECETSKIISDLNYKISVENNQFDIIER-----LGYIVEDSYAAFNKRDIDLLANN 216

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           +N     L +L +S + L  I+ + RE   I A K+SG+G G   I L K
Sbjct: 217 INIANKYLSSLELSSNILDYIIARGREFKAI-AGKLSGAGRGGAFILLFK 265


>gi|261204900|ref|XP_002627187.1| mevalonate kinase [Ajellomyces dermatitidis SLH14081]
 gi|239592246|gb|EEQ74827.1| mevalonate kinase [Ajellomyces dermatitidis SLH14081]
 gi|327348388|gb|EGE77245.1| mevalonate kinase [Ajellomyces dermatitidis ATCC 18188]
          Length = 556

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 97/361 (26%), Positives = 147/361 (40%), Gaps = 92/361 (25%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 112 VSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD-- 169

Query: 61  CGSLDLAMF-HPS---------FSFIIMAINHIKP-----SCGF--DLKVISQ------- 96
             SL   +F HPS          S     +  I+P     S G   D++ I Q       
Sbjct: 170 IDSLPWELFRHPSKKKFYYDSVTSLDTELLEAIQPHVADISIGKPDDVRKIHQSSATAFL 229

Query: 97  -----------------LDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                            L S +    GLGSSA+I V ++AALL LQ       H++  P+
Sbjct: 230 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQPPE 288

Query: 130 EILTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-F 176
           E  T    I        + + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 289 EAETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPEL 348

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQ-----KIYALMGKLSQISCQ 226
           P+ L+ S     TA  + K+      +P ++E     I+Q       +   G     S +
Sbjct: 349 PLLLVNSRQPRSTATEVAKVGKFCKAHPAVSESILEAIDQVTESASDFIQSGDFDSSSIE 408

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           A+ +       +      GLL +LGVS  +L E + +L +      +K++G+G G C I 
Sbjct: 409 AIDH-----FGELFRINHGLLVSLGVSHPRL-ERIRELVDHTGSGWTKLTGAGGGGCAIT 462

Query: 287 L 287
           L
Sbjct: 463 L 463


>gi|330916805|ref|XP_003297568.1| hypothetical protein PTT_08014 [Pyrenophora teres f. teres 0-1]
 gi|311329691|gb|EFQ94339.1| hypothetical protein PTT_08014 [Pyrenophora teres f. teres 0-1]
          Length = 548

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 115/261 (44%), Gaps = 37/261 (14%)

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY------HK 124
           SF ++ +++   K P C + L+  S +    GLGSSA+I+V I+ ALL LQ       H+
Sbjct: 175 SFLYLFLSLASRKVPPCVYTLR--STIPIGAGLGSSASISVCISTALL-LQIRALSGPHQ 231

Query: 125 EPSPDE-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           +  P E       I   A    + + G  SG+D   S  G  + +Q   Y  +K   + P
Sbjct: 232 DQPPQECELNIERINRWAFVGEMCIHGNPSGVDNTVSSGGKAVLFQRRDY--DKPPLVAP 289

Query: 178 IH--------LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK-----LSQIS 224
           +H        L+ +     TA  + K++ +   +P + E       L+ +     L+   
Sbjct: 290 LHSFPELPLLLVNTRQSRSTATEVAKVANLRKVHPALTESILNAIGLVTESAHKLLTSPD 349

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
             A     LK L + +    GLL +LGVS  KL E + ++ +   I  +K++G+G G C 
Sbjct: 350 FDATLPATLKHLGELVTINHGLLVSLGVSHPKL-ERIREIIDHTGIGWTKLTGAGGGGCA 408

Query: 285 IALGKGDLNSLPYQSVNCHMH 305
           I +    L   P    N H H
Sbjct: 409 ITI----LKPQPPALTNDHSH 425


>gi|217965922|ref|YP_002351600.1| phosphomevalonate kinase [Listeria monocytogenes HCC23]
 gi|217335192|gb|ACK40986.1| phosphomevalonate kinase [Listeria monocytogenes HCC23]
          Length = 356

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPI 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELSPVKMVIETELIDQSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|29375488|ref|NP_814642.1| mevalonate kinase [Enterococcus faecalis V583]
 gi|227555015|ref|ZP_03985062.1| mevalonate kinase [Enterococcus faecalis HH22]
 gi|257418498|ref|ZP_05595492.1| mevalonate kinase [Enterococcus faecalis T11]
 gi|29342948|gb|AAO80712.1| mevalonate kinase [Enterococcus faecalis V583]
 gi|227175841|gb|EEI56813.1| mevalonate kinase [Enterococcus faecalis HH22]
 gi|257160326|gb|EEU90286.1| mevalonate kinase [Enterococcus faecalis T11]
 gi|315167961|gb|EFU11978.1| mevalonate kinase [Enterococcus faecalis TX1341]
 gi|315574183|gb|EFU86374.1| mevalonate kinase [Enterococcus faecalis TX0309B]
 gi|315581674|gb|EFU93865.1| mevalonate kinase [Enterococcus faecalis TX0309A]
          Length = 314

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 129/286 (45%), Gaps = 23/286 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMF 69
           A G ++LMGEH V++G  A+ F      +    TL K   + ID +   + G L D+   
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAVFTLAK--TMQIDCAY--FTGLLEDVPQE 66

Query: 70  HPSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +    
Sbjct: 67  LANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTY 126

Query: 128 PD--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHLIY 182
            +  E+++ +  I     G  SGID AA+     + +     P +    +   + + +  
Sbjct: 127 QELFELVSLSEKI---AHGNPSGIDAAATSGADPLFFTRGFPPTHFSMNLSNAYLV-VAD 182

Query: 183 SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M 
Sbjct: 183 TGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLMT 238

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 239 LAQEQLQQLSVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|46906237|ref|YP_012626.1| phosphomevalonate kinase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|254992954|ref|ZP_05275144.1| hypothetical protein LmonocytoFSL_07816 [Listeria monocytogenes FSL
           J2-064]
 gi|255519791|ref|ZP_05387028.1| hypothetical protein LmonocFSL_00915 [Listeria monocytogenes FSL
           J1-175]
 gi|46879501|gb|AAT02803.1| phosphomevalonate kinase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|332310346|gb|EGJ23441.1| Phosphomevalonate kinase [Listeria monocytogenes str. Scott A]
          Length = 356

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPI 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETELIDQSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|239611598|gb|EEQ88585.1| mevalonate kinase [Ajellomyces dermatitidis ER-3]
          Length = 545

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 97/367 (26%), Positives = 150/367 (40%), Gaps = 92/367 (25%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 101 VSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD-- 158

Query: 61  CGSLDLAMF-HPS---------FSFIIMAINHIKP-----SCG--FDLKVISQ------- 96
             SL   +F HPS          S     +  I+P     S G   D++ I Q       
Sbjct: 159 IDSLPWELFRHPSKKKFYYDSVTSLDTELLEAIQPHVADISIGKPDDVRKIHQSSATAFL 218

Query: 97  -----------------LDSQL----GLGSSAAITVAITAALLTLQY------HKEPSPD 129
                            L S +    GLGSSA+I V ++AALL LQ       H++  P+
Sbjct: 219 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQPPE 277

Query: 130 EILTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-F 176
           E  T    I        + + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 278 EAETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPEL 337

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQ-----KIYALMGKLSQISCQ 226
           P+ L+ S     TA  + K+      +P ++E     I+Q       +   G     S +
Sbjct: 338 PLLLVNSRQPRSTATEVAKVGKFCKAHPAVSESILEAIDQVTESASDFIQSGDFDSSSIE 397

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           A+ +       +      GLL +LGVS  +L E + +L +      +K++G+G G C I 
Sbjct: 398 AIDH-----FGELFRINHGLLVSLGVSHPRL-ERIRELVDHTGSGWTKLTGAGGGGCAIT 451

Query: 287 LGKGDLN 293
           L + + +
Sbjct: 452 LLRANTD 458


>gi|119953466|ref|YP_945675.1| mevalonate kinase [Borrelia turicatae 91E135]
 gi|119862237|gb|AAX18005.1| mevalonate kinase [Borrelia turicatae 91E135]
          Length = 297

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 126/282 (44%), Gaps = 26/282 (9%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +  P  ++ +GEH  ++G       I   + LY+ L     + I S   +Y G   L + 
Sbjct: 4   IKKPSKILFLGEHSAVYGFPV----IGTTIPLYMYL-----VYIFSDSWKYLGVPSLKI- 53

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                FI    N ++P    +  + SQ+   LG GSSA++++     +++   H E    
Sbjct: 54  DEVIHFINKRFNKVRPV---EFLIFSQIPVGLGFGSSASLSLCFAEYIVS---HDEYRTY 107

Query: 130 EILTTAHAIVLKVQGISSGID-LAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYKT 187
           + +  A  I     G SSG+D L   + G     +    +S  +I F     LI +  + 
Sbjct: 108 DKILLAREIENIFHGRSSGMDVLLVELDGTFYLERKNGSFSYRRIAFCNFYFLIGAVRRE 167

Query: 188 -PTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
             T +++  ++Y I ++  +  EI +K    +G + + S  A   +++ +LA  MN    
Sbjct: 168 CTTNKIVSDLNYRISLDNSQF-EIIEK----LGCIVKNSYIAFNKRDILLLANNMNVANN 222

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            L +LG+S   L  ++ K R Q   ++ K+SG+G G   I L
Sbjct: 223 YLNSLGLSSCTLDYVIEKGR-QFEALSGKLSGAGRGGAFILL 263


>gi|326771746|ref|ZP_08231031.1| phosphomevalonate kinase [Actinomyces viscosus C505]
 gi|326637879|gb|EGE38780.1| phosphomevalonate kinase [Actinomyces viscosus C505]
          Length = 395

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 86/195 (44%), Gaps = 43/195 (22%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            I   APG L + GE+ V+  GH A++ A+++    ++T+R    I   S  G+Y G++ 
Sbjct: 9   DIVSRAPGKLYIAGEYAVVEPGHRAVLVAVDR----FITIR----ITPCSPAGEYAGTIS 60

Query: 66  LAMF---------HP----------SFSFIIMAINHI---------KPSCGFDLKVISQL 97
             ++          P             +II AI  +         +P   FDL V S+L
Sbjct: 61  SRLYANGSRSWRRRPQDGQAEAVGGEDDYIISAIRVVETLVTQGGGRPRS-FDLSVSSEL 119

Query: 98  DS----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAA 153
           +     +LGLGSS+A+TVA   A+ T  Y        +   A      VQ I SG D+AA
Sbjct: 120 EENDGRKLGLGSSSAVTVATVRAVATF-YGMAADDLTVYKLAMLASDTVQPIGSGGDIAA 178

Query: 154 SIHGGLICYQMPKYS 168
           S   G + Y  P  S
Sbjct: 179 SAMTGWVAYTSPDRS 193


>gi|289433385|ref|YP_003463257.1| phosphomevalonate kinase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169629|emb|CBH26163.1| phosphomevalonate kinase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 360

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLG 58
           Q  +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ + 
Sbjct: 4   QMKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVS 63

Query: 59  QYCGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSS 106
              G  +L      ++F   AIN       S G +L         ++I +  ++ GLGSS
Sbjct: 64  WPVGG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMMIETELIDKSGAKYGLGSS 122

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           AA TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 123 AAATVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 177


>gi|163790896|ref|ZP_02185320.1| phosphomevalonate kinase [Carnobacterium sp. AT7]
 gi|159873849|gb|EDP67929.1| phosphomevalonate kinase [Carnobacterium sp. AT7]
          Length = 358

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 144/339 (42%), Gaps = 73/339 (21%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           I  SAPG L + GE+ V+  G+ A++ A+++ + + L  + +R+ +I S   QY      
Sbjct: 2   IEASAPGKLYIAGEYAVVEPGYPAILVAVDQFITVSLE-KSERVGSITSF--QYGNLPIL 58

Query: 63  ------SLDLAMFHPSFSFIIMAI--------NHIKPSCGFDLKVISQLDS----QLGLG 104
                  L L      F +I+ AI           K    + L V S+LDS    + GLG
Sbjct: 59  WKRENDRLVLDKRENPFHYILAAIRVTEEYAKEQGKELSFYHLTVDSELDSSQGKKYGLG 118

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM 164
           SSAA+TVA   AL    Y    S + I   A    L V+   S  D+AAS++GG + +  
Sbjct: 119 SSAAVTVATVHALCRF-YKLTDSKNVIFKLAALAHLSVKSNGSCGDVAASVYGGWLAFTT 177

Query: 165 --PKYSIEK---------IDFIFPIHLIYSGYKTP-------------------TAQVLK 194
             P + +++         ++  +P HL ++    P                     +V  
Sbjct: 178 FDPAWVLDQKEHNTVKELVEMDWP-HLSFTPLSPPKDLRLVIGWTGSPASTSHLVDEVTN 236

Query: 195 KISYIEIEYPEINE-----INQKIYALM-GKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           K S   + Y    E     +N  I A   G +++I  Q  +N+ L  L Q        +E
Sbjct: 237 KRSQDAMAYDIFLEKSKECVNAMITAFQEGNVTEIQRQIRKNRQL--LLQMSQDTSVTIE 294

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           T  +  +KL E+  K +      A+K SG+G GDC I +
Sbjct: 295 TPAL--TKLCEMAEKFK-----GAAKSSGAGGGDCGIVI 326


>gi|254787178|ref|YP_003074607.1| mevalonate kinase [Teredinibacter turnerae T7901]
 gi|237686004|gb|ACR13268.1| mevalonate kinase [Teredinibacter turnerae T7901]
          Length = 318

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 128/287 (44%), Gaps = 22/287 (7%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI-------NIDSSLGQYCGS 63
           SA G ++L GEH V++G  A+   I + +   +       I       ++D   G++   
Sbjct: 12  SACGKVILFGEHAVVYGVPAIAGGIQQAMRARIIQSAPNEIRVSIPKWSVDVCQGEHRPG 71

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
            +L  F    +F++        S GF L++   +    GLG+SAA+ VA   AL    Y 
Sbjct: 72  TEL--FEAYLAFLLDKFQ--LASRGFCLELDPTITHASGLGASAAVAVASIRALA--DYA 125

Query: 124 KEPSPDE-ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--PKYSIEKIDFIFPIHL 180
           K P  DE I T A        G  SG+D   + +GG+  YQ    +     +    P  L
Sbjct: 126 KRPLSDEDINTLAFGCEKIAHGSPSGLDNTLATYGGIQLYQRNGEQAQCSALQLAKPFRL 185

Query: 181 IY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
           +   SG +  TA  +++++      P+  +    I+  +G ++  +  AL++  L  +A+
Sbjct: 186 LVALSGKQGFTAATVERVAKARAAEPQKYD---AIFDSIGNITARASNALQHGELAEVAE 242

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
            M   Q  L  LGVS  ++  ++  L      + +K++GSG G  VI
Sbjct: 243 LMTENQLQLRALGVSCDEIEHVI-SLAMSQGALGAKLTGSGDGGAVI 288


>gi|293333338|ref|NP_001170136.1| hypothetical protein LOC100384063 [Zea mays]
 gi|224033759|gb|ACN35955.1| unknown [Zea mays]
          Length = 405

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 151/362 (41%), Gaps = 91/362 (25%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAI----NKRVILY----------------LTLR 46
           ++   APG ++L GEH V+HG AA+  AI    N  ++L                 L LR
Sbjct: 15  EVRARAPGKIILTGEHAVVHGSAAVAAAIDLYTNSSLLLRPAGPGEGGGAGSSAVELDLR 74

Query: 47  KDRLI------NIDSSLGQY----------CGSLDLAMFH-------------------P 71
              L        +  +LG+           C    LA                       
Sbjct: 75  DSGLTFSWPCSRLRGALGEEISANPGAPAPCSPDQLAAIARLLQDQDIPEAKIWLSAGLS 134

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT------LQYHKE 125
           +F F+  +I   +P       V S L    GLGSSAA  V+++ ALLT      +  H+ 
Sbjct: 135 AFLFLYTSILGCRPGKAV---VSSDLPMGAGLGSSAAFCVSMSGALLTAAGAVSVGAHRG 191

Query: 126 PSPDEILTTAHAIVLK---------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
               E+L      ++          + G  SGID + S  G +I ++  K  +  ++   
Sbjct: 192 AEGWEVLEKGALELVNQWAFQGEKIIHGKPSGIDNSVSTFGKMIKFK--KGELTNLESRN 249

Query: 177 PIHLIYSGYKTP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQ 226
           P+ ++ +  +    T  ++  +S     +P+        +N I++++ +++  +++    
Sbjct: 250 PVKMLITDTRVGRNTKALVAGVSERASRHPDAMASVFHAVNTISEELSSIVELVAEDEI- 308

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVI 285
           A+ +K  K LA+ M   QGLL+ +GVS S +  +   LR    + + SK++G+G G CV+
Sbjct: 309 AITSKEDK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKYSLVSKLTGAGGGGCVL 364

Query: 286 AL 287
            L
Sbjct: 365 TL 366


>gi|258539704|ref|YP_003174203.1| mevalonate kinase [Lactobacillus rhamnosus Lc 705]
 gi|257151380|emb|CAR90352.1| Mevalonate kinase [Lactobacillus rhamnosus Lc 705]
          Length = 311

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 128/301 (42%), Gaps = 51/301 (16%)

Query: 16  LVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFS 74
           ++L+GEH V++G  A+   +   R++  +    D    + S+   + G L+      +F+
Sbjct: 12  IILIGEHAVVYGEPAIALPVKSIRLLAKVEPIPDGRQEVTSAF--FTGDLNAGQLT-NFA 68

Query: 75  FIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
            I M I  +         GF L + S L S+ G+GSSAA  VA+  A            D
Sbjct: 69  GIAMLIRQLLVFFNAADQGFHLTITSALPSERGMGSSAATAVAVVRAFY----------D 118

Query: 130 EILTT-AHAIVLKVQGIS--------SGIDLAAS--------IHG-GLICYQMPKYSIEK 171
              T+ +H+++L   GIS        SG+D A +        + G  L    MP+  +  
Sbjct: 119 AFQTSLSHSVLLNWAGISEKALHGNPSGLDAATASAEKPQWFVRGKSLRSIMMPRNGV-- 176

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-PEINEINQKIYALMGKLSQISCQALRN 230
              +     I    K    QV +K+      Y P I +I        G   + +  AL  
Sbjct: 177 --LLIADTGIAGQTKIAVDQVAQKLKKDPKTYQPLITDI--------GDAVRQAALALAQ 226

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
            ++  L Q +NR Q  L  LGVS  +L  ++  +        +K++GSG+G C+IAL   
Sbjct: 227 DDIITLGQLLNRDQADLAALGVSSPELDRLI-NVALDNGAYGAKLTGSGMGGCMIALAAA 285

Query: 291 D 291
           D
Sbjct: 286 D 286


>gi|307286711|ref|ZP_07566797.1| mevalonate kinase [Enterococcus faecalis TX0109]
 gi|306502189|gb|EFM71473.1| mevalonate kinase [Enterococcus faecalis TX0109]
 gi|315165236|gb|EFU09253.1| mevalonate kinase [Enterococcus faecalis TX1302]
          Length = 314

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 128/285 (44%), Gaps = 21/285 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHLIYS 183
           +  E+++ +  I     G  SGID AA+     + +     P +    +   + + +  +
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFFTRGFPPTHFSMNLSNAYLV-VADT 183

Query: 184 GYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M  
Sbjct: 184 GIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLMTL 239

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 240 AQEQLQQLSVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|239631425|ref|ZP_04674456.1| mevalonate kinase [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|239525890|gb|EEQ64891.1| mevalonate kinase [Lactobacillus paracasei subsp. paracasei 8700:2]
          Length = 311

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 23/287 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVIL--YLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           ++L+GEH V++G  A+   + K V L   +T + D    + SS   + G+L+      +F
Sbjct: 12  IILLGEHAVVYGEPAIALPV-KSVGLSARVTPQPDGRQTVTSSF--FTGNLNAGQLT-NF 67

Query: 74  SFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + I M I  +       + GF L + S L S+ G+GSSAA  VA+  A     +    S 
Sbjct: 68  AGIAMLIRRLLIFFNAKNQGFHLTITSALPSERGMGSSAATAVAVVRAFYD-AFQTSLSH 126

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE---KIDFIFPIHLIYSGY 185
           D +L  A      + G  SG+D A +  G       P++ +        + P + +    
Sbjct: 127 DTLLNWAAVSEKALHGNPSGLDAATASAG------RPQWFVRGKAPRSIMMPRNGVLLIA 180

Query: 186 KTPTAQVLK-KISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            T  A   K  +  +     +  ++ + +   +G   + +  AL   ++  L Q  NR Q
Sbjct: 181 DTGVAGQTKIAVGAVADRLKQDPKMYRPLIKDIGDTVRQAALALAQDDIITLGQLFNRDQ 240

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             L  LGVS   L  ++  +        +K++GSG+G C+IAL   D
Sbjct: 241 ADLSALGVSSPDLDRLI-NVAIDNGAYGAKLTGSGMGGCMIALAASD 286


>gi|315645839|ref|ZP_07898960.1| galactokinase [Paenibacillus vortex V453]
 gi|315278600|gb|EFU41914.1| galactokinase [Paenibacillus vortex V453]
          Length = 386

 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 139/336 (41%), Gaps = 51/336 (15%)

Query: 2   GQCLHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  H++ + +APG + L+GEH   +G   L  A+     L +  R D+ ++  S+   Y
Sbjct: 15  GESRHEVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDKKVSFSSTNIPY 74

Query: 61  --CGSLDLAMFHPSFSF------IIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAIT 110
               SLD    + S  +      +I  ++ I    S G+DL     + +  GL SSA+I 
Sbjct: 75  ELTISLDEDYRYKSDQWTDYPVGVITELHKIGSNLSSGYDLLYHGDIPNGAGLSSSASIE 134

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------------ 158
           V    ALL+++  K     EI   +  +     G++SGI    ++  G            
Sbjct: 135 VVTAYALLSME-GKAADTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMCDT 193

Query: 159 ----LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ--- 211
               L+ +Q   Y I   +      L+ S Y    ++  + +  ++ E P +  + Q   
Sbjct: 194 LEYELVPFQTGPYKIVISNTNKRRGLVDSKYNERRSECDRALEILQNELPALTYLAQLNP 253

Query: 212 -KIYALMGKLSQ------------------ISCQALRNKNLKVLAQAMNRQQGLLETL-G 251
            +   L   +                     S +AL+N +L+   Q MN+    L  L  
Sbjct: 254 DQFVTLQDNIQDETVRRRAQHVVEENQRVLDSVKALKNGDLESFGQYMNQSHDSLRYLYE 313

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           V+  +L  +V + +  P  + S+++G+G G C ++L
Sbjct: 314 VTGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSL 349


>gi|320532060|ref|ZP_08032946.1| phosphomevalonate kinase [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320135727|gb|EFW27789.1| phosphomevalonate kinase [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 379

 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 135/343 (39%), Gaps = 74/343 (21%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           +   APG L + GE+ V+  GH A++ A+N+    ++T+R    I   S  G Y G++  
Sbjct: 8   VVARAPGKLYIAGEYAVVEPGHRAVLVAVNR----FITMR----ITPCSPAGGYAGTIRS 59

Query: 67  AMF---------HP----------SFSFIIMAINHIKPSCG--------FDLKVISQLDS 99
            ++          P             ++I AI  ++            FDL + S+LD 
Sbjct: 60  QLYATGSRPWRHRPQDGLAEAVGGDDDYVISAIRVVEALVAEGGGRLGSFDLDISSELDE 119

Query: 100 ----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI 155
               +LGLGSS+A+TVA   A+    Y        +   A      VQ I SG D+AAS 
Sbjct: 120 ADGRKLGLGSSSAVTVATVRAVAGF-YGLSLDDSRVYKLAMLASDAVQPIGSGGDIAASA 178

Query: 156 HGGLICYQMPKY---------------SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE 200
             G + Y  P                 + + ++  +P  L       P+ ++    +   
Sbjct: 179 VTGWVAYASPDRVWLRRARQRAQARGGTGDLMESDWP-GLRLRRLPVPSVRLQVGWTGAP 237

Query: 201 IEYPEI-------NEINQKIYALMGKLSQISC-----QALRNKNLKVLAQAMNRQQGLLE 248
              P +       +     +YA   + SQ  C      A+   +   +  A+ R + LL 
Sbjct: 238 ASTPALVAGVQAGSRGADDVYASFLRASQ-DCLASLTAAIEADDAGQVMSAITRNRALLA 296

Query: 249 TLGVSDSKLSEIVWKLR----EQPHIMASKISGSGLGDCVIAL 287
            LG    ++ E     R     + H  A+K SG+G GDC IAL
Sbjct: 297 QLGRISGRVIETPELTRLVEIARAHGAAAKSSGAGGGDCGIAL 339


>gi|332840390|ref|XP_003313983.1| PREDICTED: mevalonate kinase isoform 1 [Pan troglodytes]
          Length = 396

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 131/320 (40%), Gaps = 78/320 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   RL
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 67

Query: 51  INIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAI---NHI 83
            ++D+S                 L +  G  D       LA+   +F ++ ++I      
Sbjct: 68  QSLDASFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQRA 125

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            PS   D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L
Sbjct: 126 LPS--LDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     
Sbjct: 183 ELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRN 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + +
Sbjct: 243 TRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYVVLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|297242908|ref|ZP_06926846.1| isopentenyl pyrophosphate isomerase [Gardnerella vaginalis AMD]
 gi|296889119|gb|EFH27853.1| isopentenyl pyrophosphate isomerase [Gardnerella vaginalis AMD]
          Length = 787

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 92/381 (24%), Positives = 151/381 (39%), Gaps = 110/381 (28%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-------LRKDRLINIDSSLGQYCGS 63
           SAPG L + GE+ V+ G AA+V A+N+ V + ++       LR++   N  SS   YCG 
Sbjct: 7   SAPGKLYIAGEYAVVDGCAAIVAAVNRYVTVSVSDETLNEELRENLQKNAPSSR-NYCGV 65

Query: 64  L--DLAMFHP-----------------SFSFIIMAI----NHIKPSCG-------FDLKV 93
           +  D   + P                  +++++ A+     +    C        +++ +
Sbjct: 66  ITSDGEKYKPLLWSRASDGSIEIQNDGKYAYVLAAMCVVDAYASEECAPNINRKSYNVHI 125

Query: 94  ISQLDS-----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG 148
            S+LD      + GLGSSAA+TVA+  AL    Y    S  EI   A      V+   SG
Sbjct: 126 SSELDDVKTGRKYGLGSSAAVTVAVIRALCKW-YDLNLSTPEICKLALIASSSVKKSGSG 184

Query: 149 IDLAASIHGGLICYQ----------------------------MPKYSIEKIDFIFPIHL 180
            D+AAS +GG I Y+                             P+  +++++    + L
Sbjct: 185 GDVAASSYGGWIMYRAYNREWLEAELTLVKSGCSDFSELLHKKWPRLEVKRLNVDKSLKL 244

Query: 181 -----------------IYSGYKTPTAQVLKKISYIEIEYP-EINEINQKI----YALMG 218
                            + S  KT T   ++  +   +E   E +  ++KI    Y    
Sbjct: 245 LVGWTGSPASSAKLVSSVESSVKTSTESSVESNAENNVESSVETSAFDKKIKSFTYEDFC 304

Query: 219 KLSQISCQ----ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA-- 272
           K S+I  Q    A+    +  +     + + LL+ L    S L+  V + RE    +   
Sbjct: 305 KQSEICVQKLARAIEKFEISEIYSGFAQNRALLQKL----SALTGTVIETRELTKFIEIA 360

Query: 273 ------SKISGSGLGDCVIAL 287
                 +K SG+G GDC IAL
Sbjct: 361 TCAGIPAKTSGAGGGDCAIAL 381


>gi|260803413|ref|XP_002596584.1| hypothetical protein BRAFLDRAFT_219207 [Branchiostoma floridae]
 gi|229281843|gb|EEN52596.1| hypothetical protein BRAFLDRAFT_219207 [Branchiostoma floridae]
          Length = 384

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 89/377 (23%), Positives = 142/377 (37%), Gaps = 83/377 (22%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR----LINIDSSLGQYCG 62
           ++ VSAPG ++L GEH V++G  A+  +++ R  L + L  D     L   D  L +   
Sbjct: 5   EVVVSAPGKVILFGEHAVVYGRKAIASSLDLRTHLEVHLLPDSTSVTLELPDIHLSKTWQ 64

Query: 63  SLDLAMFHPS--------------------------------FSFIIMAIN-HIKPSC-G 88
             DLA   P+                                 +F+ M  + H    C  
Sbjct: 65  MADLAAARPTGNPSPPSDQYLAALHRLAGTDADNTDARSLALLAFLYMYTSIHATARCPA 124

Query: 89  FDLKVISQLDSQLGLGSSAAITVAITAALLTL-----QYHKEPSPDEILTTAHAIVLK-- 141
                 SQL    GLGSSAA   A+ A LLT+     +   +   D         V+   
Sbjct: 125 GRFHASSQLPPGAGLGSSAAYCTALAAGLLTMCDVITRQEGKNGADTAWCKDDLEVINSW 184

Query: 142 -------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLK 194
                  + G  SGID + S  GG I ++  + S  K      I L+ +     T  +++
Sbjct: 185 AFQGERLIHGNPSGIDNSVSTFGGAISFKSGEISAFKSVAQLKILLVNTKVPRSTKVLVQ 244

Query: 195 KISYIEIEYPEINEINQKIYALMGKLSQISC-----------------QALRNKNLKVLA 237
            +       P I E       ++  + +ISC                 +  + K  +VL 
Sbjct: 245 GVRDRYNRLPAIME------PVLNSIEEISCTCEKVLQELGSPTVEIKENTQGKYYQVLE 298

Query: 238 QAMNRQQGLLETLGV---SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
           + ++  Q LL  +GV   S  K+S I  K     H + SK++G+G G C + L + D  +
Sbjct: 299 ELVDICQCLLNAIGVGHPSLDKVSSITSK-----HGLHSKLTGAGGGGCALVLLRPDTAA 353

Query: 295 LPYQSVNCHMHAKGIDI 311
                V   +   G D+
Sbjct: 354 DVIDKVTTELRDCGFDV 370


>gi|310823052|ref|YP_003955410.1| phosphomevalonate kinase [Stigmatella aurantiaca DW4/3-1]
 gi|309396124|gb|ADO73583.1| phosphomevalonate kinase [Stigmatella aurantiaca DW4/3-1]
          Length = 359

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 125/323 (38%), Gaps = 53/323 (16%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
            +SAPG L + GE+ VL G  + V A+  R    +  R D  +++    G   GS     
Sbjct: 4   ALSAPGKLFVSGEYAVLWGGMSRVLAVAPRTAALVRRRPDARVHVCLEEGTLAGSATPKG 63

Query: 69  FH------PSFSFIIMAIN-----HIKPSCGFDLKV----ISQLDSQLGLGSSAAITV-A 112
                   P FSF+   ++     H + S GF+L +    +     +LG+G SA  TV A
Sbjct: 64  VRWEREVPPGFSFVARTLDEALRAHGRQSVGFELAMAPSAVGPGGLKLGMGGSACATVLA 123

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--------- 163
             AA   L    E   D +  +  A  L   G  SG D+AAS  GGL+ Y+         
Sbjct: 124 ADAARFIL----EERFDTLKLSLVAHSLGQGGKGSGGDVAASFAGGLLRYRRYDTSALLT 179

Query: 164 -----------MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQK 212
                      +   S++      P   +   +   +A     IS +E    E     Q 
Sbjct: 180 ASSAGGFRAALLEAPSVDVWRLPAPKLAMAYAFTGESASTRVLISQVEARLAESG--RQA 237

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA 272
                  L     + L   + +  ++A+  QQ LL+ LG ++++       +R    I A
Sbjct: 238 FVERSDALGHALEEGLGGGDFRTFSEAVTAQQRLLQELGPTETE------SMRRVLAIAA 291

Query: 273 S-----KISGSGLGDCVIALGKG 290
           S     K SG+G GD  I    G
Sbjct: 292 SYGGVGKQSGAGGGDGCILFAPG 314


>gi|326432795|gb|EGD78365.1| hypothetical protein PTSG_09431 [Salpingoeca sp. ATCC 50818]
          Length = 382

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 135/344 (39%), Gaps = 70/344 (20%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI-------NID----- 54
           +I  SAPG L+L GEH V+HG  A+  +++ R  L LTL  D  +       NID     
Sbjct: 3   EIRASAPGKLILHGEHAVVHGKLAVAASLDLRASLVLTLNDDAKVKLSLAELNIDIDFPL 62

Query: 55  ------SSLGQYCGSLDLAMFHP----------------SFSFIIMAI------------ 80
                 S+ G     LD  ++                  S  F + A+            
Sbjct: 63  SDLPQVSAEGASSTQLDQPLYQAIHTLVAARDELSEGLESRRFAVEALLYLYCGIVKATS 122

Query: 81  ----NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAH 136
               +   PS G  + V S L    GLGSSAA +V + +++L L    + +    L   +
Sbjct: 123 TQEQDEQSPS-GVTINVKSDLPIGAGLGSSAAYSVCLASSMLALTRPIDAANAADLDAIN 181

Query: 137 AIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQV 192
           A        + G  SG+D   S  GG + +   K++         + L+ +G    T  +
Sbjct: 182 AWAFLSESIIHGKPSGLDNTISCFGGAVSFASGKFNRVSTFQSLEVVLVDTGVPRSTKAL 241

Query: 193 LKKISYIEIEYPEINEINQKIYALMGKLSQ----ISCQALRNKN----LKVLAQAMNRQQ 244
           +  +   + E+P + +    +   MG LSQ    IS Q     +       L   M    
Sbjct: 242 VSGVRERKHEFPAVMD---PLLDSMGHLSQTFLDISQQLAETSDTDPLFTKLETLMTMNH 298

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHI-MASKISGSGLGDCVIAL 287
            +L  +GV    L ++V   R    + +A+K++G+G G C   L
Sbjct: 299 HMLNAIGVGHPALDDVV---RLASSLGLAAKLTGAGGGGCAYVL 339


>gi|208965228|dbj|BAG72628.1| mevalonate kinase [synthetic construct]
          Length = 396

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 131/318 (41%), Gaps = 74/318 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   RL
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLNLPNIGIKRAWDVARL 67

Query: 51  INIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIKPS 86
            ++D+S                 L +  G  D       LA+   +F ++ ++I   + +
Sbjct: 68  QSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQRA 125

Query: 87  C-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTT 134
               D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L  
Sbjct: 126 LPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDLEL 184

Query: 135 AHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
            +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     T 
Sbjct: 185 INKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRNTR 244

Query: 191 QVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + ++ 
Sbjct: 245 ALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELIDM 300

Query: 243 QQGLLETLGVSDSKLSEI 260
            Q  L  LGV  + L ++
Sbjct: 301 NQHHLNALGVGHASLDQL 318


>gi|320546919|ref|ZP_08041221.1| mevalonate kinase [Streptococcus equinus ATCC 9812]
 gi|320448437|gb|EFW89178.1| mevalonate kinase [Streptococcus equinus ATCC 9812]
          Length = 292

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 134/284 (47%), Gaps = 32/284 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       D+ I+ D     Y  +L  A++  
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIEVECRIYPADKKIHFD-----YYDTLSTAVYAA 64

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                +  +NH   S  +D++  S++  + G+GSSAA+++A   A+     + E S D  
Sbjct: 65  -----LEYLNHTDVSITYDIR--SEIPQKRGMGSSAAVSIAAIRAVFD---YFEQSID-- 112

Query: 132 LTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
           + T   +V K + I+    SG+D    +    I + +       +D     +L+   +G 
Sbjct: 113 MDTLEILVNKAEIIAHSNPSGLDAKTCLSDNAITF-IRNIGFSALDLGLDAYLVIADTGI 171

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + ++K++  E       E N    A +G L+++  +A+++K +  +   M +   
Sbjct: 172 YGNTREAVEKVAQAE-------EANLPHLAALGDLTEMVQKAIQDKAISEIGPLMTKAHS 224

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            L+ +GVS  K  ++V ++  +   + +K+SG G G C+IAL +
Sbjct: 225 HLQAIGVSIEKADQLV-QISLENGALGAKMSGGGAGGCIIALAQ 267


>gi|62089024|dbj|BAD92959.1| mevalonate kinase variant [Homo sapiens]
          Length = 421

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 132/320 (41%), Gaps = 74/320 (23%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD------------------- 48
           + VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   
Sbjct: 31  LLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLNLPNIGIKRAWDVA 90

Query: 49  RLINIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIK 84
           RL ++D+S                 L +  G  D       LA+   +F ++ ++I   +
Sbjct: 91  RLQSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQ 148

Query: 85  PSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            +    D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L
Sbjct: 149 RALPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDL 207

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     
Sbjct: 208 ELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRN 267

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + +
Sbjct: 268 TRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELI 323

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 324 DMNQHHLNALGVGHASLDQL 343


>gi|33303805|gb|AAQ02416.1| mevalonate kinase [synthetic construct]
          Length = 397

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 131/318 (41%), Gaps = 74/318 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   RL
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 67

Query: 51  INIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIKPS 86
            ++D+S                 L +  G  D       LA+   +F ++ ++I   + +
Sbjct: 68  QSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQRA 125

Query: 87  C-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTT 134
               D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L  
Sbjct: 126 LPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDLEL 184

Query: 135 AHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
            +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     T 
Sbjct: 185 INKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRNTR 244

Query: 191 QVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + ++ 
Sbjct: 245 ALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELIDM 300

Query: 243 QQGLLETLGVSDSKLSEI 260
            Q  L  LGV  + L ++
Sbjct: 301 NQHHLNALGVGHASLDQL 318


>gi|229552295|ref|ZP_04441020.1| possible mevalonate kinase [Lactobacillus rhamnosus LMS2-1]
 gi|229314277|gb|EEN80250.1| possible mevalonate kinase [Lactobacillus rhamnosus LMS2-1]
          Length = 311

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 130/301 (43%), Gaps = 51/301 (16%)

Query: 16  LVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFS 74
           ++L+GEH V++G  A+   +   R++  +    D    + S+   + G L+      +F+
Sbjct: 12  IILIGEHAVVYGEPAIALPVKSIRLLAKVEPIPDGRQEVTSAF--FTGDLNAGQLT-NFA 68

Query: 75  FIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
            I M I  +         GF L + S L S+ G+GSSAA  VA+  A            D
Sbjct: 69  GIAMLIRQLLVFFNAADQGFHLTITSALPSERGMGSSAATAVAVVRAFY----------D 118

Query: 130 EILTT-AHAIVLKVQGIS--------SGIDLAAS--------IHG-GLICYQMPKYSIEK 171
              T+ +H+++L   GIS        SG+D A +        + G  L    MP+  +  
Sbjct: 119 AFQTSLSHSVLLNWAGISEKALHGNPSGLDAATASAEKPQWFVRGKSLRSIMMPRNGV-- 176

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-PEINEINQKIYALMGKLSQISCQALRN 230
              +     I    K    QV +K+      Y P I +I    YA+     + +  AL  
Sbjct: 177 --LLIADTGIAGQTKIAVDQVAQKLKKDPKTYQPLITDIG---YAV-----RQAALALAQ 226

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
            ++  L Q +NR Q  L  LGVS  +L  ++  +        +K++GSG+G C+IAL   
Sbjct: 227 DDIITLGQLLNRDQADLAALGVSSPELDRLI-NVALDNGAYGAKLTGSGMGGCMIALAAA 285

Query: 291 D 291
           D
Sbjct: 286 D 286


>gi|146387257|pdb|2HFS|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase
 gi|146387258|pdb|2HFS|B Chain B, Crystal Structure Of L. Major Mevalonate Kinase
          Length = 332

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 122/282 (43%), Gaps = 14/282 (4%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMFHPS 72
           G ++L GEH V+HG  A+V  I++     L +      + +D       G +        
Sbjct: 20  GKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQVDDQRPAIPGYI-AQKRDEQ 78

Query: 73  FSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                + ++H+K      G    +   L    G+G+SA+  VA + AL  L Y    + +
Sbjct: 79  IKAHQLVLDHLKVDLSGDGLKXFIGGPLVPSSGIGASASDVVAFSRALSEL-YQLNLTDE 137

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICY--QMPKYSIEKIDFIFPIHLIY--SGY 185
           E+  +A        G  SG D  A+ +GGLI Y  Q  K   + I F   ++L+   +G 
Sbjct: 138 EVNLSAFVGEGGYHGTPSGADNTAATYGGLILYRRQNGKSVFKPIAFQQRLYLVVVGTGI 197

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              TA+V+  +   + + P      +++Y     +   + +AL+  +L+ L Q  N    
Sbjct: 198 NASTAKVVNDVHKXKQQQP---VQFKRLYDNYTHIVSQAREALQKGDLQRLGQLXNANHD 254

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L   + VS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 255 LCRQIDVSCRELESIVQTCRTY-GALGAKLSGTGRGGIAVAL 295


>gi|302023329|ref|ZP_07248540.1| phosphomevalonate kinase [Streptococcus suis 05HAS68]
 gi|330832130|ref|YP_004400955.1| phosphomevalonate kinase [Streptococcus suis ST3]
 gi|329306353|gb|AEB80769.1| phosphomevalonate kinase [Streptococcus suis ST3]
          Length = 359

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 93/340 (27%), Positives = 146/340 (42%), Gaps = 71/340 (20%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC---- 61
           K+ V  PG L L GE+ V+  G+ A++ A+++ + + +      L++    +  Y     
Sbjct: 2   KVQVKIPGKLFLAGEYAVVEAGYPAVIAAVDQYLTVTIETSDRGLLHSSQQVDLYLIWER 61

Query: 62  --GSLDLAMFHPSFSFI--IMAINHIKPSC-------GFDLKVISQLDSQL-----GLGS 105
             G   +   HP ++ I  +M +     +         + L V S LD Q      GLGS
Sbjct: 62  KEGIAHVQGDHP-YALIETVMQVTEAYLTAKGYACHGTYSLAVQSDLDDQTSGAKYGLGS 120

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGI-DLAASIHGGLICYQ 163
           S A+TVA   ALLT   H+   PD +LT   A + + + G++    DLAAS  GGLI Y+
Sbjct: 121 SGAVTVATVKALLTYYGHR---PDALLTYKLAALAQTKLGMTGSFGDLAASSFGGLIAYR 177

Query: 164 ----------MPKYSIEKI---DF----IFPIHL-----IYSGYKTPTAQVLKKISYIEI 201
                     M + S+  +   D+    I PI L     +  G+    A     +S +E 
Sbjct: 178 SLDRSWLLGKMAELSLLDLVESDWQSLSISPIQLPQGLDLLVGWTGSAASTDSLVSQMES 237

Query: 202 EYPEINE--------------INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           +  +I +              + Q I A     S    QAL  +N K+L Q   R  GL+
Sbjct: 238 QKSQIEKEQIHVQFLADSKICVEQLIVACQTNDSASVRQAL-TQNRKLL-QDFARGMGLV 295

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
               +   +LS++      Q +   +K SG+G GDC I L
Sbjct: 296 ----IETPQLSQLC--DLAQTYGAVAKSSGAGGGDCGICL 329


>gi|159900828|ref|YP_001547075.1| mevalonate kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893867|gb|ABX06947.1| mevalonate kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 313

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 124/292 (42%), Gaps = 29/292 (9%)

Query: 11  SAPGSLVLMGEHGVLHGHAAL---VFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           SAPG L+L GEH V++G  AL   + A+   V +    R   +      LG       L 
Sbjct: 3   SAPGKLILAGEHAVVYGQPALAMPIAALRASVAVEPAPRGAGMTVHAPDLGLVW---RLR 59

Query: 68  MFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              P        +++++ P     L + S +    G+GS AA+  A+  AL   Q  ++ 
Sbjct: 60  ATAPLSDLAQRTLDYLQLPEPDLRLTISSSIPIASGMGSGAAVGAALVRALAE-QAGQQL 118

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP---KYSIEKIDFIFPI----- 178
           S   I    +       G  SGID        ++ Y+ P   +   +    I P+     
Sbjct: 119 SAQVISDLVYQSEKAFHGTPSGID------NTVVAYEQPILFQRQTQGEPLIAPLAVGNQ 172

Query: 179 -HLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
            H +   SG  + T  V+  +    +  PE+   N++  A+   + QI   AL   + ++
Sbjct: 173 WHFVVADSGIASETKAVVGDLRQRWLADPEL--YNRQFVAVGNLVRQIQT-ALAGNDAEL 229

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             Q +++   LL+TLGVS  KL  +V +         +K+SG+G G  ++AL
Sbjct: 230 FGQLLSQNHQLLQTLGVSAEKLDYLV-QTALAAGAWGAKMSGAGWGGIMLAL 280


>gi|4557769|ref|NP_000422.1| mevalonate kinase [Homo sapiens]
 gi|167001643|ref|NP_001107657.1| mevalonate kinase [Homo sapiens]
 gi|417215|sp|Q03426|KIME_HUMAN RecName: Full=Mevalonate kinase; Short=MK
 gi|192988174|pdb|2R3V|A Chain A, The Biochemical And Structural Basis For Feedback
           Inhibition Of Mevalonate Kinase And Isoprenoid
           Metabolism
 gi|192988175|pdb|2R3V|B Chain B, The Biochemical And Structural Basis For Feedback
           Inhibition Of Mevalonate Kinase And Isoprenoid
           Metabolism
 gi|192988176|pdb|2R3V|C Chain C, The Biochemical And Structural Basis For Feedback
           Inhibition Of Mevalonate Kinase And Isoprenoid
           Metabolism
 gi|192988177|pdb|2R3V|D Chain D, The Biochemical And Structural Basis For Feedback
           Inhibition Of Mevalonate Kinase And Isoprenoid
           Metabolism
 gi|187561|gb|AAB59362.1| mevalonate kinase [Homo sapiens]
 gi|450347|emb|CAA53060.1| unnamed protein product [Homo sapiens]
 gi|9049533|gb|AAF82407.1| mevalonate kinase [Homo sapiens]
 gi|16359371|gb|AAH16140.1| MVK protein [Homo sapiens]
 gi|119618278|gb|EAW97872.1| mevalonate kinase (mevalonic aciduria), isoform CRA_c [Homo
           sapiens]
 gi|119618279|gb|EAW97873.1| mevalonate kinase (mevalonic aciduria), isoform CRA_c [Homo
           sapiens]
 gi|123980372|gb|ABM82015.1| mevalonate kinase (mevalonic aciduria) [synthetic construct]
 gi|123995191|gb|ABM85197.1| mevalonate kinase (mevalonic aciduria) [synthetic construct]
 gi|189055059|dbj|BAG38043.1| unnamed protein product [Homo sapiens]
 gi|239740432|gb|ACS13750.1| mevalonate kinase [Homo sapiens]
 gi|239740433|gb|ACS13751.1| mevalonate kinase 1 [Homo sapiens]
          Length = 396

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 131/318 (41%), Gaps = 74/318 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-------------------RL 50
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +                   RL
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 67

Query: 51  INIDSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIKPS 86
            ++D+S                 L +  G  D       LA+   +F ++ ++I   + +
Sbjct: 68  QSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVL--AFLYLYLSICRKQRA 125

Query: 87  C-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEILTT 134
               D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L  
Sbjct: 126 LPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTKEDLEL 184

Query: 135 AHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
            +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     T 
Sbjct: 185 INKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRNTR 244

Query: 191 QVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
            ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + ++ 
Sbjct: 245 ALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELIDM 300

Query: 243 QQGLLETLGVSDSKLSEI 260
            Q  L  LGV  + L ++
Sbjct: 301 NQHHLNALGVGHASLDQL 318


>gi|314937086|ref|ZP_07844433.1| mevalonate kinase [Staphylococcus hominis subsp. hominis C80]
 gi|313655705|gb|EFS19450.1| mevalonate kinase [Staphylococcus hominis subsp. hominis C80]
          Length = 307

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 117/267 (43%), Gaps = 14/267 (5%)

Query: 14  GSLVLMGEHGVLHGHAALV--FAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           G ++L+GEH V  G  A+   F   K  +L  +L K     I S +  Y G L  A  H 
Sbjct: 11  GKIILIGEHAVTFGQPAIAIPFTSGKVKVLIESLEKGNYSAIQSDV--YDGPLYDAPDHL 68

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD-E 130
             S I   + +        +K+ + L    GLGSSAA+ VA   A  +  Y + P  D E
Sbjct: 69  K-SLITHFVENKHVEEPLLIKIQANLPPSRGLGSSAAVAVAFIRA--SYDYLELPLSDKE 125

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPIHLIYSGYKTPT 189
           +L  A        G  SGID    +    + YQ  +  I K +D    + +I +G K  T
Sbjct: 126 LLENADWAERIAHGKPSGIDTKTIVTNQPVWYQKGEVEILKSLDLDGYMVVIDTGVKGST 185

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            Q ++ +  +     + +E    +   +G L  ++  A+ + +   LA   N+ Q  L T
Sbjct: 186 KQAVEDVHRL----CDNDESYMNVIEHIGSLVYLASDAINHHSFDQLANIFNQCQDDLRT 241

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKIS 276
           L VS  K+ E + ++  Q   +A K++
Sbjct: 242 LTVSHDKI-ETLLEIGRQHGAVAGKLT 267


>gi|228475139|ref|ZP_04059866.1| mevalonate kinase [Staphylococcus hominis SK119]
 gi|228270903|gb|EEK12300.1| mevalonate kinase [Staphylococcus hominis SK119]
          Length = 307

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 117/267 (43%), Gaps = 14/267 (5%)

Query: 14  GSLVLMGEHGVLHGHAALV--FAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           G ++L+GEH V  G  A+   F   K  +L  +L K     I S +  Y G L  A  H 
Sbjct: 11  GKIILIGEHAVTFGQPAIAIPFTSGKVKVLIESLEKGNYSAIQSDV--YDGPLYDAPDHL 68

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD-E 130
             S I   + +        +K+ + L    GLGSSAA+ VA   A  +  Y + P  D E
Sbjct: 69  K-SLITHFVENKHVEEPLLIKIQANLPPSRGLGSSAAVAVAFIRA--SYDYLELPLSDKE 125

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPIHLIYSGYKTPT 189
           +L  A        G  SGID    +    + YQ  +  I K +D    + +I +G K  T
Sbjct: 126 LLENADWAERIAHGKPSGIDTKTIVTNQPVWYQKGEVEILKSLDLDGYMVVIDTGVKGST 185

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            Q ++ +  +     + +E    +   +G L  ++  A+ + +   LA   N+ Q  L T
Sbjct: 186 KQAVEDVHRL----CDNDESYMNVIEHIGSLVYLASDAINHHSFDQLANIFNQCQDDLRT 241

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKIS 276
           L VS  K+ E + ++  Q   +A K++
Sbjct: 242 LTVSHDKI-ETLLEIGRQHGAVAGKLT 267


>gi|154151752|ref|YP_001405370.1| mevalonate kinase [Candidatus Methanoregula boonei 6A8]
 gi|154000304|gb|ABS56727.1| mevalonate kinase [Methanoregula boonei 6A8]
          Length = 289

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 131/288 (45%), Gaps = 50/288 (17%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDLAMF 69
           SAPG + L GEH V++G   +  AI  RV  ++T+RK  R     S     C        
Sbjct: 5   SAPGKVFLFGEHAVVYGKPGIAMAIKPRV--FVTVRKSKRPARAKSPYIDGC-------- 54

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                F  M +          + + SQ+ S  GLGSSAA+TVA  +A +  ++    S +
Sbjct: 55  -----FEAMGVVG-------SVYINSQIPSSSGLGSSAAVTVATLSA-INDEFALNKSRE 101

Query: 130 EILTTAHAIVLKVQ-GISSGIDLAASIHGGLIC------YQMPKYSIEKIDFIFPIHLIY 182
           +I   A  I   VQ G +S  D   S +GG++        ++P  +         +HL+ 
Sbjct: 102 DIANMAFEIEKTVQKGRASPTDTTVSTYGGIVLITGSSRRRLPPQN---------MHLVI 152

Query: 183 --SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-KNLKVLAQA 239
             S     TA+++++++ ++   P I      +  ++  +  +   A+ +  N K L + 
Sbjct: 153 GDSLVSHSTAKMVEQVAELKKTNPGI------VDPILDAIEGVGLAAIHHLSNPKELGRY 206

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           MN    LLE +GV   +LS +V   R       +KI+G+G G C++AL
Sbjct: 207 MNMNHALLEAMGVGHPQLSRLVLASRSA-GAFGAKITGAGGGGCMVAL 253


>gi|229548840|ref|ZP_04437565.1| mevalonate kinase [Enterococcus faecalis ATCC 29200]
 gi|255971354|ref|ZP_05421940.1| mevalonate kinase [Enterococcus faecalis T1]
 gi|255973973|ref|ZP_05424559.1| mevalonate kinase [Enterococcus faecalis T2]
 gi|256761658|ref|ZP_05502238.1| mevalonate kinase [Enterococcus faecalis T3]
 gi|257081147|ref|ZP_05575508.1| mevalonate kinase [Enterococcus faecalis E1Sol]
 gi|257083816|ref|ZP_05578177.1| mevalonate kinase [Enterococcus faecalis Fly1]
 gi|257086241|ref|ZP_05580602.1| mevalonate kinase [Enterococcus faecalis D6]
 gi|257421148|ref|ZP_05598138.1| mevalonate kinase [Enterococcus faecalis X98]
 gi|300859613|ref|ZP_07105701.1| mevalonate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|307275321|ref|ZP_07556464.1| mevalonate kinase [Enterococcus faecalis TX2134]
 gi|307278401|ref|ZP_07559476.1| mevalonate kinase [Enterococcus faecalis TX0860]
 gi|312952829|ref|ZP_07771691.1| mevalonate kinase [Enterococcus faecalis TX0102]
 gi|9937386|gb|AAG02440.1|AF290093_1 mevalonate kinase [Enterococcus faecalis]
 gi|229306069|gb|EEN72065.1| mevalonate kinase [Enterococcus faecalis ATCC 29200]
 gi|255962372|gb|EET94848.1| mevalonate kinase [Enterococcus faecalis T1]
 gi|255966845|gb|EET97467.1| mevalonate kinase [Enterococcus faecalis T2]
 gi|256682909|gb|EEU22604.1| mevalonate kinase [Enterococcus faecalis T3]
 gi|256989177|gb|EEU76479.1| mevalonate kinase [Enterococcus faecalis E1Sol]
 gi|256991846|gb|EEU79148.1| mevalonate kinase [Enterococcus faecalis Fly1]
 gi|256994271|gb|EEU81573.1| mevalonate kinase [Enterococcus faecalis D6]
 gi|257162972|gb|EEU92932.1| mevalonate kinase [Enterococcus faecalis X98]
 gi|295113904|emb|CBL32541.1| mevalonate kinase [Enterococcus sp. 7L76]
 gi|300850431|gb|EFK78180.1| mevalonate kinase [Enterococcus faecalis TUSoD Ef11]
 gi|306504907|gb|EFM74102.1| mevalonate kinase [Enterococcus faecalis TX0860]
 gi|306507955|gb|EFM77082.1| mevalonate kinase [Enterococcus faecalis TX2134]
 gi|310629345|gb|EFQ12628.1| mevalonate kinase [Enterococcus faecalis TX0102]
 gi|315027089|gb|EFT39021.1| mevalonate kinase [Enterococcus faecalis TX2137]
 gi|315145809|gb|EFT89825.1| mevalonate kinase [Enterococcus faecalis TX2141]
 gi|315148061|gb|EFT92077.1| mevalonate kinase [Enterococcus faecalis TX4244]
 gi|315152976|gb|EFT96992.1| mevalonate kinase [Enterococcus faecalis TX0031]
 gi|315155207|gb|EFT99223.1| mevalonate kinase [Enterococcus faecalis TX0043]
 gi|315157535|gb|EFU01552.1| mevalonate kinase [Enterococcus faecalis TX0312]
 gi|315163037|gb|EFU07054.1| mevalonate kinase [Enterococcus faecalis TX0645]
 gi|315174853|gb|EFU18870.1| mevalonate kinase [Enterococcus faecalis TX1346]
          Length = 314

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 125/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|70727401|ref|YP_254317.1| mevalonate kinase [Staphylococcus haemolyticus JCSC1435]
 gi|9937372|gb|AAG02430.1|AF290089_1 mevalonate kinase [Staphylococcus haemolyticus]
 gi|68448127|dbj|BAE05711.1| mevalonate kinase [Staphylococcus haemolyticus JCSC1435]
          Length = 307

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 119/267 (44%), Gaps = 14/267 (5%)

Query: 14  GSLVLMGEHGVLHGHAALV--FAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           G ++L+GEH V  G  A+   F   K  +L  +L K     I S +  Y G L  A  H 
Sbjct: 11  GKIILIGEHAVTFGEPAIAIPFTSGKVKVLIESLEKGNYSAIQSDV--YDGPLYDAPEHL 68

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD-E 130
             S I   + + K      +K+ + L    GLGSSAA+ VA   A  +  Y   P  D E
Sbjct: 69  K-SLIGHFVENKKVEEPLLIKIQANLPPSRGLGSSAAVAVAFIRA--SYDYLGLPLTDKE 125

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPIHLIYSGYKTPT 189
           +L  A        G  SGID    +    + YQ  +  I K +D    + +I +G K  T
Sbjct: 126 LLENADWAERIAHGKPSGIDTKTIVTNQPVWYQKGEVEILKTLDLDGYMVVIDTGVKGST 185

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            Q ++ +  +     + ++   ++   +G L   + +A+ + +   LA   N+ Q  L T
Sbjct: 186 KQAVEDVHQL----CDNDKNYMQVVKHIGSLVYSASEAIEHHSFDQLATIFNQCQDDLRT 241

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKIS 276
           L VS  K+ E+  +L E+   +A K++
Sbjct: 242 LTVSHDKI-EMFLRLGEENGSVAGKLT 267


>gi|116494975|ref|YP_806709.1| mevalonate kinase [Lactobacillus casei ATCC 334]
 gi|227535021|ref|ZP_03965070.1| possible mevalonate kinase [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|116105125|gb|ABJ70267.1| mevalonate kinase [Lactobacillus casei ATCC 334]
 gi|227187336|gb|EEI67403.1| possible mevalonate kinase [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
          Length = 311

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 23/287 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVIL--YLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           ++L+GEH V++G  A+   + K V L   +T + D    + SS   + G+L+      +F
Sbjct: 12  IILLGEHAVVYGEPAIALPV-KSVGLSARVTPQPDGRQTVTSSF--FTGNLNAGQLT-NF 67

Query: 74  SFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + I M I  +       + GF L + S L S+ G+GSSAA  VA+  A     +    S 
Sbjct: 68  AGIAMLIRRLLIFFNAKNQGFHLTITSALPSERGMGSSAATAVAVVRAFYD-AFQTSLSH 126

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE---KIDFIFPIHLIYSGY 185
           D +L  A      + G  SG+D A +        + P++ +        + P + +    
Sbjct: 127 DTLLNWAAVSEKALHGNPSGLDAATA------SAERPQWFVRGKAPRSIMMPRNGVLLIA 180

Query: 186 KTPTAQVLK-KISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            T  A   K  +  +     +  ++ + +   +G   + +  AL   ++  L Q  NR Q
Sbjct: 181 DTGVAGQTKIAVGAVADRLKQNPKMYRPLIKDIGDTVRQAALALAQDDIITLGQLFNRDQ 240

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             L  LGVS   L  ++  +        +K++GSG+G C+IAL   D
Sbjct: 241 ADLSALGVSSPDLDRLI-NVAIDNGAYGAKLTGSGMGGCMIALAASD 286


>gi|171778295|ref|ZP_02919501.1| hypothetical protein STRINF_00343 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282995|gb|EDT48419.1| hypothetical protein STRINF_00343 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 292

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 135/282 (47%), Gaps = 32/282 (11%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++ MGEH V++G+ A+   +    +       D+ I+ D     Y  +L  A++  
Sbjct: 10  AHSKIIWMGEHSVVYGYPAIAIPLQGIEVECRIYPADKKIHFD-----YYNTLSTAVYAA 64

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                +  +NH   S  +D++  S++  + G+GSSAAI++A   A+     + E S D  
Sbjct: 65  -----LEYLNHTDVSITYDIR--SEIPQKRGMGSSAAISIAAIRAVFD---YFEQSID-- 112

Query: 132 LTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGY 185
           + T   +V K + I+    SG+D    +    I + +       +D     +L+   +G 
Sbjct: 113 MDTLEILVNKAEIIAHSNPSGLDAKTCLSDKAITF-IRNIGFSTLDLYLDAYLVIADTGI 171

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
              T + ++K++  E       E N    A +G L+++  +A+++K++  +   M +   
Sbjct: 172 YGNTREAVEKVAQAE-------ENNLPHLAALGDLTEMVQKAIQDKSISEIGPLMTKAHS 224

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            L+ +GVS  K  ++V ++  +   + +K+SG GLG C+IAL
Sbjct: 225 HLQAIGVSIEKADQLV-QISLENGALGAKMSGGGLGGCIIAL 265


>gi|224532311|ref|ZP_03672943.1| putative phosphomevalonate kinase [Borrelia valaisiana VS116]
 gi|224511776|gb|EEF82182.1| putative phosphomevalonate kinase [Borrelia valaisiana VS116]
          Length = 317

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 79/189 (41%), Gaps = 27/189 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K       S   +     D 
Sbjct: 4   INFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID---DF 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLK------------VISQLDSQLGLGSSAAITVAIT 114
           ++      F+    +++  +C F+L+                  ++ G GSSA + + IT
Sbjct: 59  SLIENRSDFVFKMFSYLSQNCFFNLERSAYDVYIDTSNFFFNDGTKKGFGSSAVVAIGIT 118

Query: 115 AALLTLQYHKEP-SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ---MPKY-- 167
                +         DEI           QG I SG D+A SI GG+I ++   +PK+  
Sbjct: 119 CGFFLINNATNVVKKDEIFKYCLEAYRHSQGGIGSGYDIATSIFGGIIEFEGGSIPKFRQ 178

Query: 168 --SIEKIDF 174
              IE  DF
Sbjct: 179 LGDIEFNDF 187


>gi|123490584|ref|XP_001325649.1| mevalonate kinase family protein [Trichomonas vaginalis G3]
 gi|121908551|gb|EAY13426.1| mevalonate kinase family protein [Trichomonas vaginalis G3]
          Length = 315

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 151/327 (46%), Gaps = 34/327 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVI----LYLTLR-------KDRLINIDS 55
           K   S PG ++L GEH V++G AA+  AI++R+     +Y + +       +D++I+ D 
Sbjct: 3   KFSFSFPGKVILFGEHAVVYGEAAVASAISRRMFASGKIYPSNKSFVNVTFEDKVISYDP 62

Query: 56  SLGQYCGSLDLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAIT 114
               +  +        ++  I  A + + P +   D+ +I    +  GLGSSA++  A  
Sbjct: 63  FDNVHKDN------RTTYYMIRSAFDGLVPKNYQLDINIIQDFPTG-GLGSSASL-CACM 114

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
           AA+ +   +   S D I      +     G  SGID A  ++GG I  +M   +++++  
Sbjct: 115 AAIASKISNGNLSHDFIFQRTKELEKFYHGNPSGIDPATVVYGGGI--KMENRTLKQVKL 172

Query: 175 I-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
              P+ ++ +  +  T   +  +  +  +YP   ++ + +   MG ++    ++  +   
Sbjct: 173 PEVPLLIVGTNRERNTKAAVSHVKDLLTQYP---KVFKPLIKSMGDITNSFLESKDSDKK 229

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG----- 288
           +V+         LL + G+S  +  +IV K+    + +++KISG+G+G  ++  G     
Sbjct: 230 QVMHDLFYPAHCLLSSFGLSCHESEDIV-KIAVN-NALSAKISGAGMGGIMLVTGPDVEK 287

Query: 289 KGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           K  L S  Y  V   + A+G+   PI 
Sbjct: 288 KASLFS-KYNVVAASIGAEGMREEPIN 313


>gi|313635477|gb|EFS01718.1| phosphomevalonate kinase [Listeria seeligeri FSL N1-067]
          Length = 356

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 125/286 (43%), Gaps = 43/286 (15%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPV 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I +  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMMIETELIDKSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ------ 163
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y       
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAYTTFDQEW 180

Query: 164 -----------------MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI 206
                             P   IE ++   P  +   G+        K +S I     E 
Sbjct: 181 VKHRLAYKSLEWFMKEPWPLLEIETLE--EPTSVFSVGWTGTPVSTGKLVSQIHAFKQED 238

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
           +E  Q+      ++ +   QA   K+ ++L  ++   + +L+ LG 
Sbjct: 239 SENYQQFLTYNNQIMKQIIQAFHTKDEELLYSSIKENRRILQDLGT 284


>gi|301066542|ref|YP_003788565.1| mevalonate kinase [Lactobacillus casei str. Zhang]
 gi|300438949|gb|ADK18715.1| Mevalonate kinase [Lactobacillus casei str. Zhang]
          Length = 311

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 23/287 (8%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVIL--YLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           ++L+GEH V++G  A+   + K V L   +T + D    + SS   + G+L+      +F
Sbjct: 12  IILLGEHAVVYGEPAIALPV-KSVGLSARVTPQPDGRQTVTSSF--FTGNLNAGQLT-NF 67

Query: 74  SFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + I M I  +       + GF L + S L S+ G+GSSAA  VA+  A     +    S 
Sbjct: 68  AGIAMLIRRLLIFFNAKNQGFHLTITSALPSERGMGSSAATAVAVVRAFYD-AFQTSLSH 126

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE---KIDFIFPIHLIYSGY 185
           D +L  A      + G  SG+D A +        + P++ +        + P + +    
Sbjct: 127 DTLLNWAAVSEKALHGNPSGLDAATA------SAERPQWFVRGKAPRSIMMPRNGVLLIA 180

Query: 186 KTPTAQVLK-KISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
            T  A   K  +  +     +  ++ + +   +G   + +  AL   ++  L Q  NR Q
Sbjct: 181 DTGVAGQTKIAVGAVADRLKQDPKMYRPLIKDIGDTVRQAALALAQDDIITLGQLFNRDQ 240

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
             L  LGVS   L  ++  +        +K++GSG+G C+IAL   D
Sbjct: 241 ADLSALGVSSPDLDRLI-NVAIDNGAYGAKLTGSGMGGCMIALAASD 286


>gi|227878667|ref|ZP_03996582.1| mevalonate kinase [Lactobacillus crispatus JV-V01]
 gi|256850380|ref|ZP_05555808.1| mevalonate kinase [Lactobacillus crispatus MV-1A-US]
 gi|262046472|ref|ZP_06019434.1| mevalonate kinase [Lactobacillus crispatus MV-3A-US]
 gi|227861731|gb|EEJ69335.1| mevalonate kinase [Lactobacillus crispatus JV-V01]
 gi|256712777|gb|EEU27770.1| mevalonate kinase [Lactobacillus crispatus MV-1A-US]
 gi|260573343|gb|EEX29901.1| mevalonate kinase [Lactobacillus crispatus MV-3A-US]
          Length = 302

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 138/283 (48%), Gaps = 20/283 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A G ++++GEH V++G+ AL   I K + +  T+     + +D++  +Y G L  A    
Sbjct: 7   AHGKVIIIGEHSVVYGYDALAMPI-KALHIKTTVESASQMWMDTA--RYHGPLFEA--PA 61

Query: 72  SFSFIIMAINHIKPSCGFD--LKV--ISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
            +  +   + H+K   G +  LK+    ++  + G GSSA + +  T A+    +    +
Sbjct: 62  EYDGLKYVVKHMKKKAGNNHPLKITYTGEIPMERGFGSSATVALGTTRAMNQF-FQLNMT 120

Query: 128 PDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             EI+T T HA ++   G +SG+D AA+++   + +   K   +    I    L  +   
Sbjct: 121 EKEIMTVTNHAEMIN-HGKASGLD-AATVNSDYLVFFNKKMGPK----ILQTKLGATLLI 174

Query: 187 TPTAQV--LKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             T Q+   K+  ++  +  E ++  +K  A +G+L+ ++ +A    + + + Q  N  Q
Sbjct: 175 MDTGQLGNTKEAVFLVKKMLEKSDYAKKKIARLGELADLTKKAWIKHDRQAVGQIFNEAQ 234

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +L +  +S +K+ ++  K+    + +  K+SG GLG   I+L
Sbjct: 235 EILHSFDLSTNKIDQLQ-KIALSNNALGFKLSGGGLGGITISL 276


>gi|297206032|ref|ZP_06923427.1| phosphomevalonate kinase [Lactobacillus jensenii JV-V16]
 gi|297149158|gb|EFH29456.1| phosphomevalonate kinase [Lactobacillus jensenii JV-V16]
          Length = 362

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINK--RVILYLTLRKDRLI-----NIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+  RV +   +    +I     + DS   +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQNCPAIIVALNQFVRVSISAAVGNTGIIHSKQYSQDSIHWR 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDSQ----LGLGSS 106
             G+ + +      F +I+ AI   +      G     +DL V S LDS+     GLGSS
Sbjct: 62  RQGNKMVIDNRDNPFEYILAAIRFTEQYLLENGISLKVYDLHVNSDLDSKDGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E   D +   A      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILAF-YGIERKHDLVYKLAAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|255936237|ref|XP_002559145.1| Pc13g07140 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583765|emb|CAP91783.1| Pc13g07140 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 449

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 83/387 (21%), Positives = 148/387 (38%), Gaps = 88/387 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLDLA 67
           VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R I ++     +  + D+ 
Sbjct: 7   VSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITLNFRDLGFSHTWDID 66

Query: 68  M-----FH-PS-----FSFI-------IMAIN-----------------HIKPSCGF--- 89
                 FH PS     +S +       + AI                  HI+ +  F   
Sbjct: 67  TLPWDKFHEPSKKKFYYSLVTELDPELVEAIEPHLQGVSKGLPEEQRKIHIRSASSFLYL 126

Query: 90  ------------DLKVISQLDSQLGLGSSAAITVAI-TAALLTLQYHKEPSPDEILTTAH 136
                          + S + +  GLGSSA++ V + TA LL ++    P PD+    A 
Sbjct: 127 FLSLGSPQSPGAIYTLRSTIPTGAGLGSSASVCVCLSTALLLQIRTLSGPHPDQPPEEAE 186

Query: 137 AIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH------ 179
             + ++            G  SG+D   +  G  + ++    S  +     P        
Sbjct: 187 TQIERINRWAFVGELCIHGNPSGVDNTVAAGGKAVIFRRDDSSKTRTVISLPTFPELPLL 246

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR---------- 229
           L+ +     T   + K+  +   +P + E      +++  +  ++C A R          
Sbjct: 247 LVNTQQARSTKTEVSKVGALRDAHPIVTE------SILNGIDHVTCSAQRLIEDPSFEGI 300

Query: 230 -NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
               L      +    G L +LGVS  +L E + +L +   I  +K++G+G G C I L 
Sbjct: 301 SETTLAHFGTLIRINHGFLVSLGVSHPRL-ERIRELVDYADIGWTKLTGAGGGGCAITLL 359

Query: 289 KGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           + +  +   Q +      +G     +T
Sbjct: 360 RPNAKAEVKQDLEQKFDKEGFTTYEVT 386


>gi|260941139|ref|XP_002614736.1| hypothetical protein CLUG_05514 [Clavispora lusitaniae ATCC 42720]
 gi|238851922|gb|EEQ41386.1| hypothetical protein CLUG_05514 [Clavispora lusitaniae ATCC 42720]
          Length = 425

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/388 (22%), Positives = 156/388 (40%), Gaps = 89/388 (22%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT------------------------- 44
           VSAPG ++L GEH  ++G  A+  A++ R  L +T                         
Sbjct: 5   VSAPGKVILFGEHSAVYGKPAIAAALSLRCYLLVTPNPNSDDIILEFPDIGLVHKWSAAS 64

Query: 45  LRKDRLINIDSSLGQ--------------YCGSLDLA---MFHPSFSFIIMAINHI-KPS 86
           L  D +  +  + G+                 SLD+A    +     F+ +  +   + +
Sbjct: 65  LPWDEIEAVTKNEGRPKATDELIPELLDALADSLDIADPLHYTACRCFLYLYASLCSRQT 124

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-------------KEPSPDEILT 133
            G    + S L    GLGSSAA  V ++AAL  L  H              + S D    
Sbjct: 125 AGCHFCIRSTLPIGAGLGSSAATAVCLSAALSILGGHVSAPSLAVNDRHAHKDSSDATFI 184

Query: 134 TAHAIVLK--VQGISSGIDLAASIHGGLICYQM------PKYSIEKIDF-IFPIHLIYSG 184
            A +++ +    G  SGID A + HGG + YQ       P       +F   P+ L  + 
Sbjct: 185 DAWSLMGEKCFHGNPSGIDNAVATHGGAVMYQRMTGPGNPSVRTSVRNFAALPLLLTNTR 244

Query: 185 YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA----LRNK-NLKVLAQA 239
               TA+++  ++ +  +Y  + E      A++  +  ++  A    +R + +   L+  
Sbjct: 245 VPRRTAELVGGVAQLGAKYAPVTE------AVLQAMDHVARHAYDLMVRPECDRAALSDL 298

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL------------ 287
           +    GLL +LGVS   L E V  + ++  + A+K++G+G G C I L            
Sbjct: 299 VKINHGLLVSLGVSHPSL-EQVRIIADRHSLGATKLTGAGGGGCAITLLADGLDPSNLVS 357

Query: 288 GKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
            + D     +++ +  +  KG+ ++ ++
Sbjct: 358 AQRDFADAGFETFDATLGGKGVGMLKLS 385


>gi|256957239|ref|ZP_05561410.1| mevalonate kinase [Enterococcus faecalis DS5]
 gi|257077787|ref|ZP_05572148.1| mevalonate kinase [Enterococcus faecalis JH1]
 gi|294781314|ref|ZP_06746660.1| mevalonate kinase [Enterococcus faecalis PC1.1]
 gi|307267979|ref|ZP_07549367.1| mevalonate kinase [Enterococcus faecalis TX4248]
 gi|256947735|gb|EEU64367.1| mevalonate kinase [Enterococcus faecalis DS5]
 gi|256985817|gb|EEU73119.1| mevalonate kinase [Enterococcus faecalis JH1]
 gi|294451650|gb|EFG20106.1| mevalonate kinase [Enterococcus faecalis PC1.1]
 gi|306515620|gb|EFM84147.1| mevalonate kinase [Enterococcus faecalis TX4248]
 gi|315032467|gb|EFT44399.1| mevalonate kinase [Enterococcus faecalis TX0017]
 gi|315034299|gb|EFT46231.1| mevalonate kinase [Enterococcus faecalis TX0027]
 gi|329577896|gb|EGG59317.1| mevalonate kinase [Enterococcus faecalis TX1467]
          Length = 314

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 122/286 (42%), Gaps = 23/286 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G K  T + +K I+ +    P       K    +G  ++ + QA+   + + L Q M 
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIA---KTMKQLGSFTKEAKQAILQDDKQKLGQLMT 238

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 239 LAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|256851167|ref|ZP_05556556.1| phosphomevalonate kinase [Lactobacillus jensenii 27-2-CHN]
 gi|260660591|ref|ZP_05861506.1| phosphomevalonate kinase [Lactobacillus jensenii 115-3-CHN]
 gi|282934633|ref|ZP_06339876.1| phosphomevalonate kinase [Lactobacillus jensenii 208-1]
 gi|256616229|gb|EEU21417.1| phosphomevalonate kinase [Lactobacillus jensenii 27-2-CHN]
 gi|260548313|gb|EEX24288.1| phosphomevalonate kinase [Lactobacillus jensenii 115-3-CHN]
 gi|281301208|gb|EFA93509.1| phosphomevalonate kinase [Lactobacillus jensenii 208-1]
          Length = 362

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINK--RVILYLTLRKDRLI-----NIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+  RV +   +    +I     + DS   +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQNCPAIIVALNQFVRVSISAAVGNTGIIHSKQYSQDSIHWR 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDSQ----LGLGSS 106
             G+ + +      F +I+ AI   +      G     +DL V S LDS+     GLGSS
Sbjct: 62  RQGNKMVIDNRDNPFEYILAAIRFTEQYLLENGISLKVYDLHVNSDLDSKDGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E   D +   A      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILAF-YGIERKHDLVYKLAAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|313640108|gb|EFS04732.1| phosphomevalonate kinase [Listeria seeligeri FSL S4-171]
          Length = 356

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 3   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPV 62

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I +  ++ GLGSSAA 
Sbjct: 63  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMMIETELIDKSGAKYGLGSSAAA 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL+T +++ E S  +    A    L VQG  S  D+A+ ++GG I Y
Sbjct: 122 TVAVINALMT-KFYPEISMLKKFKLAALSHLVVQGNGSCGDIASCMYGGWIAY 173


>gi|257871000|ref|ZP_05650653.1| phosphomevalonate kinase [Enterococcus gallinarum EG2]
 gi|257805164|gb|EEV33986.1| phosphomevalonate kinase [Enterococcus gallinarum EG2]
          Length = 359

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 83/175 (47%), Gaps = 21/175 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT-LRKDRLI------NIDSSLGQ 59
           I +S PG L + GE+ V+  GH A++ A+++ + + +   RK+  I      ++     +
Sbjct: 2   IEISVPGKLFIAGEYAVVEPGHPAIIVAVDQFINVTIEGARKNGSIQSAQYSDLPIRWTR 61

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIKPSCG--------FDLKVISQLDS----QLGLGSSA 107
             G L L      F +I+ AI   +            +DLKV S+LD+    + GLGSS 
Sbjct: 62  RNGELVLDHRENPFHYILAAIRLTEKYAQEKGTLLSFYDLKVTSELDNSNGRKYGLGSSG 121

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           A+TVA   A L L Y  +         A    L VQG  S  D+AAS +GG + +
Sbjct: 122 AVTVATVKA-LNLYYDLKMDRLTQFKIAALAHLAVQGNGSCGDIAASCYGGWLAF 175


>gi|154707263|ref|YP_001424028.1| mevalonate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|154356549|gb|ABS78011.1| mevalonate kinase [Coxiella burnetii Dugway 5J108-111]
          Length = 340

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 129/307 (42%), Gaps = 50/307 (16%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRV---------------ILYLTLRKD----RLIN 52
            P  L+L GEH V++GH AL  AIN+ +                + +  R++     L N
Sbjct: 10  TPAKLILSGEHAVVYGHPALSVAINRYMEATVRWSLPLHFSFHFMGIDFRREVTLQALRN 69

Query: 53  IDSSLG-QY----CGSLDLAM-----FHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQ 100
           +   L  QY     G L +       F  S    I  ++ +K     G D+   S +   
Sbjct: 70  LKRKLKKQYHKYSLGHLSIREVLQKPFELSLFTFINVLDRLKNKLPTGIDIVTDSNIPVG 129

Query: 101 LGLGSSAAITVAITAAL---LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG 157
            G+GSSAA  V++   L   L +  H E   D +     +  L+  G SSG+D+    HG
Sbjct: 130 CGMGSSAASVVSLIYVLTQFLGMDLHLE---DYLSLGVESENLQ-HGYSSGLDVHTVYHG 185

Query: 158 GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM 217
           G + Y+  ++    I   FP+ LI +G   P +   + IS     +      N KI    
Sbjct: 186 GCLRYEKGQFEKRPIP-DFPMQLIQTG--CPQSSTGECISEAAPFFK-----NSKIGEDF 237

Query: 218 GKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
             ++    QAL+N N   +   +     LL ++GV   K++  V  + +     A+KI G
Sbjct: 238 SAVTNALDQALQNHNNDSIKGCIRENHRLLRSIGVVPDKVNNFVIDVEKLGG--AAKICG 295

Query: 278 SG--LGD 282
           +G  +GD
Sbjct: 296 AGSVVGD 302


>gi|238854637|ref|ZP_04644967.1| phosphomevalonate kinase [Lactobacillus jensenii 269-3]
 gi|282932972|ref|ZP_06338369.1| phosphomevalonate kinase [Lactobacillus jensenii 208-1]
 gi|313472181|ref|ZP_07812673.1| phosphomevalonate kinase [Lactobacillus jensenii 1153]
 gi|238832427|gb|EEQ24734.1| phosphomevalonate kinase [Lactobacillus jensenii 269-3]
 gi|239529555|gb|EEQ68556.1| phosphomevalonate kinase [Lactobacillus jensenii 1153]
 gi|281303007|gb|EFA95212.1| phosphomevalonate kinase [Lactobacillus jensenii 208-1]
          Length = 362

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLT-------LRKDRLINIDSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+ V + ++       +   +  + DS   +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQNCPAIIVALNQFVRVSISAAVGNTGIIHSKQYSQDSIHWR 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDSQ----LGLGSS 106
             G+ + +      F +I+ AI   +      G     +DL V S LDS+     GLGSS
Sbjct: 62  RQGNKMVIDNRDNPFEYILAAIRFTEQYLLENGTSLKVYDLHVNSDLDSKDGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E   D +   A      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILAF-YGIERKHDLVYKLAAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|260664420|ref|ZP_05865272.1| phosphomevalonate kinase [Lactobacillus jensenii SJ-7A-US]
 gi|260561485|gb|EEX27457.1| phosphomevalonate kinase [Lactobacillus jensenii SJ-7A-US]
          Length = 362

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINK--RVILYLTLRKDRLINI-----DSSLGQ 59
           I   APG L + GE+ VL  +  A++ A+N+  RV +   +    +I+      DS   +
Sbjct: 2   ITEKAPGKLYIAGEYAVLEQNCPAIIVALNQFVRVSISAAVGNTGIIHSKQYSQDSIHWR 61

Query: 60  YCGS-LDLAMFHPSFSFIIMAINHIKP---SCG-----FDLKVISQLDSQ----LGLGSS 106
             G+ + +      F +I+ AI   +      G     +DL V S LDS+     GLGSS
Sbjct: 62  RQGNKMVIDNRDNPFEYILAAIRFTEQYLLENGTLLKVYDLHVNSDLDSKDGRKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   A+L   Y  E   D +   A      VQG  S  D+AAS++GG + YQ
Sbjct: 122 AAVTVATVKAILAF-YGIERKHDLVYKLAAISHYSVQGNGSAGDIAASVYGGWLAYQ 177


>gi|283782814|ref|YP_003373568.1| isopentenyl-diphosphate delta-isomerase, type 2 [Gardnerella
           vaginalis 409-05]
 gi|283441062|gb|ADB13528.1| isopentenyl-diphosphate delta-isomerase, type 2 [Gardnerella
           vaginalis 409-05]
          Length = 779

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 89/374 (23%), Positives = 149/374 (39%), Gaps = 104/374 (27%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-------LRKDRLINIDSSLGQYCGS 63
           SAPG L + GE+ V+ G AA+V A+++ V + ++       LR++   N  SS   YCG+
Sbjct: 7   SAPGKLYIAGEYAVVDGCAAIVAAVSRYVTVSISDETLNEELRENLQKNAPSSR-NYCGA 65

Query: 64  L--DLAMFHP-----------------SFSFIIMAIN----HIKPSCG-------FDLKV 93
           +  D   + P                  +++++ A+     +    C        +++ +
Sbjct: 66  ITSDAEKYKPLLWARASDGSIEIQNDGKYAYVLAAMGVVDAYASEKCAPNINRKSYNVHI 125

Query: 94  ISQLDS-----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG 148
            S+LD      + GLGSSAA+TVA+  AL    Y    S  EI   A      V+   SG
Sbjct: 126 SSELDDAKTGRKYGLGSSAAVTVAVIRALCKW-YGLNLSTPEICKLALIASSSVKKSGSG 184

Query: 149 IDLAASIHGGLICYQ----------------------------MPKYSIEKIDFIFPIHL 180
            D+AAS +GG   Y+                             P+  +++++    + L
Sbjct: 185 GDVAASSYGGWTMYRAYSREWLEAELTLVKSGCSDFGELLHKKWPRLEVKRLNVDKSLKL 244

Query: 181 IYSGYKTPTAQVLKKISYIE--------------IEYPEINEINQKI-YALMGKLSQISC 225
           +  G+    A   K +S +E              +E    +  NQ   Y    K S+I  
Sbjct: 245 LV-GWTGSPASSAKLVSSVESSVKTSAEGSTESSVETSAFDNKNQLFTYEDFCKQSEICV 303

Query: 226 Q----ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA--------S 273
           Q    A+    +  ++    + + LL+ L    S L+  V +  E    +         +
Sbjct: 304 QKLARAIEKFEISEISSGFAQNRALLQKL----SALTGTVIETHELTKFIEIATCAGVPA 359

Query: 274 KISGSGLGDCVIAL 287
           K SG+G GDC IAL
Sbjct: 360 KTSGAGGGDCAIAL 373


>gi|312863162|ref|ZP_07723400.1| mevalonate kinase [Streptococcus vestibularis F0396]
 gi|322517211|ref|ZP_08070093.1| mevalonate kinase [Streptococcus vestibularis ATCC 49124]
 gi|311100698|gb|EFQ58903.1| mevalonate kinase [Streptococcus vestibularis F0396]
 gi|322124198|gb|EFX95722.1| mevalonate kinase [Streptococcus vestibularis ATCC 49124]
          Length = 292

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 131/279 (46%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAADTPLTLKAQDP 56

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E S + 
Sbjct: 57  LTTAIFSALNYLEIKNQPISYDISSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELSQET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       ++I+     +L+   +G    
Sbjct: 116 LEMLVHQAETIAHSKPSGLDAKTCLSDQAISF-TRNIGFKEIEVNLGAYLVIADTGIHGN 174

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+  I ++   ++++N+     +G+LSQ +  AL+ K+ K+L Q M++    L+
Sbjct: 175 TREAVEKVEAIGLDA--LSDLNR-----LGELSQQAELALKAKDQKLLGQLMSQAHNHLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++           +K+SG GLG C+IAL
Sbjct: 228 SLGVS-CDLSDLLVATALDHGAQGAKMSGGGLGGCIIAL 265


>gi|297206030|ref|ZP_06923425.1| mevalonate kinase [Lactobacillus jensenii JV-V16]
 gi|297149156|gb|EFH29454.1| mevalonate kinase [Lactobacillus jensenii JV-V16]
          Length = 304

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 131/283 (46%), Gaps = 18/283 (6%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLA-MF 69
           A G ++L+GEH V++G+ AL   I    +   ++   D    +D+   +Y G    A   
Sbjct: 7   AHGKVILIGEHSVVYGYNALSMPIQSLNIKTTVSENNDNYHYMDTD--RYHGDFFKAPAE 64

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQ--LDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           +    +I+    ++KPS  + LK+  +  +  + GLGSSA +++  T AL    +  + S
Sbjct: 65  YAGLKYILQYFLNLKPSSPY-LKISYRGLIPIERGLGSSATVSLGTTKALNEF-FKLKLS 122

Query: 128 PDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             EI+  T HA  +   G +SG+D +A+++   + +   K  ++ +       L+     
Sbjct: 123 DKEIMAITNHAETIN-HGKASGLD-SATVNSDYLVFFNKKTGVQILKQKLNATLLI---- 176

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             T  +      +E+   E+    ++   L  +G L+    QA  +++ K + QA  + Q
Sbjct: 177 MDTGDLGNTKEAVELVKNEVTSSKKQANNLENLGNLTDQVKQAWISQDAKQVGQAFTKSQ 236

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  L VS  K+  +  +L        +K+SG GLG  VIAL
Sbjct: 237 KYLAELKVSTPKIDHLC-QLAIDTGAYGAKLSGGGLGGIVIAL 278


>gi|260656454|pdb|3K17|A Chain A, Crystal Structure Of A Lin0012 Protein From Listeria
           Innocua
 gi|260656455|pdb|3K17|B Chain B, Crystal Structure Of A Lin0012 Protein From Listeria
           Innocua
 gi|260656456|pdb|3K17|C Chain C, Crystal Structure Of A Lin0012 Protein From Listeria
           Innocua
 gi|260656457|pdb|3K17|D Chain D, Crystal Structure Of A Lin0012 Protein From Listeria
           Innocua
          Length = 365

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 87/173 (50%), Gaps = 18/173 (10%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYL--TLRKDRLI-NIDSSLGQYC 61
           +K+ V  PG L + GE+ V+  GH A++ A+N+ + L L  + R +  I + ++ +    
Sbjct: 5   NKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSERNELWIPHYENPVSWPI 64

Query: 62  GSLDLAMFHPSFSFIIMAIN---HIKPSCGFDL---------KVISQLDSQLGLGSSAAI 109
           G  +L      ++F   AIN       S G +L         ++I Q  ++ GLGSSAA 
Sbjct: 65  GG-ELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKXVIETELIDQSGAKYGLGSSAAA 123

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           TVA+  AL T +++ E S  +    A    L VQG  S  D+A+  +GG I Y
Sbjct: 124 TVAVINALXT-KFYPEISXLKKFKLAALSHLVVQGNGSCGDIASCXYGGWIAY 175


>gi|227517823|ref|ZP_03947872.1| mevalonate kinase [Enterococcus faecalis TX0104]
 gi|227074713|gb|EEI12676.1| mevalonate kinase [Enterococcus faecalis TX0104]
          Length = 314

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 129/285 (45%), Gaps = 21/285 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H   + +    L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTVKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHLIYS 183
           +  E+++ +  I     G  SGID AA+     + +     P +    +   + + +  +
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFFTRGFPPTHFSMNLSNAYLV-VADT 183

Query: 184 GYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M  
Sbjct: 184 GIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLMTL 239

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 240 AQEQLQQLSVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|223996227|ref|XP_002287787.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220976903|gb|EED95230.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 315

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 23/288 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRV---ILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
           A G L+L GEH V++   ALV A++      + YL      +++   ++  Y        
Sbjct: 12  AYGKLILFGEHFVVYKVPALVGAVSAYTDCKVEYLNEPGLEVVDNRPAVPLY----KEQK 67

Query: 69  FHPSFSFIIMAINHIKPSC---GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
                  I + + H+       G  L     L    G+G+SAA  V++  A   +   + 
Sbjct: 68  MEEGMEAINLTLKHLGVDTQKRGMKLTFGGDLCCASGIGASAAQVVSLARAFNVVD-GRS 126

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS--IEKIDFIFPIHLIYS 183
            + DEI    +       G  SGID  A+  GGL+ +Q    +   +K     PI ++Y+
Sbjct: 127 MTEDEINAAGYEGEKGYHGTPSGIDNTAATFGGLLRFQRTDGAPIFDKKSLKSPIRIVYA 186

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYA-LMGK---LSQISCQALRNKNLKVLAQA 239
                TA   K +  +  +     E ++  +A LM +   L +    A+   +L  L + 
Sbjct: 187 STGI-TASTTKVVGDVRAK----KEADEAWFANLMEQYKVLVEDGQTAVEAGDLTTLGKL 241

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           M++   LL+ L VS  +L ++V   RE    + +K+SG+G G  +IAL
Sbjct: 242 MDQNHVLLQELTVSCKELDDLVAAARE-AGALGAKMSGTGRGGLMIAL 288


>gi|256851165|ref|ZP_05556554.1| mevalonate kinase [Lactobacillus jensenii 27-2-CHN]
 gi|260660589|ref|ZP_05861504.1| mevalonate kinase [Lactobacillus jensenii 115-3-CHN]
 gi|282934631|ref|ZP_06339874.1| mevalonate kinase [Lactobacillus jensenii 208-1]
 gi|256616227|gb|EEU21415.1| mevalonate kinase [Lactobacillus jensenii 27-2-CHN]
 gi|260548311|gb|EEX24286.1| mevalonate kinase [Lactobacillus jensenii 115-3-CHN]
 gi|281301206|gb|EFA93507.1| mevalonate kinase [Lactobacillus jensenii 208-1]
          Length = 304

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 131/283 (46%), Gaps = 18/283 (6%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLA-MF 69
           A G ++L+GEH V++G+ AL   I    +   ++   D    +D+   +Y G    A   
Sbjct: 7   AHGKVILIGEHSVVYGYNALSMPIQSLNIKTTVSENNDNYHYMDTD--RYHGDFFKAPAE 64

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQ--LDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
           +    +I+    ++KPS  + LK+  +  +  + GLGSSA +++  T AL    +  + S
Sbjct: 65  YAGLKYILQYFLNLKPSSPY-LKISYRGLIPIERGLGSSATVSLGTTKALNEF-FKLKLS 122

Query: 128 PDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             EI+  T HA  +   G +SG+D +A+++   + +   K  ++ +       L+     
Sbjct: 123 DKEIMAITNHAETIN-HGKASGLD-SATVNSDYLVFFNKKTGVQILKQKLNATLLI---- 176

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             T  +      +E+   E+    ++   L  +G L+    QA  +++ K + QA  + Q
Sbjct: 177 MDTGDLGNTKEAVELVKNEVTSSKKQANNLENLGNLTDQVKQAWISQDAKQVGQAFTKAQ 236

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L  L VS  K+  +  +L        +K+SG GLG  VIAL
Sbjct: 237 KYLAELKVSTPKIDHLC-QLAIDTGAYGAKLSGGGLGGIVIAL 278


>gi|256964277|ref|ZP_05568448.1| mevalonate kinase [Enterococcus faecalis HIP11704]
 gi|307271903|ref|ZP_07553171.1| mevalonate kinase [Enterococcus faecalis TX0855]
 gi|256954773|gb|EEU71405.1| mevalonate kinase [Enterococcus faecalis HIP11704]
 gi|306511409|gb|EFM80411.1| mevalonate kinase [Enterococcus faecalis TX0855]
 gi|315172006|gb|EFU16023.1| mevalonate kinase [Enterococcus faecalis TX1342]
 gi|323480084|gb|ADX79523.1| mevalonate kinase [Enterococcus faecalis 62]
 gi|327534484|gb|AEA93318.1| mevalonate kinase [Enterococcus faecalis OG1RF]
          Length = 314

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 125/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-YTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|195653897|gb|ACG46416.1| mevalonate kinase [Zea mays]
 gi|219886615|gb|ACL53682.1| unknown [Zea mays]
 gi|223945329|gb|ACN26748.1| unknown [Zea mays]
          Length = 405

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 150/362 (41%), Gaps = 91/362 (25%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAI----NKRVILY----------------LTLR 46
           ++   APG ++L GEH V+HG AA+  AI    N  ++L                 L LR
Sbjct: 15  EVRARAPGKIILAGEHAVVHGSAAVAAAIDLYTNSSLLLRPTGPGEGGGAGSGAVELDLR 74

Query: 47  KDRLI------NIDSSLGQY----------CGSLDLAMFH-------------------P 71
              L        +  +LG+           C    LA                       
Sbjct: 75  DSGLTFSWPCSRLRGALGEEISANPGAPAPCSPDQLAAIARLLQDQEIPEAKIWLSAGLS 134

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT------LQYHKE 125
           +F F+  +I   +P       V S L    GLGSSAA  V+++ ALLT      +   + 
Sbjct: 135 AFLFLYASILGCRPGKAV---VSSDLPMGAGLGSSAAFCVSMSGALLTAAGAVSVGARRG 191

Query: 126 PSPDEILTTAHAIVLK---------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
               E+L      ++          + G  SGID + S  G +I ++  K  +  ++   
Sbjct: 192 AEGWEVLEKGALELVNQWAFQGEKIIHGKPSGIDNSVSTFGKMIKFK--KGELTNLESWN 249

Query: 177 PIHLIYSGYKTP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQ 226
           P+ ++ +  +    T  ++  +S     +P+        +N I++++ +++ +L+     
Sbjct: 250 PVKMLITDTRVGRNTKALVAGVSERASRHPDAMASVFHAVNSISEELSSIV-ELAAEDEI 308

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVI 285
           A+ +K  K LA+ M   QGLL+ +GVS S +  +   LR    + + SK++G+G G CV+
Sbjct: 309 AITSKEDK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKYSLVSKLTGAGGGGCVL 364

Query: 286 AL 287
            L
Sbjct: 365 TL 366


>gi|227514852|ref|ZP_03944901.1| possible mevalonate kinase [Lactobacillus fermentum ATCC 14931]
 gi|227086784|gb|EEI22096.1| possible mevalonate kinase [Lactobacillus fermentum ATCC 14931]
          Length = 311

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++LMGEH V++G  A+   +     +    R      + S    + G ++      S + 
Sbjct: 13  IILMGEHSVVYGEPAIALPLPSVATVATLTRGGVGKRLTSRY--FQGPIE--ELPASMTG 68

Query: 76  IIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           ++  +N       P   ++L + S L ++ G+GSSAA  +AI  A     YH+E S  ++
Sbjct: 69  VLKLLNALTDRFSPDDNWELTIESDLPAERGMGSSAATAIAIIRAFFA-AYHEELSHAQL 127

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPT 189
           L  A           SG+D AA++      + +   + + ID      L+   +G K  T
Sbjct: 128 LEWADIEEEVTHRSPSGLD-AATVSSSTPLWYVKGQTGQAIDMELSATLVIADTGIKGAT 186

Query: 190 AQVLKKISYIEIEYPEINEINQKI-YALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            + +  +     E    N    K  +A MG L + +  AL   ++  L  AM+  Q  L 
Sbjct: 187 KEAIAAVK----EQLTTNPAQTKARFAHMGHLVEETKVALATDDITRLGTAMDECQQDLV 242

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
            LGVS   L  +V  + +Q     +K++G G G C+IAL    + +    +V     A  
Sbjct: 243 ALGVSSPALDHLV-AVAKQNGARGAKLTGGGRGGCMIALTATAMGARKLAAVLKENGATA 301

Query: 309 IDIVPITPSH 318
             I P+   H
Sbjct: 302 TWIQPLKGDH 311


>gi|148544144|ref|YP_001271514.1| mevalonate kinase [Lactobacillus reuteri DSM 20016]
 gi|184153517|ref|YP_001841858.1| mevalonate kinase [Lactobacillus reuteri JCM 1112]
 gi|227364573|ref|ZP_03848634.1| mevalonate kinase [Lactobacillus reuteri MM2-3]
 gi|325682312|ref|ZP_08161829.1| mevalonate kinase [Lactobacillus reuteri MM4-1A]
 gi|148531178|gb|ABQ83177.1| mevalonate kinase [Lactobacillus reuteri DSM 20016]
 gi|183224861|dbj|BAG25378.1| mevalonate kinase [Lactobacillus reuteri JCM 1112]
 gi|227070410|gb|EEI08772.1| mevalonate kinase [Lactobacillus reuteri MM2-3]
 gi|324978151|gb|EGC15101.1| mevalonate kinase [Lactobacillus reuteri MM4-1A]
          Length = 316

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 129/278 (46%), Gaps = 14/278 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLD---LAMFHP 71
           ++LMGEH V++G  A+   + + ++ + L+ R+D    I S    Y GSL+    +M   
Sbjct: 14  IILMGEHSVVYGQPAIALPLPSVQLSVTLSSRQDNQRIIKSRY--YHGSLENLPSSMIGI 71

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                 ++        G+DLK+ SQL ++ G+GSSAA  +AI  A     Y+ EP    +
Sbjct: 72  KKLIDTLSARFNDQETGWDLKIESQLPAERGMGSSAASAIAIIRAF--FDYYDEPLDRTL 129

Query: 132 LTTAHAIVLKVQGIS-SGIDLAASIHGGLICYQMPKYSIE-KIDFIFPIHLIYSGYKTPT 189
           L     +  ++   S SG+D A       + Y   +  +  +++    + +  +G K  T
Sbjct: 130 LLQLADVEEQITHRSPSGLDAATVSSDKPLFYVKGRIGVPIEMNLDASLVIADTGKKGAT 189

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            +    I  ++ E    NE  ++    +G+L   +   L   ++  L  A+N  Q  L  
Sbjct: 190 KEA---ILAVKDELKNNNEKAEEHIKHLGELVNQTKGYLAQNDIVKLGDALNFAQTDLAA 246

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L VSD  L  ++   R+    + +K++G G G C+IAL
Sbjct: 247 LNVSDPALDHLIHVARDN-GALGAKLTGGGRGGCMIAL 283


>gi|228478387|ref|ZP_04062995.1| mevalonate kinase [Streptococcus salivarius SK126]
 gi|228250066|gb|EEK09336.1| mevalonate kinase [Streptococcus salivarius SK126]
          Length = 292

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 130/279 (46%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++LMGEH V++GH AL   +           KD  I +   +      L L    P
Sbjct: 10  AHSKIILMGEHSVVYGHPALALPL-----------KD--IEVVCQIQAAETPLTLKAQDP 56

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
             + I  A+N+++  +      + S +  + G+GSSAA+ +A   A+    + +E + + 
Sbjct: 57  LTTAIFSALNYLEIKNQPISYAIKSSVPEKRGMGSSAAVAIAAIRAVFDY-FDQELNQET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +    H          SG+D    +    I +       ++I+     +L+   +G    
Sbjct: 116 LEMLVHQAETIAHSKPSGLDAKTCLSDQAISF-TRNIGFKEIEINLGAYLVIADTGIHGN 174

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           T + ++K+  I ++   ++++NQ     +G+LSQ +  AL  K+   L Q M++    L+
Sbjct: 175 TREAVEKVEAIGLDA--LSDLNQ-----LGELSQKAELALEAKDQDTLGQLMSQAHNHLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           +LGVS   LS+++     +   + +K+SG GLG C+IAL
Sbjct: 228 SLGVS-CDLSDLLVATALEQGALGAKMSGGGLGGCIIAL 265


>gi|301105467|ref|XP_002901817.1| mevalonate kinase, putative [Phytophthora infestans T30-4]
 gi|262099155|gb|EEY57207.1| mevalonate kinase, putative [Phytophthora infestans T30-4]
          Length = 384

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 100/217 (46%), Gaps = 16/217 (7%)

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTT-AHAIVLKVQGISSGIDLAASIHGGLI 160
           GLGSSAA++VA++ A   L         E +   A++  + + G  SG D   S  GG +
Sbjct: 160 GLGSSAAMSVALSGAFAELSGSARQHELEFINKYAYSAEVILHGSPSGADNTVSCFGGTL 219

Query: 161 CYQM-PKYSIEKID-------FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQK 212
            +Q  P+ S ++I        F+     +    K   A V ++    E +  ++ +    
Sbjct: 220 LFQKHPEPSFDRIQCPLNKFRFLLVNTCVPRSTKEQVANVRRR---YEADRDKVQKRFDA 276

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA 272
           I  L+ K   +S + + ++  +VL Q M   Q +L  LGVS  ++ E+    ++     A
Sbjct: 277 IQQLVEKFVSLSERKVLSE--EVLGQEMEHNQQILSDLGVSHPQIDEVARICKQ--FNGA 332

Query: 273 SKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
           +K++G+G G C I+L    L++     +   + A+G 
Sbjct: 333 TKLTGAGGGGCTISLLPRGLSNEDLTKLITRLEARGF 369


>gi|154342246|ref|XP_001567071.1| mevalonate kinase [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134064400|emb|CAM42492.1| putative mevalonate kinase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 329

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 123/292 (42%), Gaps = 34/292 (11%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLR--------KDRLINIDSSLGQYCGSLD 65
           G ++L GEH V++G  A+V  I +     L +          D+   I   + Q  G   
Sbjct: 17  GKVILFGEHFVVYGAEAIVAGIREYTECRLEVTPGVPGLQVNDQRPAIPDYITQKRGEQK 76

Query: 66  LAMFHPSFSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
            A          + ++H++      G  + +   L    G+G+SA+  VA + AL  L Y
Sbjct: 77  KAH--------QLVLDHLQVDLSRDGLKMFIGGPLVPSSGIGASASDVVAFSRALSEL-Y 127

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM--PKYSIEKIDFIFPIHL 180
               + +++  +A        G  SG+D  A+  GGLI Y+    K  ++ I F   ++L
Sbjct: 128 QLNLTEEQVNQSAFVGEGGYHGTPSGVDNTAATFGGLISYRRHSGKSIMKSIAFQQCLYL 187

Query: 181 IY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ---ALRNKNLKV 235
           +   +G    T  V+  +  ++   PE      +   L    + I  Q   AL+  +L  
Sbjct: 188 VVVGTGITASTTAVVSDVRKMKERQPE------QFQRLCDNYTHIVSQAREALQKGDLLR 241

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + Q MN    L   +GVS  +L  IV   R     + +K+SG+G G   +AL
Sbjct: 242 VGQLMNANHDLCRKIGVSCRELESIVQTCRAY-GALGAKLSGTGRGGIAVAL 292


>gi|229546748|ref|ZP_04435473.1| mevalonate kinase [Enterococcus faecalis TX1322]
 gi|256854252|ref|ZP_05559616.1| mevalonate kinase [Enterococcus faecalis T8]
 gi|307290920|ref|ZP_07570810.1| mevalonate kinase [Enterococcus faecalis TX0411]
 gi|229308097|gb|EEN74084.1| mevalonate kinase [Enterococcus faecalis TX1322]
 gi|256709812|gb|EEU24856.1| mevalonate kinase [Enterococcus faecalis T8]
 gi|306497990|gb|EFM67517.1| mevalonate kinase [Enterococcus faecalis TX0411]
 gi|315029773|gb|EFT41705.1| mevalonate kinase [Enterococcus faecalis TX4000]
          Length = 314

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 128/285 (44%), Gaps = 21/285 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKTMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHLIYS 183
           +  E+++ +  I     G  SGID AA+     + +     P +    +   + + +  +
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFFTRGFPPTHFSMNLSNAYLV-VADT 183

Query: 184 GYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M  
Sbjct: 184 GIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLMTL 239

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 240 AQDQLQQLIVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|257415466|ref|ZP_05592460.1| mevalonate kinase [Enterococcus faecalis AR01/DG]
 gi|257157294|gb|EEU87254.1| mevalonate kinase [Enterococcus faecalis ARO1/DG]
          Length = 314

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 125/287 (43%), Gaps = 25/287 (8%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-DLAMFH 70
           A G ++LMGEH V++G  A+ F      I  +     + + ID +   + G L D+    
Sbjct: 11  ATGKIILMGEHAVVYGEPAIAFPFQATEITAV-FTPAKNMQIDCAY--FTGLLEDVPQEL 67

Query: 71  PSFSFIIMAINHIKPSCGFD--LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            +   ++    H      F   L + S + ++ G+GSSAA  VAI  +L     +     
Sbjct: 68  ANIKEVVQQTLHFLKEDTFKGTLTLTSTIPAERGMGSSAATAVAIVRSLFDYFDYAYTYQ 127

Query: 129 D--EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY---- 182
           +  E+++ +  I     G  SGID AA+     + +           F   +   Y    
Sbjct: 128 ELFELVSLSEKI---AHGNPSGIDAAATSGADPLFF---TRGFPPTHFSMNLSNAYLVVA 181

Query: 183 -SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
            +G K  T + +K I+ +    P  I E  ++    +G  ++ + QA+   + + L Q M
Sbjct: 182 DTGIKGQTREAVKDIAQLAQNNPTAIAETMKQ----LGSFTKEAKQAILQDDKQKLGQLM 237

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              Q  L+ L VS+  L  +V  L  +   + +K++G G G C+IAL
Sbjct: 238 TLAQEQLQQLTVSNDMLDRLV-ALSLEHGALGAKLTGGGRGGCMIAL 283


>gi|184155668|ref|YP_001844008.1| mevalonate kinase [Lactobacillus fermentum IFO 3956]
 gi|183227012|dbj|BAG27528.1| mevalonate kinase [Lactobacillus fermentum IFO 3956]
          Length = 311

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++LMGEH V++G  A+   +     +    R      + S    + G ++      S + 
Sbjct: 13  IILMGEHSVVYGEPAIALPLPSVATVATLTRGGVGKRLTSRY--FQGPIE--ELPTSMTG 68

Query: 76  IIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           ++  +N       P   ++L + S L ++ G+GSSAA  +AI  A     YH+E S  ++
Sbjct: 69  VLKLLNALTDRFSPDDNWELTIESDLPAERGMGSSAATAIAIIRAFFA-AYHEELSHAQL 127

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPT 189
           L  A           SG+D AA++      + +   + + ID      L+   +G K  T
Sbjct: 128 LEWADIEEEVTHRSPSGLD-AATVSSSTPLWYVKGQTGQAIDMELSATLVIADTGIKGAT 186

Query: 190 AQVLKKISYIEIEYPEINEINQKI-YALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            + +  +     E    N    K  +A MG L + +  AL   ++  L  AM+  Q  L 
Sbjct: 187 KEAIAAVK----EQLTTNPAQTKARFAHMGHLVEETKVALATDDITRLGTAMDECQQDLV 242

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
            LGVS   L  +V  + +Q     +K++G G G C+IAL    + +    +V     A  
Sbjct: 243 ALGVSSPALDHLV-AVAKQNGARGAKLTGGGRGGCMIALTATAMGARRLAAVLKENGATA 301

Query: 309 IDIVPITPSH 318
             I P+   H
Sbjct: 302 TWIQPLKGDH 311


>gi|72388266|ref|XP_844557.1| mevalonate kinase [Trypanosoma brucei TREU927]
 gi|62175380|gb|AAX69523.1| mevalonate kinase, putative [Trypanosoma brucei]
 gi|62359670|gb|AAX80102.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|70801090|gb|AAZ10998.1| mevalonate kinase, putative [Trypanosoma brucei brucei strain 927/4
           GUTat10.1]
          Length = 329

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 131/284 (46%), Gaps = 17/284 (5%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR-----LINIDSSLGQYCGSLDLAM 68
           G ++L GEH V++G  ++V  IN+     ++  K +     +I+   ++  Y        
Sbjct: 17  GKVILFGEHFVVYGAESIVAGINEYTTCEISRLKHKPNVVEVIDERPAVPGYIKEKREEQ 76

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
              +   ++  +N      G  +K+   L    G+G+SA+  V+++ AL  L Y    S 
Sbjct: 77  -RVAHGLVLRHLNIDTSKDGLLVKLGGPLVPSSGIGASASDVVSLSRALNEL-YSLNLSE 134

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP----KYSIEKIDFIFPIHLIYSG 184
           + +  +A+A      G  SG+D  A+ +GG+I ++       +S   +     I +  +G
Sbjct: 135 EAVNRSAYAGECGYHGTPSGVDNTAATYGGIILFRRALKKSVFSRLALGKTLSIIVCSTG 194

Query: 185 YKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
               T +V+  ++ ++   P   +++ ++  A + +      +AL++ NL+ + + MN  
Sbjct: 195 ITASTTKVVADVARLKAAQPSWFDDLFEQYNACVREAK----KALQSGNLRRVGELMNIN 250

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             L + L VS  +L  I    R     + +K+SG+G G  V+AL
Sbjct: 251 HTLCQKLTVSCPELDAIATCCR-TFGALGAKMSGTGRGGLVVAL 293


>gi|159116480|ref|XP_001708461.1| Mevalonate kinase [Giardia lamblia ATCC 50803]
 gi|157436573|gb|EDO80787.1| Mevalonate kinase [Giardia lamblia ATCC 50803]
          Length = 341

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 143/338 (42%), Gaps = 40/338 (11%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAIN------KRVI------------LY 42
           +G C  ++ V  P   +L GEH V++GH  +  A++       RV               
Sbjct: 4   LGPCPLELYVRTPLKAILSGEHSVVYGHPCIAMALDLYTSGHARVAKDPTCPSSLPFPTL 63

Query: 43  LTLRKDRLINIDSSLGQYCGSLDLAMFH--PSFSFIIMAINHIKPSCGFDLKVISQLDSQ 100
           L +R    +++ SS+ +    ++  +    P+      A +H    C F    +      
Sbjct: 64  LDIRTGERLDLSSSMTEAIRLINEEVLTRLPTIKRSDAACHH----CEFVEIAVHGWTLG 119

Query: 101 LGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLI 160
            GLGSSA+I V  TA LL    +  PS   +   A      + G ++G+DL   I+GG+ 
Sbjct: 120 KGLGSSASILVTHTALLLAASSNYSPS--MLFDIALLGERHIHGRTTGMDLKTVIYGGIQ 177

Query: 161 CYQMPKYSIEKID-FIFPIHLIY-----SGYKTPTAQVLKKISYIEIE--YPEINEINQK 212
            Y        KI   IF   +I      SG    TAQ ++ +S  E       I E ++ 
Sbjct: 178 IYSHGALCNAKISPDIFAARMIQVLIADSGIAKSTAQAVELVSQGENNDTLAHIGETSKD 237

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAM-NRQQGLLETLGVSDSKLSEIVWKLREQPHIM 271
           +  L+  L+  +   + N +  +   A+  R   LL +LGVS  + +E   +L       
Sbjct: 238 LIELL--LTASTPGKISNDSFYLTLSALVQRNHDLLCSLGVSVPE-TERSKELLYHMGCF 294

Query: 272 ASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
            +K++G+GLG C I  G    ++L   S + H+ A GI
Sbjct: 295 TAKLTGAGLGGCCI--GFRTQHNLVVDSPDRHVIAVGI 330


>gi|304384904|ref|ZP_07367250.1| phosphomevalonate kinase [Pediococcus acidilactici DSM 20284]
 gi|304329098|gb|EFL96318.1| phosphomevalonate kinase [Pediococcus acidilactici DSM 20284]
          Length = 360

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDS--------SLG 58
           I   APG L + GE+ ++  G++A++ A+N+ +   +   +    NI S        S  
Sbjct: 2   ITQKAPGKLYVAGEYAIVEPGNSAVLVAVNQFITASIEPSELTFGNIISKQYHDNVVSWR 61

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
           +  G L +      + +I+ AI+  +            ++L + S LDS    + GLGSS
Sbjct: 62  RKGGQLVVDNRDNPYHYILAAISITEELAVLMHRQLRTYNLYINSDLDSSDGKKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   AL   ++++ P   ++L    +I  L VQG  S  D+AAS++GG I Y+
Sbjct: 122 AAVTVATIKALA--KFYQIPLTKKLLFKLASIAHLDVQGNGSLGDIAASVYGGWIAYR 177


>gi|253751171|ref|YP_003024312.1| phosphomevalonate kinase [Streptococcus suis SC84]
 gi|253753072|ref|YP_003026212.1| phosphomevalonate kinase [Streptococcus suis P1/7]
 gi|253754894|ref|YP_003028034.1| phosphomevalonate kinase [Streptococcus suis BM407]
 gi|251815460|emb|CAZ51038.1| phosphomevalonate kinase [Streptococcus suis SC84]
 gi|251817358|emb|CAZ55094.1| phosphomevalonate kinase [Streptococcus suis BM407]
 gi|251819317|emb|CAR44668.1| phosphomevalonate kinase [Streptococcus suis P1/7]
 gi|319757440|gb|ADV69382.1| mevalonate kinase [Streptococcus suis JS14]
          Length = 359

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 144/346 (41%), Gaps = 83/346 (23%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAI------------------NKRVILYLTL-R 46
           K+ V  PG L L GE+ V+  G+ A++ A+                  +++  LYLT  R
Sbjct: 2   KVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQGSLHSSQKADLYLTWER 61

Query: 47  KDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQ---- 100
           K+  + I        GS   A+   +       +     +C   + L V S LD Q    
Sbjct: 62  KEGAVRIQ-------GSHPYALIESAMQVTEAYLTAKGYACHGTYSLSVQSDLDDQASGA 114

Query: 101 -LGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGI-DLAASIHG 157
             GLGSS A+TVA   ALLT   H+    D +LT   A + + + G++    DLAAS  G
Sbjct: 115 KYGLGSSGAVTVATVKALLTYYGHQ---ADALLTYKLAALTQSKLGMTGSFGDLAASSFG 171

Query: 158 GLICY----------QMPKYSIEKI---DF----IFPIHL-----IYSGYKTPTAQVLKK 195
           GLI Y          +M + S+  +   D+    I PI L     +  G+    A     
Sbjct: 172 GLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLLVGWTGSAASTDSL 231

Query: 196 ISYIEIEYPEINE--------------INQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           +S +E +  +  +              + Q I A     S  + QAL + N K+L Q   
Sbjct: 232 VSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQAL-SANRKLL-QDFA 289

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           R  GL+    +   +LS++      Q +   +K SG+G GDC I L
Sbjct: 290 RGMGLV----IETPQLSQLC--DLAQTYGAVAKSSGAGGGDCGICL 329


>gi|224534528|ref|ZP_03675104.1| putative phosphomevalonate kinase [Borrelia spielmanii A14S]
 gi|224514205|gb|EEF84523.1| putative phosphomevalonate kinase [Borrelia spielmanii A14S]
          Length = 317

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 81/186 (43%), Gaps = 25/186 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K       S   +     D 
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID---DF 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITVAIT 114
           ++      F+     ++  +C F+L+  +    +D+         + G GSSA + + I 
Sbjct: 59  SLIENRNDFVFKMFAYLSQNCFFNLESFAYDVYIDTSDFFFNDGTKKGFGSSAVVAIGIV 118

Query: 115 AALLTLQYHKEP-SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ---MPKYSI 169
             L  +         DEI           QG I SG D+AASI GG+I ++    PK   
Sbjct: 119 FGLFLIHNSTNVVEKDEIFKYCLEAYRHSQGGIGSGYDIAASIFGGVIEFEGGFAPK--C 176

Query: 170 EKIDFI 175
            ++DF+
Sbjct: 177 RQLDFV 182


>gi|270290282|ref|ZP_06196507.1| phosphomevalonate kinase [Pediococcus acidilactici 7_4]
 gi|270281063|gb|EFA26896.1| phosphomevalonate kinase [Pediococcus acidilactici 7_4]
          Length = 366

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 24/178 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDS--------SLG 58
           I   APG L + GE+ ++  G++A++ A+N+ +   +   +    NI S        S  
Sbjct: 8   ITQKAPGKLYVAGEYAIVEPGNSAVLVAVNQFITASIEPSELTFGNIISKQYHDNVVSWR 67

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSS 106
           +  G L +      + +I+ AI+  +            ++L + S LDS    + GLGSS
Sbjct: 68  RKGGQLVVDNRDNPYHYILAAISITEELAVLMHRQLRTYNLYINSDLDSSDGKKYGLGSS 127

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ 163
           AA+TVA   AL   ++++ P   ++L    +I  L VQG  S  D+AAS++GG I Y+
Sbjct: 128 AAVTVATIKALA--KFYQIPLTKKLLFKLASIAHLDVQGNGSLGDIAASVYGGWIAYR 183


>gi|226498346|ref|NP_001146244.1| hypothetical protein LOC100279817 [Zea mays]
 gi|219886357|gb|ACL53553.1| unknown [Zea mays]
          Length = 399

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 148/357 (41%), Gaps = 91/357 (25%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAI----NKRVILY----------------LTLRKDRLI 51
           APG ++L GEH V+HG AA+  AI    N  ++L                 L LR   L 
Sbjct: 20  APGKIILAGEHAVVHGSAAVAAAIDLYTNSSLLLRPTGPGEGGGAGSGAVELDLRDSGLT 79

Query: 52  ------NIDSSLGQY----------CGSLDLAMFH-------------------PSFSFI 76
                  +  +LG+           C    LA                       +F F+
Sbjct: 80  FSWPCSRLRGALGEEISANPGAPAPCSPDQLAAIARLLQDQEIPEAKIWLSAGLSAFLFL 139

Query: 77  IMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT------LQYHKEPSPDE 130
             +I   +P       V S L    GLGSSAA  V+++ ALLT      +   +     E
Sbjct: 140 YASILGCRPG---KAVVSSDLPMGAGLGSSAAFCVSMSGALLTAAGAVSVGARRGAEGWE 196

Query: 131 ILTTAHAIVLK---------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
           +L      ++          + G  SGID + S  G +I ++  K  +  ++   P+ ++
Sbjct: 197 VLEKGALELVNQWAFQGEKIIHGKPSGIDNSVSTFGKMIKFK--KGELTNLESWNPVKML 254

Query: 182 YSGYKT--PTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNK 231
            +  +    T  ++  +S     +P+        +N I++++ +++ +L+     A+ +K
Sbjct: 255 ITDTRVGRNTKALVAGVSERASRHPDAMASVFHAVNSISEELSSIV-ELAAEDEIAITSK 313

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVIAL 287
             K LA+ M   QGLL+ +GVS S +  +   LR    + + SK++G+G G CV+ L
Sbjct: 314 EDK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKYSLVSKLTGAGGGGCVLTL 366


>gi|260663060|ref|ZP_05863953.1| mevalonate kinase [Lactobacillus fermentum 28-3-CHN]
 gi|260552681|gb|EEX25681.1| mevalonate kinase [Lactobacillus fermentum 28-3-CHN]
          Length = 311

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 131/310 (42%), Gaps = 18/310 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++LMGEH V++G  A+   +     +    R      + S    + G ++      S + 
Sbjct: 13  IILMGEHSVVYGEPAIALPLPSVSTVATLTRGGVGKRLTSRY--FQGPIE--ELPASMTG 68

Query: 76  IIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           ++  +N       P   ++L + S L ++ G+GSSAA  +AI  A     YH+E S  ++
Sbjct: 69  VLKLLNALTDRFSPDDNWELTIESDLPAERGMGSSAATAIAIIRAFFA-AYHEELSHAQL 127

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPT 189
           L  A           SG+D AA++      + +   + + ID      L+   +G K  T
Sbjct: 128 LEWADIEEEVTHRSPSGLD-AATVSSSTPLWYVKGQTGQAIDMELSATLVIADTGIKGAT 186

Query: 190 AQVLKKISYIEIEYPEINEINQKI-YALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            + +  +     E    N    K  +A MG L + +  AL   ++  L  AM+  Q  L 
Sbjct: 187 KEAIAAVK----EQLTTNPAQTKARFAHMGHLVEETKVALATDDITRLGTAMDECQQDLV 242

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
            LGVS   L  +V  + +Q     +K++G G G C+IAL    + +    +V     A  
Sbjct: 243 ALGVSSPALDHLV-AVAKQNGARGAKLTGGGRGGCMIALTATAMGARKLAAVLKENGATA 301

Query: 309 IDIVPITPSH 318
             I P+   H
Sbjct: 302 TWIQPLKGDH 311


>gi|15212072|emb|CAC51372.1| phosphomevalonate kinase [Lactobacillus helveticus]
          Length = 294

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 113/264 (42%), Gaps = 49/264 (18%)

Query: 73  FSFIIMAINHIKPSC--------GFDLKVISQLDS----QLGLGSSAAITVAITAALLTL 120
           F +I+ AI++ +  C         +DL V S LDS    + GLGSSAA+TVA   A+L  
Sbjct: 10  FEYILSAISYTEQYCIEQNIKMKVYDLHVNSDLDSADGKKYGLGSSAAVTVATVKAIL-- 67

Query: 121 QYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHGGLICYQ-----MPKYSIE---- 170
            ++     +E++    AI    VQG  S  D+AAS++GG + YQ       +Y +     
Sbjct: 68  HFYGVKMSNELVYKLSAISHYSVQGNGSAGDIAASVYGGWLAYQTFDKKWLQYELANKTL 127

Query: 171 -----------KIDFIFPIH--LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM 217
                      KI+ + P H   +  G+    A   + +         +N   +   A  
Sbjct: 128 SDVVNEAWPGLKIELLTPPHDMKLMIGWSQKPASTSRLVDETNANKAALNTEYKNFLAAS 187

Query: 218 GKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIM------ 271
            +         + KN+ ++ + +   + LL+      +K+++I  ++     ++      
Sbjct: 188 SECVLKMIVGFKAKNIALIKKQIRVNRHLLQHF----AKINQIAIEIPRLTQLIKIAEDF 243

Query: 272 --ASKISGSGLGDCVIALGKGDLN 293
             A+K SG+G GDC I +   D +
Sbjct: 244 GGAAKTSGAGNGDCGIVITDADTD 267


>gi|16905216|gb|AAL31086.1|AC091749_15 putative mevalonate kinase [Oryza sativa Japonica Group]
          Length = 367

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 153/372 (41%), Gaps = 90/372 (24%)

Query: 7   KICVS-APGSLVLMGEHGVLHGHAALVFAIN----------------KRVILYLTLRK-- 47
           ++C + APG ++L GEH V+HG AA+  AI+                    L L L+   
Sbjct: 2   EVCAARAPGKIILAGEHAVVHGSAAVAAAIDLYTRCSLCLMPLADDEAAATLELDLKDPG 61

Query: 48  ------------------------------DRLINIDSSLGQYC---GSLDLAMFHPSFS 74
                                         DRL +I   L ++      + L+    +F 
Sbjct: 62  LTFSWPCGRLREVLLTDEAAGAREARPCSPDRLASIARLLEEHEIPEAKIWLSAGLSAFL 121

Query: 75  FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT--------------- 119
           F+  +I   +P     + V S L    GLGSSAA  V+++  LLT               
Sbjct: 122 FLYTSILGCRPG---KVTVSSDLPMGSGLGSSAAFCVSMSGVLLTAAGVVTAVGGISGEG 178

Query: 120 LQYHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           + +      D  L    A   +  + G  SGID A S  G +I ++  K  +  +    P
Sbjct: 179 MGWELVGKDDLELVNRWAFQGEKIIHGKPSGIDNAVSTFGSMIKFK--KGELTNLKSSNP 236

Query: 178 IHLIYS------GYKTPTAQVLKKISY----IEIEYPEINEINQKIYALMGKLSQISCQA 227
           + ++ +        K   A V ++ S     +   +  +N I++++ +++ +L+     A
Sbjct: 237 VKMLITDTRVGRNTKALVAGVSERASRHSDAMASVFNAVNSISEEVSSIV-ELAANDEIA 295

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHI-MASKISGSGLGDCVIA 286
           + +K  K LA+ M   QGLL+ +GVS S +  +   LR      + SK++G+G G CV+ 
Sbjct: 296 ITSKEEK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKFNLVSKLTGAGGGGCVLT 351

Query: 287 LGKGDLNSLPYQ 298
           L     +SLP +
Sbjct: 352 LIPTRSSSLPRR 363


>gi|146317947|ref|YP_001197659.1| mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|146320134|ref|YP_001199845.1| mevalonate kinase [Streptococcus suis 98HAH33]
 gi|145688753|gb|ABP89259.1| Mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|145690940|gb|ABP91445.1| Mevalonate kinase [Streptococcus suis 98HAH33]
 gi|292557731|gb|ADE30732.1| Gram positive phosphomevalonate kinase [Streptococcus suis GZ1]
          Length = 379

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 146/347 (42%), Gaps = 85/347 (24%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAI------------------NKRVILYLTL-R 46
           K+ V  PG L L GE+ V+  G+ A++ A+                  +++  LYLT  R
Sbjct: 22  KVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQGSLHSSQKADLYLTWER 81

Query: 47  KDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQ---- 100
           K+  + I        GS   A+   +       +     +C   + L V S LD Q    
Sbjct: 82  KEGAVRIQ-------GSHPYALIESAMQVTEAYLTAKGYACHGTYSLSVQSDLDDQASGA 134

Query: 101 -LGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGI-DLAASIHG 157
             GLGSS A+TVA   ALLT   H+    D +LT   A + + + G++    DLAAS  G
Sbjct: 135 KYGLGSSGAVTVATVKALLTYYGHQ---ADALLTYKLAALTQSKLGMTGSFGDLAASSFG 191

Query: 158 GLICY----------QMPKYSIEKI---DF----IFPIHL-----IYSGYKTPTAQVLKK 195
           GLI Y          +M + S+  +   D+    I PI L     +  G+    A     
Sbjct: 192 GLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLLVGWTGSAASTDSL 251

Query: 196 ISYIEIEYPEINE--------------INQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           +S +E +  +  +              + Q I A     S  + QAL + N K+L Q   
Sbjct: 252 VSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQAL-SANRKLL-QDFA 309

Query: 242 RQQGL-LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           R  GL +ET  +  S+L ++      Q +   +K SG+G GDC I L
Sbjct: 310 RGMGLVIETPQL--SQLCDLA-----QTYGAVAKSSGAGGGDCGICL 349


>gi|123227559|emb|CAM15186.1| novel protein similar to vertebrate mevalonate kinase (mevalonic
           aciduria) (MVK) [Danio rerio]
          Length = 396

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 117/276 (42%), Gaps = 63/276 (22%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDS----- 55
            ++ VSAPG ++L GEH V+HG  AL  ++N R  L L           L NID+     
Sbjct: 4   RELFVSAPGKVILHGEHSVVHGKVALAVSVNLRTYLRLQSTSSGQVCINLPNIDTFLSWE 63

Query: 56  ---------------------------SLGQYCGSLDLAMFHPS---FSFIIMAINHIKP 85
                                       L ++ G  D +    S    +F+ M I     
Sbjct: 64  ITALQPLLAGSKAEQRDPKELDADLLKKLREFTGISDDSTDTRSMAVLAFLYMYITVFAE 123

Query: 86  S-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP-----------SPDEI-L 132
           S     + V S+L +  GLGSSAA  V ++AALL+ + +  P           S DE+ L
Sbjct: 124 SLASITVSVWSELPTGAGLGSSAAYNVCLSAALLSARGNISPLLMAQQESARWSKDEMEL 183

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP-T 189
               A + +  + G  SG+D A    GG + Y     +I  + ++  + ++ +  K P +
Sbjct: 184 INRWAFMGEKIIHGNPSGVDNAVGTWGGFLRYH--SGNITPLSWVPILRILLTNTKVPRS 241

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC 225
            +VL  +S ++    +IN+    +  ++  +S +SC
Sbjct: 242 TKVL--VSGVK---DKINKFPSVMRPVLESVSAVSC 272


>gi|303245042|ref|ZP_07331363.1| mevalonate kinase [Methanothermococcus okinawensis IH1]
 gi|302484605|gb|EFL47548.1| mevalonate kinase [Methanothermococcus okinawensis IH1]
          Length = 383

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 128/301 (42%), Gaps = 65/301 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT------------------LRKDRLI 51
           + AP  ++L GEH V+ G+ A+  A++ + +  +                   L K+  +
Sbjct: 48  IGAPSKVILFGEHAVVDGYGAISMAVDLKTMGEIVSSENENNNKNKIIIDLKDLNKNIKL 107

Query: 52  NIDS---------------------SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFD 90
           NI                       ++  Y    +L   H  F    M IN+ K    F 
Sbjct: 108 NIKDLPNINIKDYENDLKYVICSLKNVANYLIKKNLLNIH-DFDDYDMNINNNKKIKPFK 166

Query: 91  LKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGID 150
           L + S +    GLGSSA++ +    + L     K  S DEI   A+++  +VQG +S  D
Sbjct: 167 LIISSNIPVSCGLGSSASVIITTIKSFLHANNIK-LSDDEIAKIAYSVEKEVQGKASITD 225

Query: 151 LAASIHGGLI-----CYQMPKYS-----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE 200
            A   +  ++      +++ K S     ++K +F+  +H+     K  TA+++ +++   
Sbjct: 226 TATITYNTILKIKNNTFELMKNSNLHNLLKKCNFLI-VHV--EERKKKTAELVNEVA--- 279

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEI 260
             +P  NEI + I  ++ K   I+        ++ L + M +   LL+ LGVS  K+ ++
Sbjct: 280 -NHPYKNEIFKSIGEIVDKAESINS-------MQELGKLMVKNHELLKQLGVSTEKMDKV 331

Query: 261 V 261
           V
Sbjct: 332 V 332


>gi|294786237|ref|ZP_06751491.1| mevalonate kinase [Parascardovia denticolens F0305]
 gi|294485070|gb|EFG32704.1| mevalonate kinase [Parascardovia denticolens F0305]
          Length = 303

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 117/268 (43%), Gaps = 27/268 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVF---------AINKRVILYLTLRKDRLINIDSSLGQYCG 62
           A G ++L+GEH V+H   A+           A++     YL  R         +   Y G
Sbjct: 34  AHGKVILIGEHSVVHFKPAIALPLMTTAIDVAVSANGSSYLDPR------FHLTCDYYSG 87

Query: 63  SLDLAMFHPSFSFIIMAINHIK---PS--CGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
            L+ A F+ +    + A  H +   P    GFD+ ++S +  + G+GSSAA+ VA+T A+
Sbjct: 88  PLESAPFNLNNLKKLQAALHNRLCLPQKLGGFDINIVSTIPRERGMGSSAAVAVALTRAI 147

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
                    S  EI   +        G +SG+D  A+ H   + ++    +    D   P
Sbjct: 148 AAYS-GVILSEQEIFDYSQISENVAHGNASGLDSIATAHDKAVWFERGAQT-RTFDLACP 205

Query: 178 IHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQ--KIYALMGKLSQISCQALRNKNL 233
             LI   +G +  T + ++ +  + +   E  E  Q  K    +G+L+    +ALR  ++
Sbjct: 206 GVLIVADTGIRGGTREAVEDVHKL-LYSQERGEARQAAKDIDRLGELTADCARALRQGDV 264

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIV 261
           + L   M+    +L +L VS  +L  +V
Sbjct: 265 RRLGYIMDEAHEVLSSLAVSSPELDRLV 292


>gi|255713922|ref|XP_002553243.1| KLTH0D12232p [Lachancea thermotolerans]
 gi|238934623|emb|CAR22805.1| KLTH0D12232p [Lachancea thermotolerans]
          Length = 415

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 136/338 (40%), Gaps = 63/338 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINK-RVILYLTLRKD------------------ 48
           +  SAPG +++ GEH  +    A+  +++  R  L ++  +D                  
Sbjct: 5   LLTSAPGKVIIFGEHSAVFNEPAVAASVSALRTYLLVSAAQDPKVVELDFPDIKFDKQWS 64

Query: 49  -------------------RLINIDSS------LGQYCGSLDLAMFHPSFSFIIMAINHI 83
                              R +N D S      L    GSL    +  ++ F+ M  +  
Sbjct: 65  GEALATIAAGVQPEAVTDSRELNADLSNALESLLQPLSGSLH---YQAAYCFLYMYFSLC 121

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLK-- 141
               G    V S L    GLGSSA++ V +  AL  L  H +   + +     A V K  
Sbjct: 122 GTRTGVKFTVKSSLPIGAGLGSSASLAVCLALALGKLGGHLKHGTESLTKEELAFVNKWS 181

Query: 142 ------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FP-IHLIYSGYKTP--TA 190
                 + G  SGID   + +G  + +Q       K + I  FP I ++ +  + P  T 
Sbjct: 182 FIGEKCIHGTPSGIDNMVATYGSAVLFQRLPSGETKSEQILSFPQIPMVLTNTRIPRSTK 241

Query: 191 QVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            ++  +  + +  PE+   I + +  +    +QI  Q L + N + L + +    GLL  
Sbjct: 242 VLVAGVKDLIVRQPEVMKPILESMGVVASSGAQILSQ-LTDANYESLCELVRVNHGLLVA 300

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           LGVS   L E++  + +  +I  +K++G+G G C + L
Sbjct: 301 LGVSHPGL-ELIKSVGDSMNIGHTKLTGAGGGGCALTL 337


>gi|227544618|ref|ZP_03974667.1| mevalonate kinase [Lactobacillus reuteri CF48-3A]
 gi|300910252|ref|ZP_07127712.1| mevalonate kinase [Lactobacillus reuteri SD2112]
 gi|227185401|gb|EEI65472.1| mevalonate kinase [Lactobacillus reuteri CF48-3A]
 gi|300892900|gb|EFK86260.1| mevalonate kinase [Lactobacillus reuteri SD2112]
          Length = 316

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 128/277 (46%), Gaps = 12/277 (4%)

Query: 16  LVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKD--RLINIDSSLGQYCGSLDLAMFHPS 72
           ++LMGEH V++G  A+   + + ++ + L+ R+D  R+I      G   G+L  +M    
Sbjct: 14  IILMGEHSVVYGQPAIALPLPSVQLSVTLSSRQDNQRIIKSRYYHGS-LGNLPSSMIGIK 72

Query: 73  FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEIL 132
                ++        G+DLK+ SQL ++ G+GSSAA  +AI  A     Y+ EP    +L
Sbjct: 73  KLIDTLSARFNDHETGWDLKIESQLPAERGMGSSAASAIAIIRAF--FDYYDEPLDRTLL 130

Query: 133 TTAHAIVLKVQGIS-SGIDLAASIHGGLICYQMPKYSIE-KIDFIFPIHLIYSGYKTPTA 190
                +  ++   S SG+D A       + Y   +  +  +++    + +  +G K  T 
Sbjct: 131 LQLADVEEQITHRSPSGLDAATVSSDKPLFYVKGRIGVPIEMNLDASLVIADTGKKGATK 190

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
           +    I  ++ E    NE  +     +G+L   +   L   ++  L  A+N  Q  L  L
Sbjct: 191 EA---ILAVKDELKNNNEKAEGHIKHLGELVNQTKDYLTQNDIVKLGDALNFAQTDLAAL 247

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            VSD  L  ++   R+    + +K++G G G C+IAL
Sbjct: 248 NVSDPSLDHLIHVARDNG-ALGAKLTGGGRGGCMIAL 283


>gi|294790207|ref|ZP_06755365.1| mevalonate kinase [Scardovia inopinata F0304]
 gi|294458104|gb|EFG26457.1| mevalonate kinase [Scardovia inopinata F0304]
          Length = 338

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 131/297 (44%), Gaps = 24/297 (8%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAI-----NKRVILYLTLRKDRLINIDSSLGQYC 61
           K    A G ++L+GEH V+H   A+   +        V    +L      +ID     + 
Sbjct: 17  KYTGQAHGKIILIGEHSVVHFKPAIALPLMSTCMEAAVEANGSLSSAPNFSIDCKY--FS 74

Query: 62  GSLDLAMFHPSFSFIIMAI---NHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAA 116
           G+L  A  + S    ++AI      +P    GF++ + S +  + G+GSSAA+ VA+  A
Sbjct: 75  GNLADAPGNLSNVKSLVAILSQQLCRPQGLGGFNIDISSSIPQERGMGSSAAVAVALIRA 134

Query: 117 LLTLQYHKEPSPD-EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
           +    Y      D EI            G +SG+D  A+ H   + ++  +  ++  D  
Sbjct: 135 IA--DYAGVVLADQEIFDYTQISENIAHGNASGLDSIATAHDKAVWFERGQ-ELKVFDCQ 191

Query: 176 FPIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYA---LMGKLSQISCQALRN 230
            P  L+   +G K  T Q +  +    + Y +   + +K       +G+L++ + QAL  
Sbjct: 192 CPGTLLVADTGVKGGTRQAVDDVR--ALLYSQERGLARKAAEDIDRLGQLTEEAAQALSG 249

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             ++ L   ++  Q  L  L VS  +L  ++   R Q   + +K++G G G C+IAL
Sbjct: 250 GYMRKLGYILDEAQDTLSALTVSSPELDRLIDAAR-QAGALGAKLTGGGRGGCMIAL 305


>gi|218184314|gb|EEC66741.1| hypothetical protein OsI_33094 [Oryza sativa Indica Group]
          Length = 401

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 149/361 (41%), Gaps = 90/361 (24%)

Query: 7   KICVS-APGSLVLMGEHGVLHGHAALVFAIN----------------KRVILYLTLRK-- 47
           ++C + APG ++L GEH V+HG AA+  AI+                    L L L+   
Sbjct: 2   EVCAARAPGKIILAGEHAVVHGSAAVAAAIDLYTRCSLCLMPLADDEAAATLELDLKDPG 61

Query: 48  ------------------------------DRLINIDSSLGQYC---GSLDLAMFHPSFS 74
                                         DRL +I   L ++      + L+    +F 
Sbjct: 62  LTFSWPCGRLREVLLTDEAAGAREARPCSPDRLASIARLLEEHEIPEAKIWLSAGLSAFL 121

Query: 75  FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT--------------- 119
           F+  +I   +P     + V S L    GLGSSAA  V+++  LLT               
Sbjct: 122 FLYTSILGCRPG---KVTVSSDLPMGSGLGSSAAFCVSMSGVLLTAAGVVTAVGGISGEG 178

Query: 120 LQYHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           +++      D  L    A   +  + G  SGID A S  G +I ++  K  +  +    P
Sbjct: 179 MEWELVGKDDLELVNRWAFQGEKIIHGKPSGIDNAVSTFGSMIKFK--KGELTNLKSSNP 236

Query: 178 IHLIYS------GYKTPTAQVLKKISY----IEIEYPEINEINQKIYALMGKLSQISCQA 227
           + ++ +        K   A V ++ S     +   +  +N I++++ +++ +L+     A
Sbjct: 237 VKMLITDTRVGRNTKALVAGVSERASRHSDAMASVFNAVNSISEEVSSIV-ELAANDEIA 295

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHI-MASKISGSGLGDCVIA 286
           + +K  K LA+ M   QGLL+ +GVS S +  +   LR      + SK++G+G G CV+ 
Sbjct: 296 ITSKEEK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKFNLVSKLTGAGGGGCVLT 351

Query: 287 L 287
           L
Sbjct: 352 L 352


>gi|257124949|ref|YP_003163063.1| mevalonate kinase [Leptotrichia buccalis C-1013-b]
 gi|257048888|gb|ACV38072.1| mevalonate kinase [Leptotrichia buccalis C-1013-b]
          Length = 296

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 127/280 (45%), Gaps = 26/280 (9%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++L+GEH V++G+ A+   + K++ +   + + +     S       +L +A+F      
Sbjct: 12  IILIGEHSVVYGYPAIAIPL-KKIGIECIVEEAK----SSCFHNKTDTLSVALF------ 60

Query: 76  IIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTT 134
              A+ ++K  +     KV SQ+  + G+GSSAA  V+I A      Y  E   DE+L  
Sbjct: 61  --TALKYLKKENAKIKYKVTSQIPPKRGMGSSAA--VSIVAIRAVFDYFGENLEDELLEK 116

Query: 135 -AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPTAQ 191
             H   +      SG+D    +    I + +       ID     +L+   +G    T++
Sbjct: 117 LVHTAEIVAHSTPSGLDAKTCLSDKAIKF-IKNKGFSYIDLNLDAYLVIADTGIYGNTSE 175

Query: 192 VLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV--LAQAMNRQQGLLET 249
            ++ +  +       +   +K+  L  ++++I  + +++K  KV  + + M +    L  
Sbjct: 176 AIQNVKNLG---SNADSSLKKLGKLTDEMAKILTENIQSKEEKVNKIGKIMTKANIELRN 232

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L ++  K +++  K   +     +KISG GLG CVIAL K
Sbjct: 233 LNITIEK-TDLFVKTAIENGASGAKISGGGLGGCVIALAK 271


>gi|256843263|ref|ZP_05548751.1| mevalonate kinase [Lactobacillus crispatus 125-2-CHN]
 gi|293380927|ref|ZP_06626961.1| mevalonate kinase [Lactobacillus crispatus 214-1]
 gi|312978154|ref|ZP_07789898.1| mevalonate kinase [Lactobacillus crispatus CTV-05]
 gi|256614683|gb|EEU19884.1| mevalonate kinase [Lactobacillus crispatus 125-2-CHN]
 gi|290922502|gb|EFD99470.1| mevalonate kinase [Lactobacillus crispatus 214-1]
 gi|310894872|gb|EFQ43942.1| mevalonate kinase [Lactobacillus crispatus CTV-05]
          Length = 302

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 138/283 (48%), Gaps = 20/283 (7%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A G ++++GEH V++G+ AL   I K + +  T+     + +D++  +Y G L  A    
Sbjct: 7   AHGKVIIIGEHSVVYGYDALAMPI-KALHIKTTVESASQMWMDTA--RYHGPLFEA--PA 61

Query: 72  SFSFIIMAINHIKPSCGFD--LKV--ISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
            +  +   + H++   G +  LK+    ++  + G GSSA + +  T A+    +    +
Sbjct: 62  EYDGLKYVVKHMQKKAGNNHPLKITYTGEIPMEHGFGSSATVALGTTRAMNQF-FQLNMT 120

Query: 128 PDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             EI+T T HA ++   G +SG+D AA+++   + +   K   +    I    L  +   
Sbjct: 121 EKEIMTVTNHAEMIN-HGKASGLD-AATVNSDYLVFFNKKMGPK----ILQTKLGATLLI 174

Query: 187 TPTAQV--LKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
             T Q+   K+  ++  +  E ++  +K  A +G+L+ ++ +A    + + + Q  N  Q
Sbjct: 175 MDTGQLGNTKEAVFLVKKMLEKSDYAKKKIARLGELADLTKKAWIKHDRQAVGQIFNEAQ 234

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +L +  +S +K+ ++  K+    + +  K+SG GLG   I+L
Sbjct: 235 EILHSFDLSTNKIDQLQ-KIALSNNALGFKLSGGGLGGITISL 276


>gi|108763233|ref|YP_633172.1| putative phosphomevalonate kinase [Myxococcus xanthus DK 1622]
 gi|108467113|gb|ABF92298.1| putative phosphomevalonate kinase [Myxococcus xanthus DK 1622]
          Length = 359

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 139/346 (40%), Gaps = 54/346 (15%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS----- 63
            +SAPG L L GE+ VL G  A + A+  R   Y+  R D  +++    G   GS     
Sbjct: 4   ALSAPGKLFLSGEYAVLWGGVARLAAVAPRTAAYVRRRADARVHVCLEEGTLAGSTTPLG 63

Query: 64  LDLAMFHPS-FSFIIMAIN-----HIKPSCGFDLKV----ISQLDSQLGLGSSAAITVAI 113
           +      P+ F+F+  A++     H + S GFDL V    +     +LG+G SA  TV  
Sbjct: 64  VRWEREVPAGFAFVARALDEALRAHGRASQGFDLAVAPSAVGPNGQKLGMGGSACATV-- 121

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-I 172
             A    +Y  E   D +     A      G  SG D+A S  GG++ Y+  +Y +   I
Sbjct: 122 -LAAEGARYVLEERYDALKLALLAHTQGQGGKGSGGDVATSFAGGVLRYR--RYDVAPLI 178

Query: 173 DFIFPIHLIYSGYKTPTAQVLKKIS-YIEIEYPEINEINQKIYALMGKLSQISCQALRNK 231
           +      L  +  ++P+  V +  S  + + Y    E +     L+G++     +A R  
Sbjct: 179 EASNTGRLRAALAESPSVDVWRLPSPRVSMAYAFTGE-SASTRVLIGQVEARLEEAGRRS 237

Query: 232 -------------------NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMA 272
                              + +  ++A+  Q  LL  LG  +++    V  L    +  A
Sbjct: 238 FVERSDTLGHAIEDGLSGGDFRAFSEAVKAQHALLLELGPLETEGMRRVLAL-AATYGAA 296

Query: 273 SKISGSGLGDCVIALGKGDLNSLPYQSVNCHM----HAKGIDIVPI 314
            K+SG+G GD  I          P   V   M     A+G   +P+
Sbjct: 297 GKLSGAGGGDGCILFA-------PDAQVRAEMCKGLEARGFHTLPL 335


>gi|55925207|ref|NP_001007350.1| mevalonate kinase [Danio rerio]
 gi|55250855|gb|AAH85528.1| Zgc:103473 [Danio rerio]
 gi|182890482|gb|AAI64491.1| Zgc:103473 protein [Danio rerio]
          Length = 396

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 134/322 (41%), Gaps = 74/322 (22%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDS----- 55
            ++ VSAPG ++L GEH V+HG  AL  ++N R  L L           L NID+     
Sbjct: 4   RELFVSAPGKVILHGEHSVVHGKVALAVSVNLRTYLRLQSTSSGQVCINLPNIDTFLSWE 63

Query: 56  ---------------------------SLGQYCGSLDLAMFHPS---FSFIIMAINHIKP 85
                                       L ++ G  D +    S    +F+ M +     
Sbjct: 64  ITALQPLLAGSKAEQRDPKELDADLLKKLREFTGISDDSTDTRSMAVLAFLYMYLTVFAE 123

Query: 86  S-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP-----------SPDEI-L 132
           S     + V S+L +  GLGSSAA  V ++AALL+ + +  P           S DE+ L
Sbjct: 124 SLASITVSVWSELPTGAGLGSSAAYNVCLSAALLSARGNISPLLMAQQESARWSKDEMEL 183

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP-T 189
               A + +  + G  SG+D A    GG + Y     +I  + ++  + ++ +  K P +
Sbjct: 184 INRWAFMGEKIIHGNPSGVDNAVGTWGGFLRYH--SGNITPLSWVPILRILLTNTKVPRS 241

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC---QALRN--------KNLKVLAQ 238
            +VL  +S ++    +IN+    +  ++  +S +SC   Q L          ++  +L +
Sbjct: 242 TKVL--VSGVK---DKINKFPSVMRPVLESVSAVSCTCEQTLTEMAEHGPSAEHYNILEE 296

Query: 239 AMNRQQGLLETLGVSDSKLSEI 260
            ++  Q  L  +GV  S L  +
Sbjct: 297 LIDINQHHLNVMGVGHSSLDTL 318


>gi|146304338|ref|YP_001191654.1| phosphomevalonate kinase [Metallosphaera sedula DSM 5348]
 gi|145702588|gb|ABP95730.1| phosphomevalonate kinase [Metallosphaera sedula DSM 5348]
          Length = 322

 Score = 53.5 bits (127), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 139/322 (43%), Gaps = 68/322 (21%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRV-------------ILYLTLRKDRLI 51
           +    VSAPG ++ +G + V+ G  + V AI+KRV               Y    + +  
Sbjct: 1   MQSFEVSAPGKVLWIGSYSVVFGGISHVIAIDKRVRCRCEESERLEFITSYGNFSEGQNE 60

Query: 52  NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITV 111
            IDS L +     D+          +  IN   P+   D K       + GLGSS+A TV
Sbjct: 61  LIDSVLNEVRTIYDIPRLR------VYLIND--PAFQIDGK-------KTGLGSSSAGTV 105

Query: 112 AITAALLTLQYHKEPSPDEILT---TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           A+TA    L Y      D  L    +  A   + +GI SG D+AA+ +G +I  +    +
Sbjct: 106 ALTAC---LSYAVTGKFDVDLVYKLSQRANYRRQKGIGSGFDIAAATYGSVIYRRYNDIN 162

Query: 169 -----IEKIDFIFPIHLI--YSGYKTPTAQVLKK-------------ISYIEIEYPEINE 208
                +E++D    I ++  ++G    T  ++++             +S IEI+    NE
Sbjct: 163 KVDSVVERLDIPQNIQILLGFTGRSASTVNLVRRFEDTKNNPRFKELMSEIEID----NE 218

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVS-DSKLSEIVWKLREQ 267
           I  K+  L    + +    L  +NL +L++         E +GV  +++    +  L E+
Sbjct: 219 IAIKLLRLGKIDAAVPHIKLARQNLNLLSK---------EVVGVEIETEEDRKLMSLAEK 269

Query: 268 PHIMASKISGSGLGDCVIALGK 289
              + S + G+G GD ++ALG+
Sbjct: 270 NGALISLMPGAGGGDLILALGE 291


>gi|323339820|ref|ZP_08080089.1| mevalonate kinase [Lactobacillus ruminis ATCC 25644]
 gi|323092693|gb|EFZ35296.1| mevalonate kinase [Lactobacillus ruminis ATCC 25644]
          Length = 319

 Score = 53.5 bits (127), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 122/283 (43%), Gaps = 22/283 (7%)

Query: 16  LVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPS-- 72
           ++L+GEH V++G  A+   +   +    +  R+D  I I S   ++ G L  A   PS  
Sbjct: 16  VILIGEHSVVYGRPAIAIPLKTIKATSTIKSREDGQIIIHSE--RFDGLLADA---PSDM 70

Query: 73  ---FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                 I+ A+       G +  + S +    G+GSSA + VA+  AL +  +    S  
Sbjct: 71  TGIKKLILDAVRKQNYQKGLEATLKSMVPIARGMGSSACVAVALARALFSF-FSLHFSEK 129

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
           E+L  A+   +      SG+D A       I     K     I+    + +  +G K  T
Sbjct: 130 ELLAAANIEEVATHTNPSGLDAATCASNTPIWMMAGKIKRIPINLDGCLLICDTGIKGQT 189

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKNLKVLAQAMNRQQGL 246
           ++ +  +         +    ++  AL  KL +++  A   L   +L  L Q  +  Q +
Sbjct: 190 SEAIAAVK------KRLGSDAKETNALFDKLQELTFAAKKQLAKNDLIGLGQTFDAAQSV 243

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L+TLGVS  +L E +  + +    + +K++G G G C I L K
Sbjct: 244 LKTLGVSCDELDEYI-SVAKDNGALGAKLTGGGRGGCFICLTK 285


>gi|300770437|ref|ZP_07080316.1| galactokinase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762913|gb|EFK59730.1| galactokinase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 384

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 137/333 (41%), Gaps = 47/333 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V +PG + ++GEH   +    L  AINK V + +  R+D  I + ++  +    +  A
Sbjct: 20  IIVKSPGRINIIGEHTDYNDGFVLPAAINKAVYVAVAPRQDNNICLYAADFREMFQVSSA 79

Query: 68  MFHPSF----SFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              P+     ++I+  ++ I+       GF+L +   + +  GL SSAA+  A   AL  
Sbjct: 80  DLQPAEKGWPNYILGVVDQIQKRGLHVGGFNLFIDGDVPAGAGLSSSAAVECATAFALNE 139

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LICY---------Q 163
           L +    S  +I            G+  GI D  AS+         L C          +
Sbjct: 140 L-FSLNLSRIDIARIGQLAEHTYVGVKCGIMDQFASVLSEKDQVFRLDCRSLAYEYFPLE 198

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ- 222
           + +Y I  ++      L  S Y     +    +S+I   YPE+  +      ++ ++ + 
Sbjct: 199 LGEYMILLLNTNVKHSLGDSQYNKRREKCELGVSWIRENYPEVKSLRDVTIEMLDEVVKK 258

Query: 223 ------ISCQALRNKNLKVLA--QAMNR-------------QQGLLETLGVSDSKLSEIV 261
                 I C+ +  +NL+V+A  QAM +              +GL +   VS  +L  +V
Sbjct: 259 RDEDVYIKCRYVVEENLRVVAACQAMEKGDLVSLGQHIYASHKGLSKAYQVSCEELDFLV 318

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
                 P ++ +++ G G G C I L K D + 
Sbjct: 319 DATYAYPDVLGARMMGGGFGGCTINLVKKDFSD 351


>gi|295397031|ref|ZP_06807145.1| phosphomevalonate kinase [Aerococcus viridans ATCC 11563]
 gi|294974722|gb|EFG50435.1| phosphomevalonate kinase [Aerococcus viridans ATCC 11563]
          Length = 394

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 87/349 (24%), Positives = 145/349 (41%), Gaps = 77/349 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTL-------------RKDRLINI 53
           I V+ PG L L GE+ V+  G AAL+  ++    L+LTL             + D  I  
Sbjct: 20  IKVAVPGKLFLAGEYAVVSSGQAALLTTVD--AFLHLTLEVNSGQNGYLITNQADHPIAW 77

Query: 54  DSSL-GQYCGSLDLAMFHPSFSFIIMAINHIKPSCG---------FDLKVISQLD----S 99
              + GQ   +   A   P     +  +     + G         FDLK+ S LD    +
Sbjct: 78  TYDVNGQVVSNDPEAGEFPLIWQALQTVTAYAEATGMKSAATPDYFDLKIQSDLDAADGT 137

Query: 100 QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAI--VLKVQGISSGI-------- 149
           + GLGSS AI+VA+ +AL  L+++K    D+ +T +  +  V K+  I+           
Sbjct: 138 KYGLGSSGAISVAVVSAL--LKFYK---LDQDITESQWVYRVFKLVAITQAQLGMVGSLG 192

Query: 150 DLAASIHGGLICYQ-------------------------MPKYSIEK--IDFIFPIHLIY 182
           D+AAS   G+I YQ                          P+  IE+  +D  + + L++
Sbjct: 193 DVAASTQTGVIYYQNFDREWFDQQAKSTGQEIHALIEEFWPELMIEQLPVDPDWTLSLVW 252

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM-- 240
           S  K  T  +LK +++  I   E+ E+      L  +   ++  A++     +   A+  
Sbjct: 253 SKEKASTEDLLKMVAH-HISERELEEVMTSFKQLAKRQVLMAKAAIQMNEWSLFKSAIKD 311

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLRE--QPHIMASKISGSGLGDCVIAL 287
           N    L  T  ++   L++   K  +        +KISG+G GDC  A+
Sbjct: 312 NFDNILTYTQTLNKPYLTKSFKKALKLVTSEKTVAKISGAGAGDCAYAI 360


>gi|50424525|ref|XP_460851.1| DEHA2F11176p [Debaryomyces hansenii CBS767]
 gi|49656520|emb|CAG89196.1| DEHA2F11176p [Debaryomyces hansenii]
          Length = 433

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 140/354 (39%), Gaps = 72/354 (20%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVIL---------------------------- 41
           VSAPG +++ GEH  ++G  A+  A++ R  L                            
Sbjct: 8   VSAPGKVIIYGEHSAVYGKPAIAAALSLRAYLLVTPCEDVNDIRLDFPDIGLSHSWNKEN 67

Query: 42  --------YLTLRKDRLINIDSSLGQYCGSLDLAM--------FHPSFSFIIMAIN-HIK 84
                   ++T + ++ +  +  + +    L   +        +     F+ +  N   K
Sbjct: 68  IPWEDIRKFVTFKDEKPVVTEELVPEIVDLLSTVLADVESKLHYTACLCFLYLYANLSNK 127

Query: 85  PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ--------------YHKEPSPDE 130
              G    V S L    GLGSSA   V + +AL  L               Y KE S  +
Sbjct: 128 DVPGMRFIVKSTLPIGAGLGSSACTAVCLASALARLGKHVSAACHTSTEKVYKKENSDLD 187

Query: 131 ILTTAHAIVLK-VQGISSGIDLAASIHGGLICYQM----PKYSIEKIDFIF-PIHLIYSG 184
            + +   +  K   G  SGID A + +GG + +Q      K S+      F PI LI   
Sbjct: 188 FIDSWSLMGEKCFHGNPSGIDNAVATYGGAVMFQRTTIPSKPSVRTTMRNFPPIKLILIN 247

Query: 185 YKTP--TAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLK-VLAQAM 240
            K P  TA ++  ++ +   YP+    I   +  L+ +  QI  +    K  K  L + +
Sbjct: 248 TKVPRSTAALVGNVAQVNRTYPKCAGSILDAMEHLVFEAYQIMIRPSFGKEEKDQLRELV 307

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLN 293
           N   GLL  LGVS   L +I  K+    H I ++K++G+G G C I+L   D+ 
Sbjct: 308 NINHGLLVALGVSHPALEKI--KIIGDTHGIGSTKLTGAGGGGCAISLVHDDVE 359


>gi|239636794|ref|ZP_04677796.1| mevalonate kinase [Staphylococcus warneri L37603]
 gi|239598149|gb|EEQ80644.1| mevalonate kinase [Staphylococcus warneri L37603]
          Length = 306

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 114/253 (45%), Gaps = 16/253 (6%)

Query: 14  GSLVLMGEHGVLHGHAALVFAIN--KRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           G ++L+GEH V  G  A+    N  K  +L  +L K     I+S +  Y G L  A  H 
Sbjct: 11  GKIILIGEHAVTFGQPAIAIPFNSGKIKVLIESLEKGNYSAIESDV--YDGLLYDAPEHL 68

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD-E 130
             S +   I++        +K+ + L    GLGSSAAI VA T A  +  +  +P  D E
Sbjct: 69  K-SMVTRFIDNTGVEEPLLVKIQTNLPPSRGLGSSAAIAVAFTRA--SYDFLGKPLSDAE 125

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYKTPT 189
           ++  A+       G  SGID    +    + +Q     +++ +     + +I +G K  T
Sbjct: 126 LIEEANWAEKIAHGKPSGIDTQTIVSSKPVWFQKGHAETLKTLQLNGYMVVIDTGVKGST 185

Query: 190 AQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            Q ++ +  +  E PE ++ I       +G L   + QA+ + +   +A+  N  Q  L 
Sbjct: 186 KQAVEDVHQL-CESPEYMSHIEH-----IGDLVYQASQAIEHHDFNQIARIFNECQQDLR 239

Query: 249 TLGVSDSKLSEIV 261
            L VS  K+ E++
Sbjct: 240 NLTVSHDKIEELL 252


>gi|24378695|ref|NP_720650.1| putative mevalonate kinase [Streptococcus mutans UA159]
 gi|24376559|gb|AAN57956.1|AE014869_1 putative mevalonate kinase [Streptococcus mutans UA159]
          Length = 332

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 131/295 (44%), Gaps = 30/295 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           A G ++LMGEH V++G  A+    +  V     +++D       +L   C   D      
Sbjct: 23  ASGKIILMGEHAVVYGQPAIAIPFSA-VETVAEVKED-----GEALTVTCEFYDGLVHKM 76

Query: 66  ---LAMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
              L     +  F +  I   + P+   D+   S + ++ G+GSSAA+ VAI  +L    
Sbjct: 77  PEILESLKHAIRFSLYRIGAPQDPAIHIDIH--STIPAERGMGSSAAVAVAIARSLFNF- 133

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
           Y K  +  E+     +      G  SGID   +  G    + +    IE++      +LI
Sbjct: 134 YGKVLTDKELWEIVQSSEKIAHGNPSGID-TVTTSGKSPVFFVKDQPIEQLSINMDAYLI 192

Query: 182 YSGYKTPTAQVLKKI-------SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
            +     T Q LK I       S +  +   +++  Q I  L G+L++++ +AL N  + 
Sbjct: 193 VAD-TGQTGQTLKAIQSVKALLSKVTYQIDSLSDPKQAIKEL-GQLTKLAKEALLNNYIL 250

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            L + MN+   LL +L VS+  L  +    R Q   + +K++G G G C+IAL K
Sbjct: 251 ELGEVMNQAHQLLASLTVSNQTLDRLAQAAR-QAGALGAKLTGGGRGGCLIALAK 304


>gi|312868451|ref|ZP_07728651.1| mevalonate kinase [Streptococcus parasanguinis F0405]
 gi|311096196|gb|EFQ54440.1| mevalonate kinase [Streptococcus parasanguinis F0405]
          Length = 294

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 129/293 (44%), Gaps = 50/293 (17%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR---LINIDSSLGQYCGSLDLAM 68
           A   ++L+GEH V++G+ A+   ++   +    +  D    L   D+        L +A+
Sbjct: 12  AHSKIILIGEHAVVYGYPAIALPLHHIEVTCQIIPADSPWILFEDDT--------LSMAV 63

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           F    S   + I   +  C    ++ S +  + G+GSSAA+++A   A+    Y++E   
Sbjct: 64  F---ASLEHLGIKEARIRC----RIQSMVPEKRGMGSSAAVSIAAIRAVF--DYYQEELD 114

Query: 129 DEILTTAHAIVLKVQGIS----SGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL---- 180
           DE L     +V + + I+    SG+D    +    I +      I  + F +P+ L    
Sbjct: 115 DETLEV---LVNRAETIAHMNPSGLDAKTCLSDQAIKF------IRNVGF-YPLELGIKA 164

Query: 181 ----IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
                 +G    T + ++K+   E    E+     +I    G+L+Q   +AL   +L  L
Sbjct: 165 SLVIADTGIHGNTREAIQKV---EARGQEVLSHFHEI----GQLTQQVEEALEMNDLTNL 217

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            QA+      L  +GVS  K   +V    E    + +K+SG GLG CVIAL K
Sbjct: 218 GQALTTCHEHLRAVGVSCEKADHLVAVALENG-ALGAKMSGGGLGGCVIALVK 269


>gi|295672626|ref|XP_002796859.1| mevalonate kinase [Paracoccidioides brasiliensis Pb01]
 gi|226282231|gb|EEH37797.1| mevalonate kinase [Paracoccidioides brasiliensis Pb01]
          Length = 545

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 147/360 (40%), Gaps = 94/360 (26%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 115 VSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSQRTITLNFRDIELDHTWD-- 172

Query: 61  CGSLDLAMF-HPS-FSFIIMAINHIKP-------------SCGFDLKV------------ 93
             SL  A+F  PS   F   ++  + P             S G   +V            
Sbjct: 173 IDSLPWALFCQPSKKKFYYDSVTSLDPELLEAIQPHIADISIGKPDEVQKIHRSSATAFL 232

Query: 94  --------------ISQLDSQLGLG----SSAAITVAITAALLTLQ-------YHKEPSP 128
                         I  L S + +G    SSA+I V ++AALL LQ       +H +P P
Sbjct: 233 YLFLSLSSPGSHAAIYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHHDQP-P 290

Query: 129 DE-------ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI--- 178
           +E       I   A    + + G  SG+D   S  G  + ++   YS  K   + PI   
Sbjct: 291 EEAEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYS--KPPSVTPILDF 348

Query: 179 ---HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM--GKLSQISCQALRNKNL 233
               L+ +G   PT  V       E     I+++ +     +  G+  + S     N+++
Sbjct: 349 PELPLLLAGSAKPTPAV------AESTLAAIDQVTESANNFIQSGRFDKDS-----NEDI 397

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
               +      GLL +LGVS  +L E + +L +   I  +K++G+G G C I L + + N
Sbjct: 398 DHFGELFRINHGLLVSLGVSHPRL-ERIRELVDHAGIGWTKLTGAGGGGCAIVLLRANTN 456


>gi|296875768|ref|ZP_06899831.1| mevalonate kinase [Streptococcus parasanguinis ATCC 15912]
 gi|296433233|gb|EFH19017.1| mevalonate kinase [Streptococcus parasanguinis ATCC 15912]
          Length = 294

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 129/288 (44%), Gaps = 40/288 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY-CGSLDLAMFH 70
           A   ++L+GEH V++G+ A+   ++   ++       ++I  DS    +   +L +A+F 
Sbjct: 12  AHSKIILIGEHAVVYGYPAIALPLHHIEVIC------QIIPADSPWVLFEDDTLSMAVF- 64

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
              S   + I   +  C    ++ S +  + G+GSSAA+++A   A+    Y++E   DE
Sbjct: 65  --ASLEHLGIKEARIRC----RIQSMVPEKRGMGSSAAVSIAAIRAVF--DYYQEELDDE 116

Query: 131 ILTTAHAIVLKVQGIS----SGIDLAASIHGGLICY--QMPKYSIE---KIDFIFPIHLI 181
            L     +V + + I+    SG+D    +    I +   +  Y +E   K   +     I
Sbjct: 117 TLEI---LVNRAETIAHMNPSGLDAKTCLSDQAIKFIRNVGFYPLELGIKASLVIADTGI 173

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           +   +    +V  K   +   + EI ++ Q++            +AL+  +L  L QA+ 
Sbjct: 174 HGNTREAIQKVEAKGQEVLSHFHEIGQLTQQVE-----------EALKMNDLTSLGQALT 222

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
                L  +GVS  +   +V    E    + +K+SG GLG CVIAL K
Sbjct: 223 TCHDHLRAVGVSCVEADHLVAVALENG-ALGAKMSGGGLGGCVIALVK 269


>gi|290579679|ref|YP_003484071.1| putative mevalonate kinase [Streptococcus mutans NN2025]
 gi|254996578|dbj|BAH87179.1| putative mevalonate kinase [Streptococcus mutans NN2025]
          Length = 332

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 131/295 (44%), Gaps = 30/295 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           A G ++LMGEH V++G  A+    +  V     +++D       +L   C   D      
Sbjct: 23  ASGKIILMGEHAVVYGQPAIAIPFSA-VETVAEVKED-----GEALTVTCEFYDGLVHKM 76

Query: 66  ---LAMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
              L     +  F +  I   + P+   D+   S + ++ G+GSSAA+ VAI  +L    
Sbjct: 77  PEILESLKHAIRFSLYRIGAPQDPAIHIDIH--STIPAERGMGSSAAVAVAIARSLFNF- 133

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI 181
           Y K  +  E+     +      G  SGID   +  G    + +    IE++      +LI
Sbjct: 134 YGKVLTDKELWEIVQSSEKIAHGNPSGID-TVTTSGKSPVFFVKDQPIEQLSINMDAYLI 192

Query: 182 YSGYKTPTAQVLKKI-------SYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
            +     T Q LK I       S +  +   +++  Q I  L G+L++++ +AL N  + 
Sbjct: 193 VAD-TGQTGQTLKAIQSVKALLSKVTYQIDSLSDPKQAIKEL-GQLTKLAKEALLNNYIL 250

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            L + MN+   LL +L VS+  L  +    R Q   + +K++G G G C+IAL K
Sbjct: 251 ELGEVMNQAHQLLASLTVSNQTLDRLAQAAR-QAGALGAKLTGGGRGGCLIALAK 304


>gi|109098672|ref|XP_001105689.1| PREDICTED: mevalonate kinase isoform 1 [Macaca mulatta]
          Length = 344

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 136/321 (42%), Gaps = 30/321 (9%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + VSAPG ++L GEH V+HG  AL  A+N R  L L    +  +++         + D+A
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLQPHSNGKVDLSLPNIGIKWAWDVA 65

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY----- 122
                 +  +   +   P+     +++ +L    GL    A+T ++  A+L   Y     
Sbjct: 66  RLQLLDTSFLEQGDATTPTP----ELVEKLKEVAGLPDDCAVTESL--AVLAFLYLYLSI 119

Query: 123 -HKEPSPDEILTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             K+    E L   +    +    + G  SG+D A S  GG + YQ  K S  K      
Sbjct: 120 CRKQRWTKEDLELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGKISSLKRPPALQ 179

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALR 229
           I L  +     T  ++  +    +++PE        I+ I+ +   ++G++     +A  
Sbjct: 180 ILLTNTKVPRNTRTLVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPA 235

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            +   VL + ++  Q  L  LGV  + L ++    R   H + SK++G+G G C I L K
Sbjct: 236 PEQYLVLEELIDMNQHHLNALGVGHASLDQLCQVTRA--HGLHSKLTGAGGGGCGITLLK 293

Query: 290 GDLNSLPYQSVNCHMHAKGID 310
             L     ++    + + G D
Sbjct: 294 PGLEQPEVEATKQALTSCGFD 314


>gi|313123655|ref|YP_004033914.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312280218|gb|ADQ60937.1| Mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
          Length = 303

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 130/295 (44%), Gaps = 37/295 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAM 68
           +A G ++L+GEH V++G+ AL   I             + ++I +++  Y G   +D  +
Sbjct: 6   TAHGKVILIGEHSVVYGYDALAMPI-------------QALHIKTTVSDYAGPVWMDTKL 52

Query: 69  FHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           +   F       N +K            +    L    ++  + GLGSSA +    T AL
Sbjct: 53  YQGPFFDAPADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVAL 112

Query: 118 LTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
              QY   + S  E++   +       G +SG+D AA+++   + +   +  ++K+    
Sbjct: 113 --SQYLGLKLSASEVMDITNQAETINHGKASGLD-AATVNSDYLVFFNKQKGVKKLSSKL 169

Query: 177 PIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
              L+   +G    T + +  ++ +  E P+     +K    +G+L+     A   ++ +
Sbjct: 170 GASLLIMDTGDLGNTREAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQDPE 225

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            + +  N  Q LL +  +S SK+  I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 226 TVGKFFNEAQELLASFNLSTSKIDRIC-QIADKGGALGCKLSGGGLGGIVIALCK 279


>gi|57753872|dbj|BAD86802.1| phosphomevalonate kinase [Streptomyces sp. KO-3988]
          Length = 375

 Score = 52.8 bits (125), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 92/219 (42%), Gaps = 46/219 (21%)

Query: 6   HKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSL------- 57
             +  SAPG L + GE+ V+  G  A++ A+++ + +  TL     I I S L       
Sbjct: 5   RTVVRSAPGKLFVAGEYAVVEPGTPAVLVAVDREITVMATLSDAADIVISSDLVPRAVTW 64

Query: 58  ----------GQYCGSLDLAMFHPSFSFIIMAINHIK--------PSCGFDLKVISQL-- 97
                     G   G  D      + + ++ A+  ++        P  G ++ + S+L  
Sbjct: 65  RWRDGRLHAPGTKNGDADGDGARGALAHVVSAVETVRRLLVERGLPLPGLEISISSRLHD 124

Query: 98  -DSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAI-VLKVQGIS---SGIDLA 152
              + GLGSS A+TVA   AL +L        D  L   + + V+   GI    SG DLA
Sbjct: 125 NGRKYGLGSSGAVTVATIDALTSLC-----GLDLSLDARYRLAVISSAGIDPKGSGGDLA 179

Query: 153 ASIHGGLICYQMPKYSIEKIDFIFPI---HLIYSGYKTP 188
           AS  GG I YQ P  +     F+  +   H I    +TP
Sbjct: 180 ASTWGGWIAYQAPDRA-----FVLDLTRRHGIEEALRTP 213


>gi|325125704|gb|ADY85034.1| Mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 303

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 130/295 (44%), Gaps = 37/295 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAM 68
           +A G ++L+GEH V++G+ AL   I             + ++I +++  Y G   +D  +
Sbjct: 6   TAHGKVILIGEHSVVYGYDALAIPI-------------QTLHIKTTVSDYAGPVWMDTKL 52

Query: 69  FHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           +   F       N +K            +    L    ++  + GLGSSA +    T AL
Sbjct: 53  YQGPFFDAPADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVAL 112

Query: 118 LTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
              QY   + S  E++   +       G +SG+D AA+++   + +   +  ++K+    
Sbjct: 113 --SQYLGLKLSASEVMNITNQAETINHGKASGLD-AATVNSDYLVFFNKQRGVKKLSSKL 169

Query: 177 PIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
              L+   +G    T + +  ++ +  E P+     +K    +G+L+     A   ++ +
Sbjct: 170 GASLLIMDTGDLGNTREAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQDPE 225

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            + +  N  Q LL +  +S SK+  I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 226 SVGKFFNEAQELLASFNLSTSKIDRIC-QIADKGGALGCKLSGGGLGGIVIALCK 279


>gi|309809858|ref|ZP_07703708.1| mevalonate kinase [Lactobacillus iners SPIN 2503V10-D]
 gi|308169810|gb|EFO71853.1| mevalonate kinase [Lactobacillus iners SPIN 2503V10-D]
          Length = 306

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 124/299 (41%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I+              +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPIHA-------------LNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + + +EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TAKALNEYFALKMTAEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  Q      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQHILANFGLSTTRINNLC-NIANQNGAYGCKLSGGGLGGIVIAL 280


>gi|300812441|ref|ZP_07092871.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|300496608|gb|EFK31700.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
          Length = 303

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 131/295 (44%), Gaps = 37/295 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAM 68
           +A G ++L+GEH V++G+ AL   I             + ++I +++  Y G   +D  +
Sbjct: 6   TAHGKVILIGEHSVVYGYDALAMPI-------------QALHIKTTVSDYAGQVWMDTKL 52

Query: 69  FHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           +   F       N +K            +    L    ++  + GLGSSA +    T AL
Sbjct: 53  YQGPFFDAPADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVAL 112

Query: 118 LTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
              QY   + S  E++   +       G +SG+D AA+++   + +   +  ++K+    
Sbjct: 113 --SQYLGLKLSASEVMDITNQAETINHGKASGLD-AATVNSDYLVFFNKQKGVKKLSSKL 169

Query: 177 PIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
              L+   +G    T + +  ++ +  E P+     +K    +G+L+     A   ++ +
Sbjct: 170 GASLLIMDTGDLGNTREAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQDPE 225

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            + +  N  Q LL +  +S SK++ I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 226 SVGKFFNEAQELLASFNLSTSKINRIC-QIADKGGALGCKLSGGGLGGIVIALCK 279


>gi|297692910|ref|XP_002823773.1| PREDICTED: mevalonate kinase-like [Pongo abelii]
          Length = 396

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 130/320 (40%), Gaps = 78/320 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---------------- 53
           VSAPG ++L GEH V+HG  AL  A+N R  L L    +  +++                
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLEPHSNGKVDLSLPNIGIKRAWDVAGL 67

Query: 54  ---DSS-----------------LGQYCGSLD-------LAMFHPSFSFIIMAINHIK-- 84
              D+S                 L    G  D       LA+   +F ++ ++I   +  
Sbjct: 68  QSLDTSFLEQGDVTTPTPEQVEKLKDVAGLPDDCAVTERLAVL--AFLYLYLSICQKQRA 125

Query: 85  -PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------DEIL 132
            PS   D+ V S+L    GLGSSAA +V + AALLT+   + P+P            E L
Sbjct: 126 LPS--LDIIVWSELPPGAGLGSSAAYSVCLAAALLTV-CEEIPNPLKDGDCVNRWTREDL 182

Query: 133 TTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
              +    +    + G  SG+D A S  GG + Y   K S  K      I L  +     
Sbjct: 183 ELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRN 242

Query: 189 TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           T  ++  +    +++PE        I+ I+ +   ++G++     +A   +   VL + +
Sbjct: 243 TRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPAPEQYLVLEELI 298

Query: 241 NRQQGLLETLGVSDSKLSEI 260
           +  Q  L  LGV  + L ++
Sbjct: 299 DMNQHHLNALGVGHASLDQL 318


>gi|242018458|ref|XP_002429692.1| Mevalonate kinase, putative [Pediculus humanus corporis]
 gi|212514695|gb|EEB16954.1| Mevalonate kinase, putative [Pediculus humanus corporis]
          Length = 396

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 131/323 (40%), Gaps = 68/323 (21%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI------------- 53
           K  +SAPG ++L GE+ V+    AL  A+  R  L+       ++++             
Sbjct: 10  KFNLSAPGKIILFGEYSVVFNKPALAGALCLRTRLHFEENSSGIVHVKFSALNLEKEFDL 69

Query: 54  ------------DSSLGQYCGSLD-------LAMFHPSFSFIIMAINHIKPSC-----GF 89
                       + + G+Y   L+       L     S +  ++A  H   +C     GF
Sbjct: 70  TDVKNYFTGTHQNENWGEYLARLNNGIRNLCLKTLSESQNNCLLAFFHCFQNCMNFSRGF 129

Query: 90  DLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP-----------------DEIL 132
            +++ S+L    G+GSSA+ +V ++AA L  Q+H + S                  DE  
Sbjct: 130 KIEINSELPVGCGVGSSASFSVVLSAAFLLYQHHLKGSQNVSELVRRNNNGICDFVDEFK 189

Query: 133 TTAHAIVLKVQ----GISSGIDLAASIHGGLICYQMPKYSIEKIDFI-----FPIHLIYS 183
            T   +    +    G  SG+D    +HG L+ +        +++ I       I L+ +
Sbjct: 190 NTVSEMSYSCEKIFHGSPSGVDNTTILHGALLKFIKSNEGHNQMEMINTKSTIRILLVNT 249

Query: 184 GYKTPTAQVLKKISYIEIEYPEINE-INQKIYAL-MGKLSQISCQALRNKNLKVLA---Q 238
                T  +++ +  ++  +PEI E + + + A+ +  +S + C+     +   ++   +
Sbjct: 250 NVPRSTKTLVENVRKLKNRHPEIIENVLKGMEAIALNAVSILKCENTSKCSENFISHFGE 309

Query: 239 AMNRQQGLLETLGVSDSKLSEIV 261
            ++    LL  LGVS   L EI+
Sbjct: 310 LISLNHNLLRVLGVSHPALEEII 332


>gi|220932898|ref|YP_002509806.1| galactokinase [Halothermothrix orenii H 168]
 gi|219994208|gb|ACL70811.1| galactokinase [Halothermothrix orenii H 168]
          Length = 404

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 130/335 (38%), Gaps = 57/335 (17%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI-----DSSLGQ 59
           L K   SAPG + L+GEH   +    L  AI K V +   LR DR I +     D+ L  
Sbjct: 20  LKKGSYSAPGRVNLIGEHTDYNDGFVLPMAIEKNVTMLGQLRHDRKIKVYSLDYDTELCF 79

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITA 115
               L+    H   ++++   + I+       G +L     +    GL SSAA+ V +TA
Sbjct: 80  NLDKLEKDEEHTWVNYVMGVADEIEKKGHKLKGMNLVFTGNVPQGSGLSSSAALEV-VTA 138

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI------DLAASIHG----------GL 159
             +      +  P E+     A      G++ GI       L    H            L
Sbjct: 139 MTMADLNELDIDPVEMALLCQAAENNFVGVACGIMDQYISRLGHRDHALLIDCRTNEYEL 198

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE---------IEYPEINEIN 210
           I ++  +Y I   +      L+ S Y T  ++  + +++           +   ++NE+ 
Sbjct: 199 IPFKDKRYRIVICNSKARRGLVDSEYNTRRSECNQAVAFFNEKLGRNITALRDVKLNEVG 258

Query: 211 QKIYALMGKLSQ-----------------ISCQALRNKNLKVLAQAM-NRQQGLLETLGV 252
           Q      G+LS                   S +AL+N + +   Q M    Q L +   V
Sbjct: 259 Q----YRGELSDSVYRRAHHVVSENERVLASVEALKNNDFEKFGQLMIESHQSLRDDYEV 314

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           S  +L  +V    +Q  ++ ++++G+G G C + L
Sbjct: 315 SCRELDCLVDVALKQEGVLGARMTGAGFGGCTVNL 349


>gi|315653556|ref|ZP_07906476.1| mevalonate kinase [Lactobacillus iners ATCC 55195]
 gi|315488918|gb|EFU78560.1| mevalonate kinase [Lactobacillus iners ATCC 55195]
          Length = 306

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 122/299 (40%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I               +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPI-------------HALNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + +  EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TAKALNEYFALKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  Q      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQDILANFGLSTTRINNLC-NIANQNGAYGCKLSGGGLGGIVIAL 280


>gi|330685883|gb|EGG97512.1| mevalonate kinase [Staphylococcus epidermidis VCU121]
          Length = 306

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 109/254 (42%), Gaps = 12/254 (4%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAIN--KRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
            + G ++L+GEH V  G  A+    N  K  +L  +L K     I+S +  Y G L  A 
Sbjct: 8   ESTGKIILIGEHAVTFGQPAIAIPFNSGKIKVLIESLEKGNYSAIESDV--YDGLLYDAP 65

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
            H   S +   I +        +K+ + L    GLGSSAAI VA T A       K  S 
Sbjct: 66  EHLK-SMVTRFIENTGVEEPLLVKIQTNLPPSRGLGSSAAIAVAFTRASYDF-LGKSLSD 123

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLIYSGYKT 187
            E++  A+       G  SGID    +    + +Q     +++ +     + +I +G K 
Sbjct: 124 AELIEEANWAEKIAHGKPSGIDTQTIVSSKPVWFQKGHAETLKTLQLNGYMVVIDTGVKG 183

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T Q ++ +  +  E PE      K    +G L   + QA+ + +   +A+  N  Q  L
Sbjct: 184 STKQAVEDVHQL-CESPEY----MKHIEHIGNLVYQASQAIEHHDFNQIARIFNECQQDL 238

Query: 248 ETLGVSDSKLSEIV 261
             L VS  K+ E++
Sbjct: 239 RNLTVSHDKIEELL 252


>gi|183983205|ref|YP_001851496.1| phosphomevalonate kinase [Mycobacterium marinum M]
 gi|183176531|gb|ACC41641.1| phosphomevalonate kinase [Mycobacterium marinum M]
          Length = 370

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 95/196 (48%), Gaps = 29/196 (14%)

Query: 12  APGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRL-----INIDSSLGQYCGSLD 65
           APG LV++GE  V+  G  ALV A+++    Y+T++   L     + + S L    G++D
Sbjct: 7   APGKLVILGEFAVVEPGCGALVAAMDR----YVTVQAADLGIGGGVAVSSEL--IAGTVD 60

Query: 66  LAMFHPSF--------SFIIMAINHIK-PSCGFDLKVISQLDSQ---LGLGSSAAITVAI 113
           L     +         S + +A   +  P  G  L + SQL  +   LGLGSS A+TVA+
Sbjct: 61  LDSDRSAAARQLPHIASAVAIARQWLDCPDRGVGLTITSQLHERGVKLGLGSSGAVTVAV 120

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKI 172
             A+ T  +        +   A     ++    SG+D+AA++ GG + Y+ P +++I ++
Sbjct: 121 IDAV-TAAWGAPVDRTTLFRLALIATARLTTSGSGVDVAAAVFGGWLSYRSPDRHAIVEL 179

Query: 173 ---DFIFPIHLIYSGY 185
              D    +H  + G+
Sbjct: 180 AAADLHSAVHADWPGH 195


>gi|269839036|ref|YP_003323728.1| mevalonate kinase [Thermobaculum terrenum ATCC BAA-798]
 gi|269790766|gb|ACZ42906.1| mevalonate kinase [Thermobaculum terrenum ATCC BAA-798]
          Length = 356

 Score = 52.4 bits (124), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 129/325 (39%), Gaps = 37/325 (11%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL---------RKDRLINIDSSLGQYC 61
           SAPG ++L GEH +    A +  A+++R    +TL         R +        LG++ 
Sbjct: 6   SAPGKIILFGEHAINRQQAGISAAVDRRAYALVTLAGSDVELVFRAEGQRLTWEGLGEFR 65

Query: 62  GSLDLAMFHPS------------FSFIIMAINHIKPSCGFDLKVISQLDSQL---GLGSS 106
             +D    H              F+     ++ ++   G+D     +  S L       S
Sbjct: 66  ARVDALRTHHDLYGIRDLVRGDFFAPAKYVLSLLRDRLGYDGGCRVEWRSALPMGSGMGS 125

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTA-HAIVLKVQGISSGIDLAASIHGG--LICYQ 163
            A   A           ++  P E+   A    +L   G++S +D +A   GG  L+   
Sbjct: 126 GAAASAAMIGAFATALGRDLPPVEVAHLAWQGDILAHGGVASALDSSACTLGGCVLVSTS 185

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
            P  ++  +    PI +  +G +  T +V  ++       P +  + ++I    G L + 
Sbjct: 186 WPPRTLSGV-LELPIVVGDTGVRASTGEVNTRVREALQSRPHLGMLFEEI----GLLVER 240

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
           +  AL   +L+V+ + M+    LL  LGVS  +L  +V +         +K+SGSG G  
Sbjct: 241 AVPALERGDLQVVGRLMHMNHLLLRELGVSCPELERLV-EAALSAGAWGAKLSGSGGGGI 299

Query: 284 VIALGKGDLNSLPYQSVNCHMHAKG 308
           ++AL  GD        V C +   G
Sbjct: 300 MVALAPGDR----VAEVACALEGAG 320


>gi|115481534|ref|NP_001064360.1| Os10g0329300 [Oryza sativa Japonica Group]
 gi|78708201|gb|ABB47176.1| Mevalonate kinase, putative, expressed [Oryza sativa Japonica
           Group]
 gi|113638969|dbj|BAF26274.1| Os10g0329300 [Oryza sativa Japonica Group]
 gi|215697957|dbj|BAG92127.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215701434|dbj|BAG92858.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765768|dbj|BAG87465.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 401

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 148/361 (40%), Gaps = 90/361 (24%)

Query: 7   KICVS-APGSLVLMGEHGVLHGHAALVFAIN----------------KRVILYLTLRK-- 47
           ++C + APG ++L GEH V+HG AA+  AI+                    L L L+   
Sbjct: 2   EVCAARAPGKIILAGEHAVVHGSAAVAAAIDLYTRCSLCLMPLADDEAAATLELDLKDPG 61

Query: 48  ------------------------------DRLINIDSSLGQYC---GSLDLAMFHPSFS 74
                                         DRL +I   L ++      + L+    +F 
Sbjct: 62  LTFSWPCGRLREVLLTDEAAGAREARPCSPDRLASIARLLEEHEIPEAKIWLSAGLSAFL 121

Query: 75  FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT--------------- 119
           F+  +I   +P     + V S L    GLGSSAA  V+++  LLT               
Sbjct: 122 FLYTSILGCRPG---KVTVSSDLPMGSGLGSSAAFCVSMSGVLLTAAGVVTAVGGISGEG 178

Query: 120 LQYHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           + +      D  L    A   +  + G  SGID A S  G +I ++  K  +  +    P
Sbjct: 179 MGWELVGKDDLELVNRWAFQGEKIIHGKPSGIDNAVSTFGSMIKFK--KGELTNLKSSNP 236

Query: 178 IHLIYS------GYKTPTAQVLKKISY----IEIEYPEINEINQKIYALMGKLSQISCQA 227
           + ++ +        K   A V ++ S     +   +  +N I++++ +++ +L+     A
Sbjct: 237 VKMLITDTRVGRNTKALVAGVSERASRHSDAMASVFNAVNSISEEVSSIV-ELAANDEIA 295

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHI-MASKISGSGLGDCVIA 286
           + +K  K LA+ M   QGLL+ +GVS S +  +   LR      + SK++G+G G CV+ 
Sbjct: 296 ITSKEEK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKFNLVSKLTGAGGGGCVLT 351

Query: 287 L 287
           L
Sbjct: 352 L 352


>gi|325686247|gb|EGD28290.1| mevalonate kinase [Lactobacillus delbrueckii subsp. lactis DSM
           20072]
          Length = 303

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 129/295 (43%), Gaps = 37/295 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAM 68
           +A G ++L+GEH V++G+ AL   I             + ++I +++  Y G   +D  +
Sbjct: 6   TAHGKVILIGEHSVVYGYDALAMPI-------------QALHIKTTVSDYAGPVWMDTKL 52

Query: 69  FHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           +   F       N +K            +    L    ++  + GLGSSA +    T AL
Sbjct: 53  YQGPFFDAPADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVAL 112

Query: 118 LTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
              QY   + S  E++   +       G +SG+D AA+++   + +   +  ++K+    
Sbjct: 113 --SQYLGLKLSASEVMDITNQAETINHGKASGLD-AATVNSDYLVFFNKQKGVKKLSSKL 169

Query: 177 PIHLIY--SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
              L+   +G    T + +  ++ +  E P+     +K    +G+L+     A   +  +
Sbjct: 170 GASLLIMDTGDLGNTREAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQEPE 225

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            + +  N  Q LL +  +S SK+  I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 226 TVGKFFNEAQELLASFNLSTSKIDRIC-QIADKGGALGCKLSGGGLGGIVIALCK 279


>gi|332638891|ref|ZP_08417754.1| phosphomevalonate kinase [Weissella cibaria KACC 11862]
          Length = 352

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 81/174 (46%), Gaps = 19/174 (10%)

Query: 8   ICVSAPGSLVLMGEHGV-LHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY----CG 62
           +   APG L L GE+ V L G  +++ A+++ V + L  R D LI++ S+L  +      
Sbjct: 2   VMAKAPGKLYLAGEYAVTLPGQPSIIMAVDRFVTVNLDPRTDALISMTSNLLGHRELSSS 61

Query: 63  SLDLAMFHPSFSFIIM--------AINHIKPSCGFDLKVISQLD---SQLGLGSSAAITV 111
            L        +  ++         AI + +P  G  + + SQL     +LGLGSSAA+ +
Sbjct: 62  ELLTVALDDDWRLVLRTLQLIQTYAIENGQPFTGLTVSIDSQLTMAGQKLGLGSSAAVVM 121

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI--DLAASIHGGLICYQ 163
           A+  A + L      S  +    A A  L      +G   DLAA+  GG+I YQ
Sbjct: 122 ALIKAYVALSELPMSSIQQYKLGALA-TLTTPNFKAGSMGDLAAATFGGIIRYQ 174


>gi|320531912|ref|ZP_08032822.1| mevalonate kinase [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320135881|gb|EFW27919.1| mevalonate kinase [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 320

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 122/284 (42%), Gaps = 23/284 (8%)

Query: 17  VLMGEHGVLHGHAALVFAINK---RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           +L+GEH V++GH A+   +     R     T     L ++D     Y G LD A     F
Sbjct: 19  ILLGEHSVVYGHPAVAVPLQDLRMRATASPTSGPSTLSSLD-----YSGPLDQAGSR--F 71

Query: 74  SFIIMAINHIKPSCG-----FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +  A    +   G     FD+  +S    + GLGSSAA   AI  A+L     +E + 
Sbjct: 72  ASVARAFEVAREFSGGLGQAFDITTVSDFPHERGLGSSAAAAGAIIRAVLDA-CGREANS 130

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS--IEKIDFIFPIHLIYSGYK 186
           DE+            G  SG+D AA+     I +Q  +     ++ID  F + +  SG  
Sbjct: 131 DELFALTQMAEQIAHGKPSGLDAAATCSPCPIRFQGGQMRPLSQRIDNAFLV-IADSGVH 189

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T + +  +       PE   I  +I  L G L+QI+   L   +   L  AMN    L
Sbjct: 190 GSTREAVSGLRQRYENDPE--NIGPRINHL-GTLTQIAIMTLDQADAPALGAAMNEAHTL 246

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
           L  L +S   L ++      +   + +K++G GLG CVIAL  G
Sbjct: 247 LTKLSLSLPILDDLA-DAARRAGALGAKLTGGGLGGCVIALVAG 289


>gi|325912586|ref|ZP_08174969.1| mevalonate kinase [Lactobacillus iners UPII 60-B]
 gi|329920275|ref|ZP_08277059.1| mevalonate kinase [Lactobacillus iners SPIN 1401G]
 gi|325478007|gb|EGC81136.1| mevalonate kinase [Lactobacillus iners UPII 60-B]
 gi|328936320|gb|EGG32768.1| mevalonate kinase [Lactobacillus iners SPIN 1401G]
          Length = 306

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 124/298 (41%), Gaps = 37/298 (12%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I               +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPI-------------HALNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + + +EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TAKALNEYFALKMTAEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
           EK+     I  + +G    T + +  + Y +IE+   + + ++    +G L+  +     
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKY-QIEH---DIVKKEAIDKLGYLADQTKDYWF 223

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            K+  ++    N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 224 KKDAPMVGTIFNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|307718948|ref|YP_003874480.1| hypothetical protein STHERM_c12660 [Spirochaeta thermophila DSM
           6192]
 gi|306532673|gb|ADN02207.1| hypothetical protein STHERM_c12660 [Spirochaeta thermophila DSM
           6192]
          Length = 381

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 21/132 (15%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
            L +I VSAPG + L+GEH   H   A+ FA + RV + ++ RK      DSSL  Y  S
Sbjct: 14  VLPEIAVSAPGVVSLLGEHTEEHEGRAIQFAASHRVDVAISRRK------DSSLRFYSAS 67

Query: 64  L----DLAMFHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAA 108
           L      ++ +  +       N++K           P  G ++ + S +  Q+GL SS+A
Sbjct: 68  LRERKKTSIPNLKYRKEDRWANYLKGFYAQLLDWGAPPHGLEVTIYSTVKPQIGLASSSA 127

Query: 109 ITVAITAALLTL 120
           + +A   AL TL
Sbjct: 128 MELAFAVALATL 139


>gi|296411929|ref|XP_002835681.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629469|emb|CAZ79838.1| unnamed protein product [Tuber melanosporum]
          Length = 442

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/380 (22%), Positives = 156/380 (41%), Gaps = 90/380 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYL-----TLRKDRLINIDSSLGQYCG-- 62
           VSAPG +++ GEH V++G AA+  A++ R  L +     T R   L   D SL       
Sbjct: 2   VSAPGKVIVYGEHAVVYGKAAIAAALSLRSYLLVTPLPKTSRTLSLNFSDISLNHSWDID 61

Query: 63  SLDLAMFHPS-----------------------------------------FSFIIMAIN 81
           SL  A+F                                            + ++++   
Sbjct: 62  SLPWAIFSKPGKKRYYFDTVERLDKELLETVKPLVAAIPGKVQQGAASAFLYLYLMLGSK 121

Query: 82  HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE-ILTTAHAIVL 140
           H  P+  + L+  S +    GLGSSA+I+V ++ A L LQ     +P E +L+    + L
Sbjct: 122 H-APASIYTLR--SAIPIGAGLGSSASISVCLSTA-LQLQMGTLATPFEGMLSNETQLQL 177

Query: 141 K------------VQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-FPIHLIY 182
           K            + G  SG+D   +  G  + ++   YS+        +F   P+ L+ 
Sbjct: 178 KRINNWSFVGEMCIHGNPSGVDNTVATGGRAVLFKRTDYSLPPEVTHLRNFPELPLLLVD 237

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA------------LRN 230
           +     TA+ L  +  +   +PEI +      +++  + +I+ +A              +
Sbjct: 238 TKQPRRTAEQLANVRNMLNAHPEITQ------SMLDTIDRITAEAHDVISDPDFTSFSGS 291

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKG 290
            +L  L + +    GLL +LGVS  KL  I  +L +   I  +K++G+G G C I L K 
Sbjct: 292 PSLSRLGELIRINHGLLVSLGVSHPKLERIR-ELIDHTGIGWTKLTGAGGGGCSITLLKP 350

Query: 291 DLNSLPYQSVNCHMHAKGID 310
            + +   + ++  +  +G +
Sbjct: 351 KVKANILEELDSKLRTEGFE 370


>gi|190408434|gb|EDV11699.1| mevalonate kinase [Saccharomyces cerevisiae RM11-1a]
          Length = 443

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-------Q 121
           +H +F F+ M +     +      + S L    GLGSSA+I+V++  A+  L        
Sbjct: 112 YHAAFCFLYMFVCLCPHAKNIKFSLKSTLPIGAGLGSSASISVSLALAMAYLGGLIGSND 171

Query: 122 YHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIF- 176
             K    D+ +    A + +  + G  SGID A + +G  + ++   +  +I   +F F 
Sbjct: 172 LEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFL 231

Query: 177 ------PIHLIYSGYKTPTAQVLKKISYIEIE-YPEI--------NEINQKIYALMGKLS 221
                 P+ L Y+     T  ++ ++  +  E +PE+         E   +   +M KLS
Sbjct: 232 DDFPAIPMILTYTRISRSTKDLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMTKLS 291

Query: 222 Q---ISCQALRNKN--LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
           +      +A+   N   + L + +    GLL ++GVS   L E++  L +   I ++K++
Sbjct: 292 KCKGTDDEAVETNNELYEQLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGSTKLT 350

Query: 277 GSGLGDCVIALGKGDL 292
           G+G G C + L + D+
Sbjct: 351 GAGGGGCSLTLLRRDI 366


>gi|315186434|gb|EFU20194.1| Galactokinase [Spirochaeta thermophila DSM 6578]
          Length = 381

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 21/132 (15%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
            L +I VSAPG + L+GEH   H   A+ FA + RV + ++ RK      DSSL  Y  S
Sbjct: 14  VLPEIAVSAPGVVSLLGEHTEEHEGRAIQFAASHRVDVAISRRK------DSSLRFYSAS 67

Query: 64  L----DLAMFHPSFSFIIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAA 108
           L      ++ +  +       N++K           P  G ++ + S +  Q+GL SS+A
Sbjct: 68  LRERKKTSIPNLKYRKEDRWANYLKGFYAQLLDWGAPPHGLEVTIYSTVKPQIGLASSSA 127

Query: 109 ITVAITAALLTL 120
           + +A   AL TL
Sbjct: 128 MELAFAVALATL 139


>gi|207342169|gb|EDZ70019.1| YMR208Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 384

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 119/259 (45%), Gaps = 39/259 (15%)

Query: 69  FHPSFSFIIMAI---NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL----- 120
           +H +F F+ M +    H K +  F LK  S L    GLGSSA+I+V++  A+  L     
Sbjct: 112 YHAAFCFLYMFVCLCPHAK-NIKFSLK--STLPIGAGLGSSASISVSLALAMAYLGGLIG 168

Query: 121 --QYHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDF 174
                K    D+ +    A + +  + G  SGID A + +G  + ++   +  +I   +F
Sbjct: 169 SNDLEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNF 228

Query: 175 IF-------PIHLIYSGYKTPTAQVLKKISYIEIE-YPEI--------NEINQKIYALMG 218
            F       P+ L Y+     T  ++ ++  +  E +PE+         E   +   +M 
Sbjct: 229 KFLDDFPAIPMILTYTRIPRSTKDLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMT 288

Query: 219 KLSQ---ISCQALRNKN--LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMAS 273
           KLS+      +A+   N   + L + +    GLL ++GVS   L E++  L +   I ++
Sbjct: 289 KLSKCKGTDDEAVETNNELYEQLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGST 347

Query: 274 KISGSGLGDCVIALGKGDL 292
           K++G+G G C + L + D+
Sbjct: 348 KLTGAGGGGCSLTLLRRDI 366


>gi|307204866|gb|EFN83424.1| Mevalonate kinase [Harpegnathos saltator]
          Length = 387

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 153/379 (40%), Gaps = 77/379 (20%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR-----------LINI 53
           +H+  VSAPG ++L GEH V++   A+  ++++R+ L      D            L NI
Sbjct: 3   IHQFKVSAPGKVILFGEHAVVYNKLAVAASLDQRMTLEFAELPDEVAESRQMVEISLPNI 62

Query: 54  D-------------SSLGQYCGSLD-------LAMFHPS---------------FSFIIM 78
           D              SL QY    D       +  F P+               F F ++
Sbjct: 63  DLYLSVHIKKIKDFISLDQYHEPYDYDNLYRLVREFVPTIINRATTEQIQSLEAFFFTMV 122

Query: 79  AINH----IKPSCGFDLKVISQLDSQLGLGSSAAITVA-ITAALLTLQYHKEPSPDEILT 133
            +N     +KP   F + + ++     GLGSSA+  V  +T      +  K  +   I  
Sbjct: 123 FVNRNRTVLKP---FRVHLDTEFPIGSGLGSSASFVVCFVTCFYYWWKLRKGEARKFIPY 179

Query: 134 TAHAIVLKVQ-------GISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FPIHLIYSG 184
               I    Q       G  SGID +    G ++ ++   Y +E +       I L+ + 
Sbjct: 180 DLRHIADMSQMCEKVMHGNPSGIDTSVCTFGSIVKFRSNPYIMEPMAKAPKLKILLVDTQ 239

Query: 185 YKTPTAQVLKKISYIEIEYPEINE--------INQKIYALMGKLSQIS--CQALRNKNLK 234
            +  T  +++K+  ++ ++P I E        I+   +  +  + ++S  C+ L     K
Sbjct: 240 VQRSTKTMVQKVKELQAKHPTIYEPFIASIDGISDAAFQALVPIFRLSDNCEILLK--YK 297

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            L + +N  Q +L  L VS   L +I  +   Q H +A+K++G+G G     L   D + 
Sbjct: 298 ELMKLINMNQNILSMLEVSHPALDKICDE--AQKHGLAAKLTGAGGGGHAYVLIPPDTSD 355

Query: 295 LPYQSVNCHMHAKGIDIVP 313
               +++  + A+G  + P
Sbjct: 356 ETISNLSQKLTAEGFKVTP 374


>gi|302349236|ref|YP_003816874.1| Mevalonate kinase [Acidilobus saccharovorans 345-15]
 gi|302329648|gb|ADL19843.1| Mevalonate kinase [Acidilobus saccharovorans 345-15]
          Length = 304

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 81/163 (49%), Gaps = 8/163 (4%)

Query: 144 GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYS---GYKTPTAQVLKKISYIE 200
           G  SG+D AA I+GG I ++     +  I     + LI +     ++ +A VL  I +++
Sbjct: 126 GNPSGVDPAAVIYGGTIVFRKGAGVVGTISPGLSVPLIVADSGARRSTSAPVLSVIRFLD 185

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEI 260
                I  +   +  L+ ++  ++  A+R  +L+ +   MN   GLL  +GVS  +L E+
Sbjct: 186 ----RIGGLRDSMIGLVEQIIDLASDAIRKGSLEDIGNLMNINHGLLSAIGVSTPELEEL 241

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           V     +   + +K++G+G G  +IA+ + +  +    +++ H
Sbjct: 242 V-HAARRAGALGAKLTGAGWGGSIIAIAQPEKTNDVVSALSAH 283


>gi|51598942|ref|YP_073130.1| phosphomevalonate kinase, putative [Borrelia garinii PBi]
 gi|51573513|gb|AAU07538.1| phosphomevalonate kinase, putative [Borrelia garinii PBi]
          Length = 317

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 83/190 (43%), Gaps = 29/190 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I  S PG+L+LMGE+ +L  +   L  AINKR   + + +K       S   +     D 
Sbjct: 4   ISFSVPGNLLLMGEYTILEENGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID---DF 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITVAIT 114
           ++       +    +++  +C  +L+  +    +D+         + G GSSA + + I 
Sbjct: 59  SLIENRNDLVFKMFSYLSQNCFLNLESFAYDVYIDTSNFFFNDGTKKGFGSSAVVAIGIA 118

Query: 115 AALLTLQYHKEP--SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ---MPKY- 167
             L  + Y+       DEI           QG I SG D+A SI GG+I ++    PKY 
Sbjct: 119 CGLFFI-YNATNVVEKDEIFKYCLEAYRHAQGGIGSGYDIATSIFGGVIEFEGGFTPKYR 177

Query: 168 ---SIEKIDF 174
              S+E  DF
Sbjct: 178 QLGSLEFDDF 187


>gi|325067066|ref|ZP_08125739.1| phosphomevalonate kinase [Actinomyces oris K20]
          Length = 381

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 138/345 (40%), Gaps = 76/345 (22%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            +   APG L + GE+ V+  GH A++ A+++    ++T+R    I   S  G Y G++ 
Sbjct: 9   DVVSRAPGKLYIAGEYAVVEPGHRAVLVAVDR----FITVR----ITPCSPTGGYAGTIS 60

Query: 66  LAMFHPSF-------------------SFIIMAINHIKPSCG--------FDLKVISQLD 98
             ++                        ++I AI  ++            F+L + S+LD
Sbjct: 61  SRLYDTGSRPWRHRPQDGLAEAVGGDDDYVISAIRVVEALVAEGGGRLGSFNLGISSELD 120

Query: 99  S----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAAS 154
                +LGLGSSAA+TVA   A+    Y        +   A      VQ I SG D+AAS
Sbjct: 121 KADGRKLGLGSSAAVTVATVRAVAGF-YGLSLDDSRVYKLAMLASDAVQPIGSGGDIAAS 179

Query: 155 IHGGLICYQMPKY---------------SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYI 199
              G + Y  P                 + + ++  +P  L       P+ ++    +  
Sbjct: 180 AVTGWVDYASPDRVWLRRARQRAQARGGTGDLLESDWP-GLCLRRLPVPSVRLQVGWTGA 238

Query: 200 EIEYPEI-------NEINQKIYALMGKLSQIS----CQALRNKNLKVLAQAMNRQQGLLE 248
               P +       +     +Y+   + SQ +      A+ + +   +  A+ R + LL 
Sbjct: 239 PASTPALVAGVQAGSRGADDVYSSFLRASQDTLASLTTAIEDNDAGQVMSAITRNRVLLV 298

Query: 249 TLG------VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            LG      +   +L+ +V   R+  H  A+K SG+G GDC IAL
Sbjct: 299 QLGRISGRAIETPELTRLVEIARD--HGAAAKSSGAGGGDCGIAL 341


>gi|330718591|ref|ZP_08313191.1| phosphomevalonate kinase [Leuconostoc fallax KCTC 3537]
          Length = 341

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 159/358 (44%), Gaps = 76/358 (21%)

Query: 5   LHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
           ++KI ++ PG L L GE+ +   G+ A+V AIN  + L ++   + +  + S+L +   +
Sbjct: 1   MNKIKITTPGKLFLAGEYAITQPGNLAIVAAINLGLTLTISETHNNVSTMTSNLIESPLT 60

Query: 64  LDL-----AMFHPSFSFIIMAIN--------HIKPSCG-FDLKVISQLD---SQLGLGSS 106
            ++      +    + + + A++        H KP    F++ + S LD    +LGLGSS
Sbjct: 61  FNIDHLPNTVADTKWCYALSAVHIVQDYMYHHQKPLLKEFNININSDLDHSTGKLGLGSS 120

Query: 107 AAITVAITAALLTLQYHK-EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP 165
           AA+ VA+   L   +Y K   S  ++   A    L VQ   S  D+A  ++ G+I Y  P
Sbjct: 121 AAVVVAVVEGL--DRYFKLHLSRIQLFKLAALAHLNVQQSGSLGDIAVGVYHGIIAYSSP 178

Query: 166 K-------YSIEKID----------FIFPIHLIYSGYKTPTAQ------VLKKISYIEIE 202
                   Y+ + +D            +P++  +  Y  PT Q       LK +    + 
Sbjct: 179 DLSKFEQPYTAKIVDSPWSGLHIEPLTWPMN--WQLYLAPTYQAASTKKALKSVQIPAVF 236

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL---GVSDSKLSE 259
           Y +   I  KI             A++++N + L Q +   Q LL        S SKL+ 
Sbjct: 237 YKQNITIVDKI-----------IIAIKSQNYQQLKQYIAYNQALLTEYLPATYSTSKLAT 285

Query: 260 IVWKLREQPHIMASKISGSGLGD--CVIALGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           ++  +++  H +A KISG+G GD   +IAL +     LP         A   D++P+T
Sbjct: 286 VLSYIQQ--HQLAGKISGAGFGDNAYIIALTQ---EPLP---------ATNFDVLPVT 329


>gi|312874239|ref|ZP_07734273.1| mevalonate kinase [Lactobacillus iners LEAF 2052A-d]
 gi|311090309|gb|EFQ48719.1| mevalonate kinase [Lactobacillus iners LEAF 2052A-d]
          Length = 306

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 123/299 (41%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I               +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPI-------------HALNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + + +EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TAKALNEYFALKMTSEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|222612620|gb|EEE50752.1| hypothetical protein OsJ_31091 [Oryza sativa Japonica Group]
          Length = 460

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 148/361 (40%), Gaps = 90/361 (24%)

Query: 7   KICVS-APGSLVLMGEHGVLHGHAALVFAIN----------------KRVILYLTLRK-- 47
           ++C + APG ++L GEH V+HG AA+  AI+                    L L L+   
Sbjct: 2   EVCAARAPGKIILAGEHAVVHGSAAVAAAIDLYTRCSLCLMPLADDEAAATLELDLKDPG 61

Query: 48  ------------------------------DRLINIDSSLGQYC---GSLDLAMFHPSFS 74
                                         DRL +I   L ++      + L+    +F 
Sbjct: 62  LTFSWPCGRLREVLLTDEAAGAREARPCSPDRLASIARLLEEHEIPEAKIWLSAGLSAFL 121

Query: 75  FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT--------------- 119
           F+  +I   +P     + V S L    GLGSSAA  V+++  LLT               
Sbjct: 122 FLYTSILGCRPG---KVTVSSDLPMGSGLGSSAAFCVSMSGVLLTAAGVVTAVGGISGEG 178

Query: 120 LQYHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
           + +      D  L    A   +  + G  SGID A S  G +I ++  K  +  +    P
Sbjct: 179 MGWELVGKDDLELVNRWAFQGEKIIHGKPSGIDNAVSTFGSMIKFK--KGELTNLKSSNP 236

Query: 178 IHLIYS------GYKTPTAQVLKKISY----IEIEYPEINEINQKIYALMGKLSQISCQA 227
           + ++ +        K   A V ++ S     +   +  +N I++++ +++ +L+     A
Sbjct: 237 VKMLITDTRVGRNTKALVAGVSERASRHSDAMASVFNAVNSISEEVSSIV-ELAANDEIA 295

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHI-MASKISGSGLGDCVIA 286
           + +K  K LA+ M   QGLL+ +GVS S +  +   LR      + SK++G+G G CV+ 
Sbjct: 296 ITSKEEK-LAELMEMNQGLLQCMGVSHSSIETV---LRTTLKFNLVSKLTGAGGGGCVLT 351

Query: 287 L 287
           L
Sbjct: 352 L 352


>gi|309804010|ref|ZP_07698092.1| mevalonate kinase [Lactobacillus iners LactinV 11V1-d]
 gi|308163929|gb|EFO66194.1| mevalonate kinase [Lactobacillus iners LactinV 11V1-d]
          Length = 306

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 123/299 (41%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I+              +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPIHA-------------LNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + +  EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TARALNKYFALKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  Q      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQHILANFGLSTTRINNLC-NIANQNGAYGCKLSGGGLGGIVIAL 280


>gi|323336048|gb|EGA77322.1| Erg12p [Saccharomyces cerevisiae Vin13]
          Length = 413

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-------Q 121
           +H +F F+ M +     +      + S L    GLGSSA+I+V++  A+  L        
Sbjct: 112 YHAAFCFLYMFVCLCPHAKNIKFSLKSTLPIGAGLGSSASISVSLALAMAYLGGLIGSND 171

Query: 122 YHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIF- 176
             K    D+ +    A + +  + G  SGID A + +G  + ++   +  +I   +F F 
Sbjct: 172 LEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFL 231

Query: 177 ------PIHLIYSGYKTPTAQVLKKISYIEIE-YPEI--------NEINQKIYALMGKLS 221
                 P+ L Y+     T  ++ ++  +  E +PE+         E   +   +M KLS
Sbjct: 232 DDFPAIPMILTYTRIPRSTKDLVARVRVLVTEKFPEVMKXILDAMGECALQGLEIMTKLS 291

Query: 222 Q---ISCQALRNKN--LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
           +      +A+   N   + L + +    GLL ++GVS   L E++  L +   I ++K++
Sbjct: 292 KCKGTDDEAVETNNELYEQLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGSTKLT 350

Query: 277 GSGLGDCVIALGKGDL 292
           G+G G C + L + D+
Sbjct: 351 GAGGGGCSLTLLRRDI 366


>gi|183983207|ref|YP_001851498.1| mevalonate kinase, Erg12 [Mycobacterium marinum M]
 gi|183176533|gb|ACC41643.1| mevalonate kinase, Erg12 [Mycobacterium marinum M]
          Length = 332

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 127/291 (43%), Gaps = 29/291 (9%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL--DLAM 68
           +A G  +++GEH V+HG AAL   I    IL  T    R  +         GS+  D+A+
Sbjct: 16  TATGKAIVLGEHLVVHGAAALAIPIP---ILVETATAHRGPSPTPVRQPTVGSMGPDMAL 72

Query: 69  FHPSFS--FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
               F+  F + A      + G  ++V   +    GLGSSAA+  A+  AL  L +  EP
Sbjct: 73  LISDFAERFDVPAAV----ASGVVVEVSHVVPCGRGLGSSAAVVRAVVLALADL-FECEP 127

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID------FIFPIHL 180
           S  ++     +      G  SG+D AA+   G I +   + ++  +       F+     
Sbjct: 128 SAAQVYQLVQSRERTAHGTPSGVDAAATGADGPIVFC--RGAVRPVSPAPVGVFVVADSG 185

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA--LRNKNLKVLAQ 238
             S  K   A+V   ++         + + +++ AL      ++C A  L+  NL  L  
Sbjct: 186 EISATKDSVAEVAAILTADRDGLARRDWLVEQLDAL------VACAAIDLQQGNLSALGA 239

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           AM R   LL  L +S  +L  ++ +       M +K++G G G CV+AL +
Sbjct: 240 AMARNHDLLRGLNLSTPRLEGLI-EAANTSGAMGAKLTGGGRGGCVLALAR 289


>gi|259500612|ref|ZP_05743514.1| mevalonate kinase [Lactobacillus iners DSM 13335]
 gi|302191301|ref|ZP_07267555.1| mevalonate kinase [Lactobacillus iners AB-1]
 gi|312875536|ref|ZP_07735537.1| mevalonate kinase [Lactobacillus iners LEAF 2053A-b]
 gi|259167996|gb|EEW52491.1| mevalonate kinase [Lactobacillus iners DSM 13335]
 gi|311088790|gb|EFQ47233.1| mevalonate kinase [Lactobacillus iners LEAF 2053A-b]
          Length = 306

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 123/299 (41%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I+              +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPIHA-------------LNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + +  EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TARALNEYFALKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  Q      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQHILANFGLSTTRINNLC-NIANQNGAYGCKLSGGGLGGIVIAL 280


>gi|151945912|gb|EDN64144.1| mevalonate kinase [Saccharomyces cerevisiae YJM789]
 gi|256271635|gb|EEU06677.1| Erg12p [Saccharomyces cerevisiae JAY291]
 gi|259148794|emb|CAY82039.1| Erg12p [Saccharomyces cerevisiae EC1118]
          Length = 443

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-------Q 121
           +H +F F+ M +     +      + S L    GLGSSA+I+V++  A+  L        
Sbjct: 112 YHAAFCFLYMFVCLCPHAKNIKFSLKSTLPIGAGLGSSASISVSLALAMAYLGGLIGSND 171

Query: 122 YHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIF- 176
             K    D+ +    A + +  + G  SGID A + +G  + ++   +  +I   +F F 
Sbjct: 172 LEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFL 231

Query: 177 ------PIHLIYSGYKTPTAQVLKKISYIEIE-YPEI--------NEINQKIYALMGKLS 221
                 P+ L Y+     T  ++ ++  +  E +PE+         E   +   +M KLS
Sbjct: 232 DDFPAIPMILTYTRIPRSTKDLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMTKLS 291

Query: 222 Q---ISCQALRNKN--LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
           +      +A+   N   + L + +    GLL ++GVS   L E++  L +   I ++K++
Sbjct: 292 KCKGTDDEAVETNNELYEQLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGSTKLT 350

Query: 277 GSGLGDCVIALGKGDL 292
           G+G G C + L + D+
Sbjct: 351 GAGGGGCSLTLLRRDI 366


>gi|6323864|ref|NP_013935.1| Erg12p [Saccharomyces cerevisiae S288c]
 gi|125407|sp|P07277|KIME_YEAST RecName: Full=Mevalonate kinase; Short=MK; Short=MvK; AltName:
           Full=Ergosterol biosynthesis protein 12; AltName:
           Full=Regulation of autonomous replication protein 1
 gi|3684|emb|CAA39359.1| mevalonate kinase [Saccharomyces cerevisiae]
 gi|4287|emb|CAA29487.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|854460|emb|CAA89923.1| Rar1p [Saccharomyces cerevisiae]
 gi|285814212|tpg|DAA10107.1| TPA: Erg12p [Saccharomyces cerevisiae S288c]
          Length = 443

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 115/256 (44%), Gaps = 33/256 (12%)

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL-------Q 121
           +H +F F+ M +     +      + S L    GLGSSA+I+V++  A+  L        
Sbjct: 112 YHAAFCFLYMFVCLCPHAKNIKFSLKSTLPIGAGLGSSASISVSLALAMAYLGGLIGSND 171

Query: 122 YHKEPSPDEILTTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIF- 176
             K    D+ +    A + +  + G  SGID A + +G  + ++   +  +I   +F F 
Sbjct: 172 LEKLSENDKHIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFL 231

Query: 177 ------PIHLIYSGYKTPTAQVLKKISYIEIE-YPEI--------NEINQKIYALMGKLS 221
                 P+ L Y+     T  ++ ++  +  E +PE+         E   +   +M KLS
Sbjct: 232 DDFPAIPMILTYTRIPRSTKDLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMTKLS 291

Query: 222 Q---ISCQALRNKN--LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
           +      +A+   N   + L + +    GLL ++GVS   L E++  L +   I ++K++
Sbjct: 292 KCKGTDDEAVETNNELYEQLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGSTKLT 350

Query: 277 GSGLGDCVIALGKGDL 292
           G+G G C + L + D+
Sbjct: 351 GAGGGGCSLTLLRRDI 366


>gi|194756512|ref|XP_001960521.1| GF11467 [Drosophila ananassae]
 gi|190621819|gb|EDV37343.1| GF11467 [Drosophila ananassae]
          Length = 390

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 95/217 (43%), Gaps = 21/217 (9%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-------KEPSPDEILTTAHAIV 139
            GF ++V S+L+   GLGSSA+   A+  A L L  H       +E +   I T A+   
Sbjct: 137 TGFQVQVDSELNVGAGLGSSASFGAALATAFLILAGHFDSDSYLQEENQALISTWAYESE 196

Query: 140 LKVQGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISY 198
               G  SG+D     +GG++ Y +   +   +I     I L+ S     TA ++ K+ +
Sbjct: 197 RVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLRIQKPLNILLVDSRVSRSTADIVAKVRH 256

Query: 199 IEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
           +   +P++         E+      L          + + + L+ L Q  N    LL+ +
Sbjct: 257 LAEGFPQLIEAIWQACEELVTAAVPLYESFGNAQDDSAKFEKLERLFQINND---LLKAI 313

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 314 GVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 348


>gi|329769191|ref|ZP_08260611.1| hypothetical protein HMPREF0433_00375 [Gemella sanguinis M325]
 gi|328839410|gb|EGF88988.1| hypothetical protein HMPREF0433_00375 [Gemella sanguinis M325]
          Length = 329

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 90/176 (51%), Gaps = 23/176 (13%)

Query: 12  APGSLVLMGEHGVLHGHA-ALVFAINKRVILYL-----TLRKDRLINIDSSLGQYCGSLD 65
           A G L L GE+ +L  ++ AL+ ++ ++++  +     T   D L NI   L  Y  + +
Sbjct: 12  AFGKLYLAGEYAILEDYSKALLTSVPQKIVTTVEPSEKTTIFDTLHNITVDL--YEDNKN 69

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDS---QLGLGSSAAITVAITAALLTLQY 122
             M      FI+    +      + +K+ ++L S   + GLGSS A+ V+I  A+LT  +
Sbjct: 70  FTMIQ---QFILFLNKYTNSEKTYSIKIYNELHSNNKKYGLGSSGAVLVSIAKAILT--F 124

Query: 123 HKEPSPDEI---LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
            K P  +E    L T + +   + G S G D+AAS++ GL  YQ  K++  K+++I
Sbjct: 125 EKIPFDNETIFKLVTLNNLTHNISG-SMG-DVAASLNEGLTFYQ--KFNASKLNYI 176


>gi|70607013|ref|YP_255883.1| GHMP kinase [Sulfolobus acidocaldarius DSM 639]
 gi|68567661|gb|AAY80590.1| GHMP kinase [Sulfolobus acidocaldarius DSM 639]
          Length = 322

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 87/183 (47%), Gaps = 18/183 (9%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           + K+  SAPG ++ +G + V+ G  +   AINKRV              ++S G + G  
Sbjct: 4   IKKVVASAPGKVLWIGSYSVVFGGISHSIAINKRVRAECEYSPSDDSLFETSYGVFKGKG 63

Query: 65  DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLD-----SQLGLGSSAAITVAITAALLT 119
           +        S I   I+         +K+I+  D      + GLGSS+A TVA+TA L  
Sbjct: 64  N--------SLIESVISQFPNLPKVHVKLINDKDFLLEGRKTGLGSSSASTVALTACLYA 115

Query: 120 LQYHKEPSPDEILTTAH-AIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID-FIFP 177
           L  ++    +EI   +  A   + +GI SG D+A +++G ++  +     I+ +D +I P
Sbjct: 116 L-VNENVDLNEIHKISQVANYQRQRGIGSGFDIATAVYGSIVYKRFT--DIQNLDTYIEP 172

Query: 178 IHL 180
           + L
Sbjct: 173 LRL 175


>gi|126179755|ref|YP_001047720.1| mevalonate kinase [Methanoculleus marisnigri JR1]
 gi|125862549|gb|ABN57738.1| mevalonate kinase [Methanoculleus marisnigri JR1]
          Length = 289

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 132/283 (46%), Gaps = 40/283 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG + L GEH V++G   +  AI  RV  ++T+RK R  N       Y          
Sbjct: 5   SAPGKVFLFGEHAVVYGKPGVAMAIKPRV--FVTVRKSR--NPTRPKSPYIDEC------ 54

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
               F +M +          + V SQL S  GLGSSAA+TVA  +A +  +++   + + 
Sbjct: 55  ----FRMMGVRG-------SVYVHSQLQSSSGLGSSAAVTVATLSA-INDEFNLGHAREY 102

Query: 131 ILTTAHAIVLKVQ-GISSGIDLAASIHGGLIC---YQMPKYSIEKIDFIFPIHLIYSGYK 186
           I  TA AI  KVQ G +S  D     +GG++        +   E +  +    L+     
Sbjct: 103 IAETAFAIEKKVQKGRASPTDTYVCANGGMVLITGNSKRRLPPENLQVVVGNTLVSHS-- 160

Query: 187 TPTAQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRN-KNLKVLAQAMNRQQ 244
             TA++++++  +  ++PE+ N I   I AL       +  AL N  N K L Q M+   
Sbjct: 161 --TAKMVEQVGNLRRKHPEVANPILDAIGAL-------TLAALHNIGNPKELGQYMDMNH 211

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            LLE LGV     S++V   R       +KI+G+G G C+IAL
Sbjct: 212 ALLEALGVGHPASSKLVLAARAS-GAYGAKITGAGGGGCIIAL 253


>gi|227538909|ref|ZP_03968958.1| galactokinase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241418|gb|EEI91433.1| galactokinase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 384

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 136/331 (41%), Gaps = 47/331 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V +PG + ++GEH   +    L  AINK V + +  R+D  I + ++  +    +  A
Sbjct: 20  IIVKSPGRINIIGEHTDYNDGFVLPAAINKAVYVAVAPRQDNEICLYAADFREMFQVSAA 79

Query: 68  MFHPSF----SFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              P+     ++I+  ++ ++       GF+L +   + +  GL SSAA+  A   AL  
Sbjct: 80  DLQPAEKGWPNYILGVVDQLQKRGLHVGGFNLFIDGDVPAGAGLSSSAAVECATAFALNE 139

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LICYQM--PKYSIE 170
           L +    S  +I            G+  GI D  AS+         L C  +    + +E
Sbjct: 140 L-FSLNLSRIDIARIGQLAEHTYVGVKCGIMDQFASVLSEKDQVFRLDCRSLAYEYFPLE 198

Query: 171 KIDFIFPI-------HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ- 222
             D++  +        L  S Y     +    +S I   YPE+  +      ++ ++ + 
Sbjct: 199 LGDYMILLLNTNVRHSLGDSQYNKRREKCELGVSLIRERYPEVKSLRDVTVEILDEVVKN 258

Query: 223 ------ISCQALRNKNLKVLA--QAMNR-------------QQGLLETLGVSDSKLSEIV 261
                 I C+ +  +NL+V+A  QAM +              +GL +   VS  +L  +V
Sbjct: 259 RDEDVYIKCRYVVEENLRVVAACQAMEKGDLISLGQHIYASHKGLSKAYQVSCEELDFLV 318

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDL 292
                 P ++ +++ G G G C I L K D 
Sbjct: 319 DTTYAYPDVLGARMMGGGFGGCTINLVKKDF 349


>gi|256078719|ref|XP_002575642.1| mevalonate kinase [Schistosoma mansoni]
 gi|238660884|emb|CAZ31875.1| mevalonate kinase [Schistosoma mansoni]
          Length = 325

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 99/201 (49%), Gaps = 17/201 (8%)

Query: 102 GLGSSAAITVAITAALLTLQ--------YHKEPSPDEILTT-AHAIVLKVQGISSGIDLA 152
           GLGSS A +VA TA +L L         +  +    +++++ A      + G SSG+D  
Sbjct: 85  GLGSSGAFSVAATATILLLTNNYPLVQVWDIDRVQSKLVSSLARDAECIIHGKSSGLDST 144

Query: 153 ASIHGGLICY---QMPKY---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI 206
              +GG I +   Q+P +   +I   D I  + +  +  ++ +  V K     + +   +
Sbjct: 145 ICTYGGTIVFRKDQLPLFQEINISNSDTIKLLIVNTNITRSTSIAVRKVYDKWKEDKTCV 204

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLRE 266
           N I ++I  ++ ++  I  Q    +  + L + + R Q LLE LGVS S  +EI+ +L++
Sbjct: 205 NSIFKEIGIIVDEVIDILNQKHNWEISQSLTRHIVRNQHLLEELGVSHSISNEIIEELKQ 264

Query: 267 QPHIMASKISGSGLGDCVIAL 287
               + +K++G+G G CV+  
Sbjct: 265 VG--IPAKVTGAGFGGCVVGF 283


>gi|238854635|ref|ZP_04644965.1| mevalonate kinase [Lactobacillus jensenii 269-3]
 gi|260664422|ref|ZP_05865274.1| mevalonate kinase [Lactobacillus jensenii SJ-7A-US]
 gi|282932974|ref|ZP_06338371.1| mevalonate kinase [Lactobacillus jensenii 208-1]
 gi|238832425|gb|EEQ24732.1| mevalonate kinase [Lactobacillus jensenii 269-3]
 gi|260561487|gb|EEX27459.1| mevalonate kinase [Lactobacillus jensenii SJ-7A-US]
 gi|281303009|gb|EFA95214.1| mevalonate kinase [Lactobacillus jensenii 208-1]
          Length = 304

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 130/294 (44%), Gaps = 40/294 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY---CGSLDLAM 68
           A G ++L+GEH V++G+ AL   I             + +NI +++ +    C  +D   
Sbjct: 7   AHGKVILIGEHSVVYGYDALSMPI-------------QSLNIKTTVSENNNPCHYMDTDR 53

Query: 69  FHPSF----------SFIIMAINHIKPSCGFDLKVISQ--LDSQLGLGSSAAITVAITAA 116
           +H  F           +I+     +KP+  + LK+  +  +  + GLGSSA +++  T A
Sbjct: 54  YHGDFFKAPSEYAGLKYILQHFLTLKPNSPY-LKISYRGLIPIERGLGSSATVSLGTTKA 112

Query: 117 LLTLQYHKEPSPDEILT-TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
           L    +    S  EI+  T HA  +   G +SG+D +A+++   + +   K  +E +   
Sbjct: 113 LNDF-FQLNLSEQEIMAITNHAETIN-HGKASGLD-SATVNSDYLVFFNKKTGVEILKQK 169

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYAL--MGKLSQISCQALRNKNL 233
               L+       T  +      +E+   E+    ++   L  +G L+    +A  N++ 
Sbjct: 170 LNATLLI----MDTGDLGNTKEAVELVKNEVTNSPKQAENLTNLGNLTVQVKKAWLNQDA 225

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + +  A  + Q  L  L VS  K+  +  ++        +K+SG GLG  VIAL
Sbjct: 226 ECVGNAFTQAQKYLAKLKVSTPKIDHLC-QIALDTGAYGTKLSGGGLGGIVIAL 278


>gi|326803270|ref|YP_004321088.1| phosphomevalonate kinase [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651719|gb|AEA01902.1| phosphomevalonate kinase [Aerococcus urinae ACS-120-V-Col10a]
          Length = 373

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 27/186 (14%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHG-HAALVFAINKRVILYLTL--RKDRLINIDSSLGQYC 61
           +  I    PG L + GE+ ++H    AL+ A++  V + L    + +  ++ + +   Y 
Sbjct: 1   MQTIVSKRPGKLYVAGEYAIVHSFQGALLVAVDAYVTVELNPLDQAESRLSTNQAQETYT 60

Query: 62  GSLDLA---------------MFHPSFSFIIMAINHIKPSCGFDLKVISQLDS----QLG 102
             +D A               +   ++ ++  +     P    D+K+ S LDS    + G
Sbjct: 61  WHVDEAGEISGIPSQFLLVKTLIQTAYQYLRQSGQAEAPFQAIDIKITSDLDSPEGKKYG 120

Query: 103 LGSSAAITVAITAALLTL----QYHKEPSPDEILTTAHAIV-LKVQGISSGIDLAASIHG 157
           LGSSAA+++AI  A+L L    Q H + +   +L    AI  +K+    S  DLAA+  G
Sbjct: 121 LGSSAAVSIAILEAILKLYQVNQGHSQKAFAYLLYQLGAIAQIKMDLKGSFGDLAAAAFG 180

Query: 158 GLICYQ 163
           G I YQ
Sbjct: 181 GCIYYQ 186


>gi|312871758|ref|ZP_07731846.1| mevalonate kinase [Lactobacillus iners LEAF 3008A-a]
 gi|311092700|gb|EFQ51056.1| mevalonate kinase [Lactobacillus iners LEAF 3008A-a]
          Length = 306

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 122/299 (40%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I               +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPI-------------HALNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + +  EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TARALNKYFALKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|213410339|ref|XP_002175939.1| mevalonate kinase [Schizosaccharomyces japonicus yFS275]
 gi|212003986|gb|EEB09646.1| mevalonate kinase [Schizosaccharomyces japonicus yFS275]
          Length = 431

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 75/373 (20%), Positives = 140/373 (37%), Gaps = 101/373 (27%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA-- 67
            SAPG L+L GEH V++G  A+  A++ R   +     + ++ +  +      S  LA  
Sbjct: 4   TSAPGKLILFGEHAVVYGAQAVAAAVSLRTYCFTEHVSEPILKVTLADAHTTASWSLADL 63

Query: 68  ------------------------------------MFHPSFSFIIMAINHIKPSC-GFD 90
                                               + H +F  I+     +  S  G  
Sbjct: 64  PWSLVPKIDVNKAPKSLDQKLVKGVHSLLECYVTNPLIHSAFFCILYMYMFLGSSSEGTA 123

Query: 91  LKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPDEILTTAHAIVLKVQGIS 146
           + + S +    GLGSSA ++V++ +ALL     L +   PS  +  +   A    V G +
Sbjct: 124 IVIRSNVPLGAGLGSSATVSVSVASALLLNKGVLSFPSNPSSKDSNSPTQAASTTVDGHT 183

Query: 147 ----------------------------------SGIDLAASIHGGLICYQMPKYS---- 168
                                             SGID A + HGG++ +     S    
Sbjct: 184 ASQTSQCTSPGPSDSGRLIEAWSFVGECCIHGNPSGIDNAVATHGGVVTFTKSTSSQPSR 243

Query: 169 IEKIDFIFPIHLIYSGYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
           ++ +  +  + ++ +  K P  T Q+++ ++ +      + ++   + ALM  +  +S  
Sbjct: 244 MQVLQGVTSLPIMITDTKQPKSTKQLVQNVAKL------VQDMPAPMRALMATIDSVSKS 297

Query: 227 AL---------RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
           A+         R + L  + Q +   Q LLE L VS   L  ++   +    I  +K++G
Sbjct: 298 AVELLCSRQLAREQLLPKIGQLVELNQKLLECLHVSHPTLERVIDAAK---RIGWTKLTG 354

Query: 278 SGLGDCVIALGKG 290
           +G G C   + +G
Sbjct: 355 AGGGGCAYTVLRG 367


>gi|116627445|ref|YP_820064.1| phosphomevalonate kinase [Streptococcus thermophilus LMD-9]
 gi|116100722|gb|ABJ65868.1| Phosphomevalonate kinase [Streptococcus thermophilus LMD-9]
          Length = 331

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 136/313 (43%), Gaps = 38/313 (12%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           Q ++++ V   G L + GE+ VL  G  AL+  I   + +   ++K +   + S +  Y 
Sbjct: 4   QSVNQVTVKTGGKLYIAGEYSVLTPGQTALIQFIP--IFMSAEIKKAQTTQLTSDMFDY- 60

Query: 62  GSLDLAMFHP--SFSFIIMAINHIKPSCG-----FDLKVISQLDS---QLGLGSSAAITV 111
            S+D     P  +++ I  A+N  +  CG      DL +  +L+    + G+GSS ++ V
Sbjct: 61  -SVDR---EPDVNYALIQEALNTFEAYCGENLPALDLSITGKLERDGVKFGIGSSGSVVV 116

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--------- 162
            +T   L     K+ S D +   A   +LK     S  DLA  ++  L+ Y         
Sbjct: 117 -LTLKALAASLQKDLSKDILFKLASYTLLKQGDNGSMGDLACIVYEDLVSYHSFDRAKIA 175

Query: 163 ----QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI--NEINQKIYAL 216
               QM    + +ID+ + I  + S  K        K + I  +  ++  + I+ K  + 
Sbjct: 176 ELIDQMTLSELLEIDWGYRISPVVSELKARFLVGWTKQAAISKDMVKMVKSRISSKYLSE 235

Query: 217 MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG--VSDSKLSEIVWKLREQPHIMASK 274
                Q + +AL   N  +L +++      LE+L   +   KL ++  K  EQ     +K
Sbjct: 236 TEVAVQDAIKALETGNKNLLKRSLQTVSDQLESLSPDIYVDKLKKL--KEAEQRLDAIAK 293

Query: 275 ISGSGLGDCVIAL 287
            SG+G GDC IA 
Sbjct: 294 SSGAGGGDCGIAF 306


>gi|219685517|ref|ZP_03540334.1| putative phosphomevalonate kinase [Borrelia garinii Far04]
 gi|219672916|gb|EED29938.1| putative phosphomevalonate kinase [Borrelia garinii Far04]
          Length = 317

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 29/190 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K       S   +     D 
Sbjct: 4   ISFSVPGNLLLMGEYTILEESGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID---DF 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITVAIT 114
           ++       +    +++  +C  +L+  +    +D+         + G GSSA + + I 
Sbjct: 59  SLIENRNDLVFKMFSYLSQNCFLNLESFAYDVYIDTSNFFFNDGTKRGFGSSAVVAIGIA 118

Query: 115 AALLTLQYHKEP--SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ---MPKY- 167
             L  + Y+       DEI           QG I SG D+A SI GG+I ++    PKY 
Sbjct: 119 CGLFFI-YNATNVVDKDEIFKYCLEAYRHAQGGIGSGYDIATSIFGGVIEFEGGFAPKYR 177

Query: 168 ---SIEKIDF 174
              S+E  DF
Sbjct: 178 QLGSLEFNDF 187


>gi|71993800|ref|NP_001022868.1| hypothetical protein Y42G9A.4 [Caenorhabditis elegans]
 gi|51988125|gb|AAU20835.1| Hypothetical protein Y42G9A.4c [Caenorhabditis elegans]
          Length = 484

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 129/327 (39%), Gaps = 81/327 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVI----------LYLTLR----------KDR 49
           VSAPG ++L GEH V++G  A+  +I+ R            +YL+L           KD 
Sbjct: 14  VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGRIYLSLPDLGVEKTWMLKDL 73

Query: 50  LINIDSSLGQY---------------------------CGSLDLAMFHPSFSFIIMAINH 82
           L   D    +Y                           CG   LA+   +F ++++ + H
Sbjct: 74  LKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAIL--AFWYLLLGVAH 131

Query: 83  IKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ----------------YHKE 125
            K         V  +L S +GLGSS A  V I  +LL                     +E
Sbjct: 132 RKRDLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIVADEQGNLTWEE 191

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH--LIYS 183
              D I   A A    + G +SG+D A    GG+  ++ P + IE +  +  +   L+ S
Sbjct: 192 DHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFK-PGHRIEHLKNLPDLRVILVNS 250

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
             +  TA++++ +     ++PE+      + A+ G +  IS  A      K+L + +  +
Sbjct: 251 KVERNTARMVQTVKERLKKFPEV------VDAMFGSIDAISLDA-----AKILHRPLLEE 299

Query: 244 QGLLETLG-VSDSKLSEIVWKLREQPH 269
            G  +T   V ++ L      + EQ H
Sbjct: 300 NGGGDTGSTVQENGLGPFGGNMVEQDH 326


>gi|325912093|ref|ZP_08174491.1| mevalonate kinase [Lactobacillus iners UPII 143-D]
 gi|325476043|gb|EGC79211.1| mevalonate kinase [Lactobacillus iners UPII 143-D]
          Length = 306

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 123/299 (41%), Gaps = 39/299 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-- 63
            K+ V   G ++L+GEH V++G  A+   I+              +NID+S+  Y     
Sbjct: 4   RKVVVKTHGKVILIGEHSVVYGKDAMALPIHA-------------LNIDTSVEAYHDGIW 50

Query: 64  LDLAMFHPSFSFIIMAINHIK----------PS-CGFDLKVISQLDSQLGLGSSAAITVA 112
           +D   +   +       N +K          P+ C   +    ++  + GLGSSA + + 
Sbjct: 51  MDTLRYQGPYLTAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG 110

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSI 169
            TA  L   +  + +  EI    +       G +SG+D A      L+ +     PK   
Sbjct: 111 -TARALNEYFALKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLS 169

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQAL 228
           EK+     I  + +G    T + +  + Y IE +  +   I++     +G L+  +    
Sbjct: 170 EKLGATLLI--MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYW 222

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K+  ++    N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 223 FKKDAPMVGTIFNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|296212867|ref|XP_002753028.1| PREDICTED: mevalonate kinase-like [Callithrix jacchus]
          Length = 344

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 142/325 (43%), Gaps = 38/325 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC--GSLD 65
           + VSAPG ++L GEH V+HG  AL  A+N R   +L L+      +D SL       S D
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRT--FLRLQPHSSGKVDLSLPNIGIKRSWD 63

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY--- 122
           +A      +  +   +   P+     + + +L    GL    A+T  +  A+LT  Y   
Sbjct: 64  VARLQLLDTSFLEQGDVTAPTP----EQVEKLKEVAGLPDDCAVTKRL--AVLTFLYLYL 117

Query: 123 ---HKEPSPDEILTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
               K+    E L   +    +    + G  SG+D A S  GG + YQ  K  I  +  +
Sbjct: 118 SIFRKQRWTKEDLELINKWAFQGERVIHGNPSGVDNAVSTWGGALRYQQGK--IASLKRL 175

Query: 176 FPIHLIYSGYKTP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISC 225
             + ++ +  + P  T  ++  +    +++PE        I+ I+ +   ++G++ +   
Sbjct: 176 PALQILLTNTRVPRSTKALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGE--A 233

Query: 226 QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
            AL  +   VL + ++  Q  L  LGV  + L ++    R   H + SK++G+G G C I
Sbjct: 234 PAL--EQYHVLEELIDMNQHHLNALGVGHASLDQLCQVTR--AHGLHSKLTGAGGGGCGI 289

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGID 310
            L K  L     ++    + + G D
Sbjct: 290 TLLKPGLEQPEVEATKQALTSCGFD 314


>gi|203284585|ref|YP_002222325.1| phosphomevalonate kinase, putative [Borrelia duttonii Ly]
 gi|201084028|gb|ACH93619.1| phosphomevalonate kinase, putative [Borrelia duttonii Ly]
          Length = 313

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 20/187 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLR---KDRLINIDSSLGQY 60
           +  I  S PG+L+LMGE+ +L  +   L  AI++R   Y + +   K R  +  + +  +
Sbjct: 1   MDTINFSVPGNLLLMGEYSILEENGFGLAIAIDERA--YFSFKQSDKWRFFSKRTKIDNF 58

Query: 61  C--GSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDSQL--GLGSSAAITVAI 113
               S D  +F   FS++     +   +  FD+ V +    LDS +  G GSSA + V I
Sbjct: 59  TLIDSNDDFIFK-MFSYLKYCYFNNLEAFPFDVYVDTSNFFLDSGVKKGFGSSAVVAVGI 117

Query: 114 TAAL-LTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQ---MPKYS 168
              + L L  +K    D+I           Q G+ SG D+A S+ GG++ ++    PKY 
Sbjct: 118 VYGIYLILNGNKNFIKDKIFMYCLEAYRYAQGGMGSGYDIATSLFGGVVMFKGGNSPKYE 177

Query: 169 -IEKIDF 174
            ++KI F
Sbjct: 178 LLDKICF 184


>gi|193685976|ref|XP_001942835.1| PREDICTED: mevalonate kinase-like [Acyrthosiphon pisum]
          Length = 417

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 148/376 (39%), Gaps = 104/376 (27%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS---------LGQY 60
           V+APG ++L GEH V++G  A+  AI++   L  T  +    N D +         L  Y
Sbjct: 9   VTAPGKIILFGEHSVVYGKPAIACAIDQHTTL--TFTESYCNNQDLNTIPCRIILPLINY 66

Query: 61  CGSLDLAM-----FHPS--FSFIIMAINHIKP---------------------------S 86
            G L + +     F P+  F   +  +N  +P                           S
Sbjct: 67  SGMLTIHLDAKPTFSPTTYFQETLNKLNKNEPFLNELDTLSGNEKKTLTVLHFIFGGILS 126

Query: 87  C--------GFDLKVISQLDSQLGLGSSAAITVAITAALL---------TLQYHKEPSPD 129
           C         F + + S L    G GSSA+  V++ AA L          ++   +P  D
Sbjct: 127 CYMKQLKNVSFTIGITSVLKLGAGTGSSASYCVSLVAACLAYVKFKINSNVEIQFDPLLD 186

Query: 130 EILTTAHAIVLKVQGIS----------------------------SGIDLAASIHGGLIC 161
           +  + +   +L ++  +                            SG+D     +G ++ 
Sbjct: 187 DFHSQSGDNLLIIEAFTDNISFSDGEKCLINRWALLAENFIHTKASGLDNTICTYGTMV- 245

Query: 162 YQMPKYSIEKIDFI--FPIHLIYSGYKTPTAQVLKKI--SYIEIEYPEI-----NEINQK 212
            Q  K +  K+       I LIYSG +  T  V++ +   Y +  Y  I     N I Q 
Sbjct: 246 -QYTKLNSHKLLEAPELKILLIYSGIERSTGNVVQSVRTKYNDDTYQPILDAIFNSIGQI 304

Query: 213 IYALMGKLSQISCQALRN-KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIM 271
           + + +  + Q++   L+  + + VL   M+  QGLL +LGVS   L  IV  L++    +
Sbjct: 305 VNSAVNAIDQMAQNPLQELQQISVLQTLMDMNQGLLMSLGVSHETLDAIVAILKK--FDL 362

Query: 272 ASKISGSGLGDCVIAL 287
            +K++G+G+G   I L
Sbjct: 363 HAKLTGAGMGGYAICL 378


>gi|254787176|ref|YP_003074605.1| kinase ATP-binding domain, GHMP family [Teredinibacter turnerae
           T7901]
 gi|237684885|gb|ACR12149.1| kinase ATP-binding domain, GHMP family [Teredinibacter turnerae
           T7901]
          Length = 346

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 102/234 (43%), Gaps = 37/234 (15%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI------- 53
           M + LH    SAPG ++L GE+ VL G  ALV  +++R+ L L  +      I       
Sbjct: 1   MTKTLH---ASAPGKVILCGEYAVLQGAPALVAGVDRRINLQLKPQASSKAEINVLCPGF 57

Query: 54  -DSSLGQYCGSLDLAMFHPSFSFIIMAINHI------------KPSCGFDLKVISQLDSQ 100
            D +   +  + +L    P+ + +I   N +              S   ++   +  D Q
Sbjct: 58  LDGACQLHWQATELVSTEPALALLIKLCNALLAEIPSALDLLRSHSWALEIDSRALFDKQ 117

Query: 101 --LGLGSSAAITVAITAALLTLQ----YHKEPSPDEILTTAHAIVLKVQGISSGIDLAAS 154
             LGLGSS A+  A+  AL TL       ++  P  I+  AH+     QG  SG D+AAS
Sbjct: 118 HKLGLGSSGALATALAGALWTLSGDVLSREQAWP--IIHRAHSAAQGKQG--SGADVAAS 173

Query: 155 IHGG--LICYQMPKYSIEKIDFIFPIHL--IYSGYKTPTAQVLKKISYIEIEYP 204
           + GG  +   Q    ++E +      HL  I+SG    T + L+ +S     +P
Sbjct: 174 LCGGTHVFSNQQLHCALEPLRLPQGTHLAFIWSGTSASTPKYLQSLSQWREHHP 227


>gi|71993806|ref|NP_001022869.1| hypothetical protein Y42G9A.4 [Caenorhabditis elegans]
 gi|52839819|gb|AAU87813.1| Hypothetical protein Y42G9A.4d [Caenorhabditis elegans]
          Length = 514

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 129/327 (39%), Gaps = 81/327 (24%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVI----------LYLTLR----------KDR 49
           VSAPG ++L GEH V++G  A+  +I+ R            +YL+L           KD 
Sbjct: 44  VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGRIYLSLPDLGVEKTWMLKDL 103

Query: 50  LINIDSSLGQY---------------------------CGSLDLAMFHPSFSFIIMAINH 82
           L   D    +Y                           CG   LA+   +F ++++ + H
Sbjct: 104 LKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAIL--AFWYLLLGVAH 161

Query: 83  IKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ----------------YHKE 125
            K         V  +L S +GLGSS A  V I  +LL                     +E
Sbjct: 162 RKRDLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIVADEQGNLTWEE 221

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH--LIYS 183
              D I   A A    + G +SG+D A    GG+  ++ P + IE +  +  +   L+ S
Sbjct: 222 DHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFK-PGHRIEHLKNLPDLRVILVNS 280

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
             +  TA++++ +     ++PE+      + A+ G +  IS  A      K+L + +  +
Sbjct: 281 KVERNTARMVQTVKERLKKFPEV------VDAMFGSIDAISLDA-----AKILHRPLLEE 329

Query: 244 QGLLETLG-VSDSKLSEIVWKLREQPH 269
            G  +T   V ++ L      + EQ H
Sbjct: 330 NGGGDTGSTVQENGLGPFGGNMVEQDH 356


>gi|225562386|gb|EEH10665.1| mevalonate kinase [Ajellomyces capsulatus G186AR]
          Length = 488

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 159/384 (41%), Gaps = 92/384 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 44  VSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD-- 101

Query: 61  CGSLDLAMF-HPS---------FSFIIMAINHIKP-----SCG--FDLKVISQ------- 96
             SL   +F HPS          S     +  I+P     S G   +++ I Q       
Sbjct: 102 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDEVRKIHQSSATAFL 161

Query: 97  -----------------LDSQLGLG----SSAAITVAITAALLTLQY------HKEPSPD 129
                            L S + +G    SSA+I V ++AALL LQ       H++  P+
Sbjct: 162 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQLPE 220

Query: 130 EILTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-F 176
           E  T    I        + + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 221 EAETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPEL 280

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE--------INQKIYALM--GKLSQISCQ 226
           P+ L+ S     T+  + K++     +P ++E        + +    L+  G+  + S +
Sbjct: 281 PLLLVNSRQPRSTSVEVAKVANFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSE 340

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           A+ +       +      GLL +LGVS  +L E + +L +      +K++G+G G C I 
Sbjct: 341 AIDH-----FGELFRINHGLLVSLGVSHPRL-ERIRELVDHTGSGWTKLTGAGGGGCAIT 394

Query: 287 LGKGDLNSLPYQSVNCHMHAKGID 310
           L + +++    + +   +  +G +
Sbjct: 395 LLRTNIDPAALKRLEKTLDDEGFE 418


>gi|71993795|ref|NP_001022867.1| hypothetical protein Y42G9A.4 [Caenorhabditis elegans]
 gi|51988124|gb|AAU20834.1| Hypothetical protein Y42G9A.4b [Caenorhabditis elegans]
          Length = 614

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 113/286 (39%), Gaps = 75/286 (26%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVI----------LYLTLR----------KDR 49
           VSAPG ++L GEH V++G  A+  +I+ R            +YL+L           KD 
Sbjct: 144 VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGRIYLSLPDLGVEKTWMLKDL 203

Query: 50  LINIDSSLGQY---------------------------CGSLDLAMFHPSFSFIIMAINH 82
           L   D    +Y                           CG   LA+   +F ++++ + H
Sbjct: 204 LKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAIL--AFWYLLLGVAH 261

Query: 83  IKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ----------------YHKE 125
            K         V  +L S +GLGSS A  V I  +LL                     +E
Sbjct: 262 RKRDLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIVADEQGNLTWEE 321

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH--LIYS 183
              D I   A A    + G +SG+D A    GG+  ++ P + IE +  +  +   L+ S
Sbjct: 322 DHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFK-PGHRIEHLKNLPDLRVILVNS 380

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
             +  TA++++ +     ++PE+      + A+ G +  IS  A +
Sbjct: 381 KVERNTARMVQTVKERLKKFPEV------VDAMFGSIDAISLDAAK 420


>gi|203288119|ref|YP_002223134.1| phosphomevalonate kinase, putative [Borrelia recurrentis A1]
 gi|201085339|gb|ACH94913.1| phosphomevalonate kinase, putative [Borrelia recurrentis A1]
          Length = 313

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 20/187 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLR---KDRLINIDSSLGQY 60
           +  I  S PG+L+LMGE+ +L  +   L  AI++R   Y + +   K R  +  + +  +
Sbjct: 1   MDTINFSVPGNLLLMGEYSILEENGFGLAIAIDERA--YFSFKQSDKWRFFSKRTKIDNF 58

Query: 61  C--GSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDSQL--GLGSSAAITVAI 113
               S D  +F   FS++     +   +  FD+ V +    LDS +  G GSSA + V I
Sbjct: 59  TLIDSNDDFIFK-MFSYLKYCYFNNLEAFPFDVYVDTSNFFLDSGVKKGFGSSAVVAVGI 117

Query: 114 TAAL-LTLQYHKEPSPDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQ---MPKYS 168
              + L L  +K    D+I           Q G+ SG D+A S+ GG++ ++    PKY 
Sbjct: 118 IYGIYLILNGNKNFIKDKIFMYCLEAYRYAQGGMGSGYDIATSLFGGVVMFKGGNSPKYE 177

Query: 169 -IEKIDF 174
            ++KI F
Sbjct: 178 LLDKICF 184


>gi|310794260|gb|EFQ29721.1| mevalonate kinase [Glomerella graminicola M1.001]
          Length = 499

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 105/240 (43%), Gaps = 30/240 (12%)

Query: 102 GLGSSAAITVAITAALLTLQY-----HKEPSPDE-------ILTTAHAIVLKVQGISSGI 149
           GLGSSA+I V + AALL         H +  PDE       I   A    + + G  SG+
Sbjct: 198 GLGSSASIAVCLAAALLLQLRTLSGPHPDQPPDEARLQVERINRWAFVCEMCIHGNPSGV 257

Query: 150 DLAASIHGGLICYQMPKYSIEK-----IDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEY 203
           D   +  G  + +Q   Y+         DF   P+ L+ +     TA  + K++ ++  +
Sbjct: 258 DNTVATQGKAVVFQRTDYNKPPAVRPLWDFPELPLLLVDTKQAKSTAFEVAKVAKLKKTH 317

Query: 204 PE--------INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDS 255
           PE        I+++      L+G     + +A   ++L+ + + M    GLL +LGVS  
Sbjct: 318 PELVGCILDAIDKVTDAADKLIGGEEFDNEEA---ESLRKVGELMTINHGLLVSLGVSHP 374

Query: 256 KLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           +L  I  +L +   I  +K++G+G G C I L K D+       +   +  +G +    T
Sbjct: 375 RLERIR-ELVDHEGIGWTKLTGAGGGGCSITLLKPDVEKEKLMKLETQLADEGYEKFETT 433



 Score = 37.0 bits (84), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 10 VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKDR 49
          VSAPG +++ GEH V+H  AA+  AI+ R  L +T L K R
Sbjct: 54 VSAPGKVIVFGEHAVVHRKAAIAAAISLRSYLLVTSLSKSR 94


>gi|170016978|ref|YP_001727897.1| phosphomevalonate kinase [Leuconostoc citreum KM20]
 gi|169803835|gb|ACA82453.1| Phosphomevalonate kinase [Leuconostoc citreum KM20]
          Length = 339

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 134/328 (40%), Gaps = 62/328 (18%)

Query: 13  PGSLVLMGEHGVLH-GHAALVF------------AINKRVILYLTLRKDRLINIDSSLGQ 59
           PG L L GE+ + H G+ AL+             A    VI   T+  D   NI  +   
Sbjct: 7   PGKLFLAGEYAITHPGNTALIATTKTGLSVEIESAAQTSVIHSNTITTDWHFNITET--A 64

Query: 60  YCGSLDLAMFHPSFSFI--IMAINHIKPSCGFDLKVISQLDS---QLGLGSSAAITVAIT 114
              + D      + + +      N  KP    ++ + S L+S   ++GLGSSAA+ V I 
Sbjct: 65  IVSTDDWRYVRAAVNIMQAYTTTNQFKPLSNINVNITSNLNSPFGKIGLGSSAAVVVGIV 124

Query: 115 AALLTLQYHKEP--SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK- 171
            A+      K P  +  ++ + AH   L VQ   S  D+AA ++GG+I YQ P  S  + 
Sbjct: 125 EAINAQFNLKLPILTRFKLASLAH---LHVQKNGSLGDIAAIMYGGVIAYQSPDLSSFRQ 181

Query: 172 ----------IDFIFP-IHL----------IYSGYKTPTAQVLKKISYIEIEYPEINEIN 210
                      + I+P +H+          +  G    +A     + +  +    I E  
Sbjct: 182 NDENWLRPSLANKIWPKLHIAQLPWPPKWQLLLGATLESADTKSALEHFILSKQFITESQ 241

Query: 211 QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET---LGVSDSKLSEIVWKLREQ 267
           Q +  L+  ++Q        ++   LA  + R Q LL+     G    KL+ ++  L   
Sbjct: 242 QIVQNLIHTIAQ--------EDYPQLALGLRRNQELLQNSLPTGYITPKLAHLLESLTN- 292

Query: 268 PHIMASKISGSGLGDCVIALGKGDLNSL 295
              +A KISG+G GD   A+ + +   L
Sbjct: 293 ---IAGKISGAGFGDNGFAVLQNNAEQL 317


>gi|164659744|ref|XP_001730996.1| hypothetical protein MGL_1995 [Malassezia globosa CBS 7966]
 gi|159104894|gb|EDP43782.1| hypothetical protein MGL_1995 [Malassezia globosa CBS 7966]
          Length = 838

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 87/362 (24%), Positives = 147/362 (40%), Gaps = 63/362 (17%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQ----- 59
           + VSAPG ++L GEH V+HG  A+  A   R    +T  K  ++++   D +L Q     
Sbjct: 439 LTVSAPGKVILFGEHAVVHGVTAVAAATALRCYGRVTPSKQGMVSLSMPDIALEQHWDQA 498

Query: 60  ------YCGSLDLAMFHP-----------------------SFSFIIMAINHIK-PSCGF 89
                 Y  S  L    P                       S +F+ + ++  +  + G 
Sbjct: 499 ALPWSLYDTSRKLDTLDPQLLEALSMLVSPAYPRDDRRYAASLAFLYLYMHLAQNDALGQ 558

Query: 90  DLKVISQLDSQLGLGSSAAITVAITAALLTLQYH------KEPSP----DEILTTAHAIV 139
             ++ S L    GLGSSAA++  + + LL    H       EP P      I T A+   
Sbjct: 559 AFELRSSLPISAGLGSSAAVSTCLASLLLYTHMHLPLPDLHEPMPKLHTKYINTWAYVAE 618

Query: 140 LKVQGISSGIDLAASIHGGLICYQ--MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKIS 197
             + G  SG+D   +  GG + +   +P   + + + + P++L           V++   
Sbjct: 619 KVIHGEPSGVDNTVATLGGAVAFTRALPTNHLTENELV-PMNLDAVRVLITDTHVIRNTK 677

Query: 198 YIEIEY-PEINEINQKIYALMGKLSQISCQA---LRNKNL------KVLAQAMNRQQGLL 247
            +  +   + NE   ++ A    +  +S QA   LR+  L      + L+  M+     L
Sbjct: 678 DLVAKVSAQKNEEPVRVEAAFAMIQHLSTQAQALLRDSTLSRRHLVERLSVLMDLNHLQL 737

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             LGV  S L E V +L  +  + A K++G+G G C I L    ++    Q +   M A+
Sbjct: 738 VQLGVGHSAL-ENVRRLCAERRLCA-KLTGAGGGGCAITLLDDQVDESTVQQLTHAMRAQ 795

Query: 308 GI 309
           G 
Sbjct: 796 GF 797


>gi|330718589|ref|ZP_08313189.1| mevalonate kinase [Leuconostoc fallax KCTC 3537]
          Length = 311

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 136/319 (42%), Gaps = 42/319 (13%)

Query: 16  LVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSF 75
           ++L+GEH V++G  A+   +   + +  TLR        +  GQ    LD   FH   + 
Sbjct: 15  VILIGEHAVVYGQPAIAMPL-PNLTVTATLRP-------AFRGQV---LDGNHFHGELNE 63

Query: 76  IIMAINHIK------------PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
           I   I  ++            P   F L + + +  + GLG+SAA+  A+T A     ++
Sbjct: 64  IGANIEGLRQLILRLLDKFGVPDMTFTLSIETNIPQERGLGASAALATAVTKAFFNY-FN 122

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYS 183
              S  E             G  SG+D AA++H     +    +   KI   F +HL  +
Sbjct: 123 TGLSETERTYFTDIEETITHGSPSGLD-AATVHATNPVW----FVKNKIMQSFDMHLSGT 177

Query: 184 GYKTPT---AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ---ALRNKNLKVLA 237
                T    Q ++ IS I+ E  +IN    + YA +  L  +S +   AL N     L 
Sbjct: 178 LVIADTGIHGQTIRAISVIK-EQLKINF--DETYAQIEHLGSLSDEVRLALVNNQPAYLG 234

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
           +  +     L +LGVS  +L ++V         + +K++G+G+G  + AL K + +++  
Sbjct: 235 ELFSEAHRTLRSLGVSHPRLDKLV-TAAINAGALGAKLTGAGVGGAMFALAKNNNDAI-- 291

Query: 298 QSVNCHMHAKGIDIVPITP 316
            ++   ++A G     I P
Sbjct: 292 -TIANALNAAGAQNTWIQP 309


>gi|219684220|ref|ZP_03539164.1| putative phosphomevalonate kinase [Borrelia garinii PBr]
 gi|219672209|gb|EED29262.1| putative phosphomevalonate kinase [Borrelia garinii PBr]
          Length = 314

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 80/189 (42%), Gaps = 27/189 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K       S   +     D 
Sbjct: 4   ISFSVPGNLLLMGEYTILEESGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID---DF 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITVAIT 114
           ++       +    +++  +C  +L+  +    +D+         + G GSSA + + I 
Sbjct: 59  SLIENRNDLVFKMFSYLSQNCFLNLESFAYDVYIDTSNFFFNDGTKKGFGSSAVVAIGIA 118

Query: 115 AALLTL-QYHKEPSPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ---MPKY-- 167
             L  +         DEI           QG I SG D+A SI GG+I ++    PKY  
Sbjct: 119 CGLFFICNATNVVDKDEIFKYCLEAYRHAQGGIGSGYDIATSIFGGVIEFEGGFAPKYRQ 178

Query: 168 --SIEKIDF 174
             S+E  DF
Sbjct: 179 LGSLELNDF 187


>gi|240281233|gb|EER44736.1| mevalonate kinase [Ajellomyces capsulatus H143]
          Length = 552

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 159/384 (41%), Gaps = 92/384 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKR-VILYLTLRKD--------RLINIDSSLGQY 60
           VSAPG +++ GEH V+HG  A+  AI+ R  +L  TL K         R I +D +    
Sbjct: 108 VSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD-- 165

Query: 61  CGSLDLAMF-HPS---------FSFIIMAINHIKP-----SCG--FDLKVISQ------- 96
             SL   +F HPS          S     +  I+P     S G   +++ I Q       
Sbjct: 166 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDEVRKIHQSSATAFL 225

Query: 97  -----------------LDSQLGLG----SSAAITVAITAALLTLQY------HKEPSPD 129
                            L S + +G    SSA+I V ++AALL LQ       H++  P+
Sbjct: 226 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALL-LQIRILAGPHQDQLPE 284

Query: 130 EILTTAHAI-------VLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-----IDFI-F 176
           E  T    I        + + G  SG+D   S  G  + ++   YS        +DF   
Sbjct: 285 EAETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPEL 344

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYAL-----MGKLSQISCQ 226
           P+ L+ S     T+  + K++     +P ++E     I+Q   +       G+  + S +
Sbjct: 345 PLLLVNSRQPRSTSVEVAKVANFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSE 404

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           A+ +       +      GLL +LGVS  +L E + +L +      +K++G+G G C I 
Sbjct: 405 AIDH-----FGELFRINHGLLVSLGVSHPRL-ERIRELVDHTGSGWTKLTGAGGGGCAIT 458

Query: 287 LGKGDLNSLPYQSVNCHMHAKGID 310
           L + +++    + +   +  +G +
Sbjct: 459 LLRTNIDPAALKRLEKTLDDEGFE 482


>gi|195485263|ref|XP_002091019.1| GE13435 [Drosophila yakuba]
 gi|194177120|gb|EDW90731.1| GE13435 [Drosophila yakuba]
          Length = 390

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 92/217 (42%), Gaps = 21/217 (9%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH-------KEPSPDEILTTAHAIV 139
            GF ++V SQL    GLGSSA+   A+    L L  H       +E +   I T A    
Sbjct: 137 TGFQVQVDSQLTVGAGLGSSASFGAALATTFLILAGHFDRDSYLEEANQALISTWAFESE 196

Query: 140 LKVQGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISY 198
               G  SG+D     +GG++ Y +   +   KI     I L+ S     TA ++ K+ +
Sbjct: 197 RVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLKIQKPLNILLVDSRVSRSTADIVAKVRH 256

Query: 199 IEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
           +   +P++         E+      L          + + + L+ L Q  N    LL+ +
Sbjct: 257 LGEAFPQLIEAIWHACEELVTAAVPLYESFGNAQDDSAKFEQLERLFQINN---DLLKAI 313

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 314 GVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 348


>gi|315222754|ref|ZP_07864642.1| mevalonate kinase [Streptococcus anginosus F0211]
 gi|315188167|gb|EFU21894.1| mevalonate kinase [Streptococcus anginosus F0211]
          Length = 292

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 130/279 (46%), Gaps = 26/279 (9%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A   ++L+GEH V++G+ AL   +    +    L  D    +         +L +A+F  
Sbjct: 10  AHSKIILIGEHAVVYGYPALALPLTNIEVTCRILPSDHAWILYEE-----DTLSMAVF-A 63

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
           S  F+ +   +I+  C    ++ S +  + G+GSSAA+++A   A+    Y +E   + +
Sbjct: 64  SLEFLGVQEAYIR--C----EIESMVPEKRGMGSSAAVSIAAIRAVFDY-YEQELDRETL 116

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPT 189
              A+   +      SG+D    +    I + +      + +     +L+   +G    T
Sbjct: 117 EILANRAEMIAHMNPSGLDAKTCLSDRAIKF-IKNVGFSEFETNLGAYLVIADTGIYGHT 175

Query: 190 AQVLKKISYIEIE-YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            + ++++  + +   P +++        +GKL+    +AL+ K+L+ +  AM++    L+
Sbjct: 176 REAIQEVEQLGMTALPHLHQ--------LGKLTNEVEEALKVKDLERIGIAMSKAHLSLK 227

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            LGVS  +   +V   +E    + +K+SG GLG C+IAL
Sbjct: 228 NLGVSCPEADWLVATAQENG-ALGAKMSGGGLGGCIIAL 265


>gi|116491122|ref|YP_810666.1| phosphomevalonate kinase [Oenococcus oeni PSU-1]
 gi|116091847|gb|ABJ57001.1| Phosphomevalonate kinase [Oenococcus oeni PSU-1]
          Length = 249

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 120/281 (42%), Gaps = 70/281 (24%)

Query: 13  PGSLVLMGEHGV-LHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           PG L+L GE+ V L  H ALVF+I            DR I+ + S               
Sbjct: 7   PGKLMLAGEYAVTLANHLALVFSI------------DRFISKNYS--------------- 39

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                               +++++   + GLGSS A  V     L+T   +   S  +I
Sbjct: 40  --------------------QLVNEKGVKYGLGSSGAYAV-----LMTKMENSSLSDKDI 74

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI--YSGYKTPT 189
              A  +  + Q  +SG D+AAS + GL+ Y+   +  E+I F    +LI  ++G    T
Sbjct: 75  FRQALILSRQTQPQNSGADIAASTYSGLLLYKNGSFP-ERIFFPENWNLIVGWTGKPAIT 133

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           ++++KK         E + I +K+              ++ K+ +   Q +   +  LE 
Sbjct: 134 SELVKKNQLSSFFVKESDMIVRKM-----------VDFIKAKDFEKFNQEIFLAEKNLEK 182

Query: 250 L-GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L GV   KL++ + ++ +   I A KISG+G GD VIA  +
Sbjct: 183 LSGVLTDKLAKAI-EIAKNFGIEA-KISGAGGGDNVIAFTR 221


>gi|312277965|gb|ADQ62622.1| Phosphomevalonate kinase [Streptococcus thermophilus ND03]
          Length = 331

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 136/313 (43%), Gaps = 38/313 (12%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           Q ++++ V   G L + GE+ VL  G  AL+  I   + +   ++K +   + S +  Y 
Sbjct: 4   QSVNQVTVKTGGKLYIAGEYSVLTPGQTALIQFIP--IFMSADIKKAQTTQLTSDMFDY- 60

Query: 62  GSLDLAMFHP--SFSFIIMAINHIKPSCG-----FDLKVISQLDS---QLGLGSSAAITV 111
            S+D     P  +++ I  A+N  +  CG      DL +  +L+    + G+GSS ++ V
Sbjct: 61  -SVDR---EPDVNYALIQEALNTFEAYCGENLPALDLSITGKLERDGVKFGIGSSGSVVV 116

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY--------- 162
            +T   L     K+ S D +   A   +LK     S  DLA  ++  L+ Y         
Sbjct: 117 -LTLKALAASLQKDLSKDILFKLASYTLLKQGDNGSMGDLACIVYEDLVSYRSFDRAKIA 175

Query: 163 ----QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI--NEINQKIYAL 216
               QM    + +ID+ + I  + S  K        K + I  +  ++  + I+ K  + 
Sbjct: 176 ELIDQMTLSELLEIDWGYRISPVVSVLKARFLVGWTKQAAISKDMVKMVKSRISSKYLSE 235

Query: 217 MGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG--VSDSKLSEIVWKLREQPHIMASK 274
                Q + +AL   N  +L +++      LE+L   +   KL ++  K  EQ     +K
Sbjct: 236 TEVAVQDAIKALETGNKNLLKRSLQTVSDQLESLSPDIYVDKLKKL--KEAEQGLDAIAK 293

Query: 275 ISGSGLGDCVIAL 287
            SG+G GDC IA 
Sbjct: 294 SSGAGGGDCGIAF 306


>gi|312147919|gb|ADQ30578.1| phosphomevalonate kinase, putative [Borrelia burgdorferi JD1]
          Length = 317

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTA-HAIVLKVQGISSGIDLAASIHGGLICYQ 163
            I   L  +          EI      A      GI SG D+A SI GG+I ++
Sbjct: 116 GIACGLFLIHNATNVVEKGEIFKYCLEAYRYSQGGIGSGYDIATSIFGGVIEFE 169


>gi|55822531|ref|YP_140972.1| phosphomevalonate kinase [Streptococcus thermophilus CNRZ1066]
 gi|55738516|gb|AAV62157.1| phosphomevalonate kinase [Streptococcus thermophilus CNRZ1066]
          Length = 331

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 142/315 (45%), Gaps = 38/315 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQ 59
           + Q ++++ V   G L + GE+ VL  G  AL+  I   + +   ++K +   + S +  
Sbjct: 2   LKQSVNQVTVKTGGKLYIAGEYSVLTPGQTALIQFIP--IFMSAEIKKAQTTQLTSDMFD 59

Query: 60  YCGSLDLAMFHP--SFSFIIMAINHIKPSCG-----FDLKVISQLDS---QLGLGSSAAI 109
           Y  S+D     P  +++ I  A+N  +  CG      DL +  +L+    + G+GSS ++
Sbjct: 60  Y--SVDR---EPDVNYALIQEALNTFEAYCGENLPALDLSITGKLERDGVKFGIGSSGSV 114

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-MPKYS 168
            V +T   L     K+ S D +   A   +LK     S  DLA  ++  L+ Y+   +  
Sbjct: 115 VV-LTLKALAASLQKDLSKDILFKLASYTLLKQGDNGSMGDLACIVYEDLVSYRSFDRAK 173

Query: 169 I-EKIDFIFPIHL--IYSGYK-TPTAQVLKK---ISYIE---IEYPEINEINQKIYALMG 218
           I E ID +    L  I  GY+ +P   VLK    + + +   I    +  +  +I +   
Sbjct: 174 IAELIDQMTLSELLEIDWGYRISPVVSVLKARFLVGWTKQAAISKDMVKMVKSRISSKYL 233

Query: 219 KLSQISCQ----ALRNKNLKVLAQAMNRQQGLLETLG--VSDSKLSEIVWKLREQPHIMA 272
             ++++ Q    AL   N  +L +++      LE+L   +   KL ++  K  EQ     
Sbjct: 234 SETEVTVQDAIKALETGNKNLLKRSLQTVSDQLESLSPDIYVDKLKKL--KEAEQGLDAI 291

Query: 273 SKISGSGLGDCVIAL 287
           +K SG+G GDC IA 
Sbjct: 292 AKSSGAGGGDCGIAF 306


>gi|227529134|ref|ZP_03959183.1| possible mevalonate kinase [Lactobacillus vaginalis ATCC 49540]
 gi|227350978|gb|EEJ41269.1| possible mevalonate kinase [Lactobacillus vaginalis ATCC 49540]
          Length = 316

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 132/322 (40%), Gaps = 34/322 (10%)

Query: 16  LVLMGEHGVLHGHAALVFA---INKRVILYLTLRKDRLIN---IDSSLGQYCGSLDLAMF 69
           ++LMGEH V++G  A+      +    I+ LT +    I     +  L Q    +  A  
Sbjct: 13  IILMGEHSVVYGEPAIALPLPDVTLTAIIKLTNKGGHQIKSRYFEGPLNQIPEKM--AGV 70

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
               S ++   N    S  + + + SQL ++ G+GSSAA  VAI  A   L Y +     
Sbjct: 71  QRLISSLMRRFN--GESDQWIMTIKSQLPAERGMGSSAATAVAIVRAFFDL-YEERLERK 127

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE-------KIDFIFPIHLIY 182
           ++L  A           SG+D A       +    P Y ++       K++    + +  
Sbjct: 128 QLLQLADIEEEVTHRSPSGLDAAT------VSSTSPLYFVKGQAGVPLKMNLQATMVIAD 181

Query: 183 SGYKTPTAQVLKKISYIEIEY---PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +G K  T + +  + + E++      ++ IN      +GKL  ++   L N     L  A
Sbjct: 182 TGIKGATKEAIIAVKH-ELDTNHSTALSHINH-----LGKLVNLAKDYLSNNEAMSLGIA 235

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
           +N  Q  L  L VSD  L  ++         + +K++G G G C+ A+ +  L +     
Sbjct: 236 LNSAQNDLAALNVSDEHLDRLIAAANHNG-ALGAKLTGGGRGGCMFAITRTALGARKLAG 294

Query: 300 VNCHMHAKGIDIVPITPSHSTS 321
           +     AK + + P+  +  T+
Sbjct: 295 ILKDNGAKQVWLQPLGDTEETN 316


>gi|313885705|ref|ZP_07819454.1| phosphomevalonate kinase [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619070|gb|EFR30510.1| phosphomevalonate kinase [Eremococcus coleocola ACS-139-V-Col8]
          Length = 371

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 135/331 (40%), Gaps = 61/331 (18%)

Query: 12  APGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD----- 65
           APG L L GE+ VL     A++ A+N+ V   +T++    +N    L Q  G  D     
Sbjct: 19  APGKLYLAGEYAVLAPRQPAILLALNRYV--KVTIKPSSTLN-QGILSQAKGQADYHYQR 75

Query: 66  ----LAMFHPSFSFIIMAINHI--------KPSCGFDLKVISQL-----DSQLGLGSSAA 108
               +      +++ + AI  +        +    + L+ +S L       + GLGSS A
Sbjct: 76  QNGSIPQKEAYWTYCLAAIQIVEVLFRQKGQVIADYHLETMSDLVEEVSGKKFGLGSSGA 135

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           ITVA   ALL    ++  SP ++   A   ++ +    S  DLAA+  GG + YQ P   
Sbjct: 136 ITVATIRALLDFYGYQADSPLDVYKLAVLALVNLGNNGSFGDLAAAAFGGWVYYQAPDRQ 195

Query: 169 I--------EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL 220
                    + IDF   +   +   +  +  V  KI ++ + + +    +    A   + 
Sbjct: 196 WLADQVSQNQTIDFF--LENSWPNLQIESLPVPSKIDFL-VAWTQSPASSDHFVANFKEA 252

Query: 221 SQISCQALR-----NKN------LKVLAQAMNRQQGLLETLGVSDSKLS----------- 258
           SQ   Q  +     NK+        ++   + + Q L+  +G     LS           
Sbjct: 253 SQQEPQRYQEFLAENKDAVLALKTALIQDDVGQSQSLINKIGQQLDNLSHHLKLGILTPQ 312

Query: 259 -EIVWKLREQPHIMASKISGSGLGDCVIALG 288
            E +  L  Q +  A+K SG+G GDC IALG
Sbjct: 313 LETMISL-AQVYGYAAKSSGAGGGDCGIALG 342


>gi|224532360|ref|ZP_03672990.1| putative phosphomevalonate kinase [Borrelia burgdorferi WI91-23]
 gi|224512667|gb|EEF83038.1| putative phosphomevalonate kinase [Borrelia burgdorferi WI91-23]
          Length = 317

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTA-HAIVLKVQGISSGIDLAASIHGGLICYQ 163
            I   L  +          EI      A      GI SG D+A SI GG+I ++
Sbjct: 116 GIVCGLFLIHNATNVVEKGEIFKYCLEAYRYSQGGIGSGYDIATSIFGGVIEFE 169


>gi|195941506|ref|ZP_03086888.1| phosphomevalonate kinase, putative [Borrelia burgdorferi 80a]
 gi|225548958|ref|ZP_03769935.1| putative phosphomevalonate kinase [Borrelia burgdorferi 94a]
 gi|226320476|ref|ZP_03796042.1| putative phosphomevalonate kinase [Borrelia burgdorferi 29805]
 gi|225370561|gb|EEG99997.1| putative phosphomevalonate kinase [Borrelia burgdorferi 94a]
 gi|226234118|gb|EEH32833.1| putative phosphomevalonate kinase [Borrelia burgdorferi 29805]
 gi|312148975|gb|ADQ29046.1| phosphomevalonate kinase, putative [Borrelia burgdorferi N40]
          Length = 317

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTA-HAIVLKVQGISSGIDLAASIHGGLICYQ 163
            I   L  +          EI      A      GI SG D+A SI GG+I ++
Sbjct: 116 GIACGLFLIHNATNVVEKGEIFKYCLEAYRYSQGGIGSGYDIATSIFGGVIEFE 169


>gi|320591607|gb|EFX04046.1| mevalonate kinase [Grosmannia clavigera kw1407]
          Length = 495

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 98/400 (24%), Positives = 152/400 (38%), Gaps = 124/400 (31%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVIL----------YLTLRKDRL-----INID 54
           VSAPG +++ GEH V++G A++  AI  R  L           LTLR   +      NID
Sbjct: 11  VSAPGKVIVFGEHSVVYGKASIAAAIALRSYLLVTTLSKSKRTLTLRFPDVDMAHTWNID 70

Query: 55  -------SSLGQY------CGSLD----------LAMFHPSFSFIIMAINHIK------- 84
                  S+ G+         +LD          LA   PS S     ++          
Sbjct: 71  ELPWEIFSTPGKKKFYYDLVTTLDPDLLDALQPHLANVSPSKSEHERKVHQSSALSFLYL 130

Query: 85  ---------PSCGFDLKVISQLDSQLGLGSSAAITVAI-TAALLTLQYHKEPSPDEILTT 134
                    P C + L+  S +    GLGSS +I V + TA LL L+    P PD+    
Sbjct: 131 FLSLGSQKFPGCIYTLR--STIPIGAGLGSSGSIAVCMATALLLQLRTLSGPHPDQPSEE 188

Query: 135 AHAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKY----SIEKIDFIFP-I 178
           A   V ++            G  SG+D   S  G  + +Q   Y    S++ + + FP +
Sbjct: 189 ARLQVERINRWAFVAEMCIHGNPSGVDNTVSTQGKAVVFQRTDYGKPPSVKPL-WNFPEL 247

Query: 179 HLIYSGYKTP--TAQVLKKISYIEIEYPEI--------NEINQKIYALMGK--------- 219
            L+    K P  TA  + K++ ++  YPE+        + + +   +LM +         
Sbjct: 248 PLLLVNTKQPKSTAHEVAKVARLKKTYPELIGNVLDAMDSVARNAISLMDRGHGPESSDA 307

Query: 220 ------------------------------LSQISCQALRNKNLKVLAQAMNRQQGLLET 249
                                          SQ    A   ++L  L + M    GLL +
Sbjct: 308 DSKDSESKSKANSADNGASHDAAKGEANSDGSQSCFDATDLEDLGELGELMTINHGLLAS 367

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           LGVS  +L E V ++ +      +K++G+G G C I L K
Sbjct: 368 LGVSHPRL-ERVREIVDHAGFGWTKLTGAGGGGCSITLMK 406


>gi|326692554|ref|ZP_08229559.1| phosphomevalonate kinase [Leuconostoc argentinum KCTC 3773]
          Length = 343

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 137/331 (41%), Gaps = 64/331 (19%)

Query: 11  SAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDS--SLGQYCGSLDLA 67
           S PG L L GE+ +   GH A++ A    + L +T      +  +S  +   +  +  + 
Sbjct: 6   SVPGKLFLAGEYAITAPGHTAVIAATAMGLNLTVTDAPTSSVTSNSIATAWHFNMAEPIT 65

Query: 68  MFHPSFSFIIMAINHIKPSCGFD--LKVISQLD-----------SQLGLGSSAAITVAIT 114
           +    + ++  AI  ++    F+  L  +S ++            +LGLGSSAA+ V I 
Sbjct: 66  VGQDHWRYVQAAIKMLQDYTQFETTLPTLSDVNITIESDLNGPYGKLGLGSSAAVVVGII 125

Query: 115 AAL---LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
            AL    +L   ++ +  ++   AH  V K   +    D+AA  +GG+I YQ P  +   
Sbjct: 126 TALDAHFSLHLPRQ-TRFKLAGLAHYFVQKNGSLG---DIAAITYGGVIAYQSPDLA--- 178

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKK----ISYIEIEYPE------------------INEI 209
                   +I +  + PT + + +    ++   + +P                   I+++
Sbjct: 179 -------QVIDTAQQWPTPEAIARDWPALNITPLPWPNHWRLLLGATHESADTKSAIHQL 231

Query: 210 NQKIYALMGKLSQIS--CQALRNKNLKVLAQAMNRQQGLLET---LGVSDSKLSEIVWKL 264
           +     L      +S   QAL   +   L QA+   Q LL+T    G    KL+  +  L
Sbjct: 232 DLSTTFLTQSQQAVSRVIQALTTHDYSQLVQALQANQSLLQTHLPAGYVTPKLAHFLASL 291

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSL 295
            +    +A KISG+G GD   A+   D  +L
Sbjct: 292 NQ----VAGKISGAGYGDNGFAVVTDDAAAL 318


>gi|55820640|ref|YP_139082.1| phosphomevalonate kinase [Streptococcus thermophilus LMG 18311]
 gi|55736625|gb|AAV60267.1| phosphomevalonate kinase [Streptococcus thermophilus LMG 18311]
          Length = 331

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 142/315 (45%), Gaps = 38/315 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQ 59
           + Q ++++ V   G L + GE+ VL  G  AL+  I   + +   ++K +   + S +  
Sbjct: 2   LKQSVNQVTVKTGGKLYIAGEYSVLTPGQTALIQFIP--IFMSAEIKKAQTTQLTSDMFD 59

Query: 60  YCGSLDLAMFHPSFSFIIM--AINHIKPSCG-----FDLKVISQLDS---QLGLGSSAAI 109
           Y  S+D     P  ++ ++  A+N  +  CG      DL +  +L+    + G+GSS ++
Sbjct: 60  Y--SVDR---EPDVNYALIQDALNTFEAYCGENLPALDLSITGKLERDGVKFGIGSSGSV 114

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ-MPKYS 168
            V +T   L     K+ S D +   A   +LK     S  DLA  ++  L+ Y+   +  
Sbjct: 115 VV-LTLKALAASLQKDLSKDILFKLASYTLLKQGDNGSMGDLACIVYEDLVSYRSFDRAK 173

Query: 169 I-EKIDFIFPIHL--IYSGYK-TPTAQVLKK---ISYIE---IEYPEINEINQKIYALMG 218
           I E ID +    L  I  GY+ +P   VLK    + + +   I    +  +  +I +   
Sbjct: 174 IAELIDQMTLSELLEIDWGYRISPVVSVLKARFLVGWTKQAAISKDMVKMVKSRISSKYL 233

Query: 219 KLSQISCQ----ALRNKNLKVLAQAMNRQQGLLETLG--VSDSKLSEIVWKLREQPHIMA 272
             ++++ Q    AL   N  +L +++      LE+L   +   KL ++  K  EQ     
Sbjct: 234 SETEVAVQDAIKALETGNKNLLKRSLQTVSDQLESLSPDIYVDKLKKL--KEAEQGLDAI 291

Query: 273 SKISGSGLGDCVIAL 287
           +K SG+G GDC IA 
Sbjct: 292 AKSSGAGGGDCGIAF 306


>gi|15595032|ref|NP_212821.1| phosphomevalonate kinase, putative [Borrelia burgdorferi B31]
 gi|223889409|ref|ZP_03623995.1| putative phosphomevalonate kinase [Borrelia burgdorferi 64b]
 gi|226321385|ref|ZP_03796912.1| putative phosphomevalonate kinase [Borrelia burgdorferi Bol26]
 gi|2688614|gb|AAC67030.1| phosphomevalonate kinase, putative [Borrelia burgdorferi B31]
 gi|223885095|gb|EEF56199.1| putative phosphomevalonate kinase [Borrelia burgdorferi 64b]
 gi|226233181|gb|EEH31933.1| putative phosphomevalonate kinase [Borrelia burgdorferi Bol26]
          Length = 317

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKKID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTA-HAIVLKVQGISSGIDLAASIHGGLICYQ 163
            I   L  +          EI      A      GI SG D+A SI GG+I ++
Sbjct: 116 GIVCGLFLIHNATNVVEKGEIFKYCLEAYRYSQGGIGSGYDIATSIFGGVIEFE 169


>gi|171059923|ref|YP_001792272.1| galactokinase [Leptothrix cholodnii SP-6]
 gi|170777368|gb|ACB35507.1| galactokinase [Leptothrix cholodnii SP-6]
          Length = 387

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 132/328 (40%), Gaps = 54/328 (16%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD---- 65
           V APG + L+GEH   +    L  AI+   ++    R DRL+ + ++   Y   LD    
Sbjct: 25  VHAPGRVNLIGEHTDYNDGFVLPCAIDYHTLVAAQPRDDRLVRVVAA--DYGNKLDEFSL 82

Query: 66  -----------LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
                      +   +     + M ++H  P  G +L V   +    GL SSA++ VAI 
Sbjct: 83  DAPIKPLTAGDMGWANYVRGMVKMLLDHGLPLRGAELAVAGNVPQGAGLSSSASLEVAIG 142

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI------DLAASIHGGLI-CYQMPKY 167
            A  TLQ   E S  EI   A     +  GI+ GI         A+ H  LI C  +   
Sbjct: 143 QAFKTLQGFDELSATEIALLAQKAENRFVGINCGIMDQLISARGAAGHALLIDCRSLDAA 202

Query: 168 SIEKID--FIFPIH------LIYSGYKTPTAQVLKKISYIEIEYPEINEINQ-KIYALMG 218
            +   D   +  +H      L+ S Y T   Q      +  +  P + ++++ ++ A  G
Sbjct: 203 PVHLPDDVAVLIVHSRVKRGLVDSEYNTRRQQCEAAARHYGV--PALRDVDEARLLAERG 260

Query: 219 KLSQISCQALR---NKNLKVL----AQAMNRQQGLLETLGVSDSKLSE----IVWKLREQ 267
            L +   +  R    +N + L    A A N  + + E +  S + + +     V  + + 
Sbjct: 261 SLDERVFRRARHIVTENQRTLDAAEALAANDLRRMGELMAASHASMRDDFEITVPAIDQL 320

Query: 268 PHIM--------ASKISGSGLGDCVIAL 287
             I+         ++++G G G CV+AL
Sbjct: 321 VEILQGVIGTAGGARMTGGGFGGCVVAL 348


>gi|218249964|ref|YP_002375187.1| putative phosphomevalonate kinase [Borrelia burgdorferi ZS7]
 gi|218165152|gb|ACK75213.1| putative phosphomevalonate kinase [Borrelia burgdorferi ZS7]
          Length = 317

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKKID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTA-HAIVLKVQGISSGIDLAASIHGGLICYQ 163
            I   L  +          EI      A      GI SG D+A SI GG+I ++
Sbjct: 116 GIVCGLFLIHNATNVVEKGEIFKYCLEAYRYSQGGIGSGYDIATSIFGGVIEFE 169


>gi|307195155|gb|EFN77148.1| Galactokinase [Harpegnathos saltator]
          Length = 393

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 137/349 (39%), Gaps = 55/349 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL---RKDRLINIDSSLGQY---- 60
           +CV APG + L+GEH   +    L  A+    ++       ++ +++++  ++G+     
Sbjct: 29  VCVYAPGRVNLIGEHTDYNDGFVLPMALPMVTVIAGKSHDGQRMKIVSLSDTVGETNEVE 88

Query: 61  ---CGSLDLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
                  DL    P ++  +     N +     F   + S + +  GL SSAA+ VA   
Sbjct: 89  FEASSRADLKPGDPKWANYVKGCIANFVCDVPAFKAVIASTVPAGAGLSSSAALEVATYT 148

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGGLIC-----------YQ 163
            L  L   K   P+E             G+  GI D   S+ G   C            Q
Sbjct: 149 FLEALSGKKAEKPEEKALACQKAEHDFAGVPCGIMDQFISVMGKEGCALLLDCRDLAIKQ 208

Query: 164 MPKYSIEKIDFIF-------PIHLIYSGYKT------PTAQVLKKISYIEIEYPEI---- 206
           +P   ++  D++F       P  L  S Y          A++L K S  + +  +I    
Sbjct: 209 IPMLHMD--DYVFLITNSNAPHKLSSSAYCERRDCCYEAARMLNKKSLRDADMNDIRALT 266

Query: 207 --NEINQKIYALMGKLSQI-----SCQALRNKNLKVLAQAMN-RQQGLLETLGVSDSKLS 258
             N  ++ +      +++I     + +AL   +LK   + MN     L +   VS  +L 
Sbjct: 267 LQNAPDRGVKRARHIVTEIQRTLDAAEALERGDLKRFGRLMNDSHDSLRDDYEVSSKELD 326

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V   RE   ++ S+++G+G G C + L + +      Q    HM AK
Sbjct: 327 SLVSAAREVDGVLGSRLTGAGFGGCTVTLLRKNAVDRAIQ----HMTAK 371


>gi|325103381|ref|YP_004273035.1| galactokinase [Pedobacter saltans DSM 12145]
 gi|324972229|gb|ADY51213.1| galactokinase [Pedobacter saltans DSM 12145]
          Length = 384

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 140/343 (40%), Gaps = 77/343 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---------DSSLG 58
           I V +PG + L+GEH   +    L  AINK + + +  R D ++++          ++L 
Sbjct: 21  IVVCSPGRVNLIGEHTDYNMGFVLPAAINKGIYIAIKKRDDDVVSLIAADLNKKHQTTLK 80

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
            Y  S D     P  +FI+  ++ +    K   GF+  +   +    G+ SSAA+  A+ 
Sbjct: 81  DYKYSDD---NWP--NFILGVVDQLLKAGKHLSGFNAVISGDVPLGAGMSSSAALECAVA 135

Query: 115 AAL----------LTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHG------ 157
            +L          L+L    + + +E +           G+  GI D  AS+ G      
Sbjct: 136 FSLNHIFDLGLDKLSLVQKAQKAENEFV-----------GLQCGIMDQFASVFGKKKHVI 184

Query: 158 GLIC----YQMPKYSIEKI-----DFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINE 208
            L C    Y+   + IE I     D +    L  S Y    +Q  + +S I+  YP++  
Sbjct: 185 KLDCRSLEYEYVPFDIEGIKIVLFDSMVKHSLASSEYNVRRSQCEEGVSIIQQTYPQVKT 244

Query: 209 INQKIYALMGK-LSQIS--------------------CQALRNKNLKVLAQAM-NRQQGL 246
           +      ++   L   S                    C+ L++ +++   Q M +  +GL
Sbjct: 245 LRDATLEMVETCLKHTSADIYNRCKYVVEENDRLLKACEDLKHGDIESFGQKMYDTHEGL 304

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
            +   VS  +L  I    +++  I+ +++ G G G CVIAL K
Sbjct: 305 SKLYEVSCPELDFIAANAKKESAILGARMMGGGFGGCVIALVK 347


>gi|332026426|gb|EGI66554.1| Galactokinase [Acromyrmex echinatior]
          Length = 391

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 131/348 (37%), Gaps = 53/348 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAI-----------NKRVILYLTLRKDRLINIDSS 56
           +CV APG + L+GEH   +    L  A+           N +    L+L  D + NI+  
Sbjct: 29  VCVYAPGRVNLIGEHTDYNDGFVLPMALPMVTVIVGKSHNGKKTRILSL-SDVVGNINEF 87

Query: 57  LGQYCGSLDLAMFHPSFSFIIMA--INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
             +     D+    P ++  I     N I     F+  ++S + +  GL SSAA+ VA  
Sbjct: 88  EFEAGSRADIKPGEPKWANYIKGCIANFICDVPAFNAVIVSTVPAGAGLSSSAALEVATY 147

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHG-----------GLICY 162
             L TL   K   P+              G+  GI D   S  G            LI  
Sbjct: 148 TFLETLSGKKPEKPELKALACQKAEHNFAGVPCGIMDQFISTMGKEGYALLLDCRDLITK 207

Query: 163 QMPKYSIEKIDFIF-----PIHLIYSGYKT------PTAQVLKKISYIEIEYPEI----- 206
           Q+P   +    F+      P  L  S Y          A++L K S  +    +I     
Sbjct: 208 QIPMLHLNNYIFLITNSNTPHKLSSSAYCERRDCCYEAAKILGKKSLRDANMNDILALIS 267

Query: 207 ----NEINQKIYALMGKLSQI--SCQALRNKNLKVLAQAMNR-QQGLLETLGVSDSKLSE 259
                 I +K   ++ ++ +   +  AL   + +   + MN     L +   VS  +L  
Sbjct: 268 QNASESIVKKARHVITEIQRTLNAAVALEKNDFQQFGRLMNESHDSLRDDYEVSSKELDS 327

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +V   RE   ++ S+++G+G G C + L + D      Q    HM AK
Sbjct: 328 LVSAAREVDGVLGSRLTGAGFGGCTVTLLRKDAVDKTIQ----HMKAK 371


>gi|296821744|ref|XP_002850173.1| mevalonate kinase [Arthroderma otae CBS 113480]
 gi|238837727|gb|EEQ27389.1| mevalonate kinase [Arthroderma otae CBS 113480]
          Length = 447

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 145/357 (40%), Gaps = 84/357 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLI-------------NID 54
           VSAPG +++ GEH  ++   A+  AI+ R  L +T   +  R +             +ID
Sbjct: 7   VSAPGKVIVFGEHAAVYNKPAIAAAISLRSYLLVTTLSKSQRTVTLNFRDIHLHHTWSID 66

Query: 55  S---------SLGQY----CGSLD---LAMFHPSFSFIIMAIN------HIKPSCGFDLK 92
           S         S  Q+      SLD   LA   P  + + + +       H++ +  F L 
Sbjct: 67  SLPWHIFNLPSKKQFYHSRVESLDQDLLAAIEPHAAAVSVGLEEKQRKMHVRSATAF-LY 125

Query: 93  VISQLDSQ----------------LGLGSSAAITVAI-TAALLTLQYHKEPSPDEILTTA 135
           +   L SQ                 GLGSSA++ V + TA LL ++    P P++ +  A
Sbjct: 126 LFLSLGSQQSPGFVYTLRSTIPIGAGLGSSASVCVCLSTALLLQIRALAGPHPNQPVNEA 185

Query: 136 HAIVLKVQ-----------GISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FP---IH 179
              + ++            G  SG+D   S  G  + ++    +   +  +  FP     
Sbjct: 186 KDQIERINRWAFVGELCSHGDPSGVDNTVSSQGKAVLFRKNTNAPSSVTPLLKFPALRFL 245

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK----- 234
           L+ +  +  TA  ++K+  ++   P   E    +   +GKL++ +     + +       
Sbjct: 246 LVDTKQQRSTASQVEKVRALKESQPVTIE---SVLEAIGKLTESALDHFSSADFNGNGAA 302

Query: 235 ----VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
                L   +    GLL+ LGVS  +L E V +L +   +  +K++G+G G C I L
Sbjct: 303 GAIDSLGTLIRVNHGLLDALGVSHRRL-ERVRELADDAGVGWTKLTGAGGGGCAITL 358


>gi|50305147|ref|XP_452532.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641665|emb|CAH01383.1| KLLA0C07469p [Kluyveromyces lactis]
          Length = 419

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 105/238 (44%), Gaps = 26/238 (10%)

Query: 88  GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH----KEPSPDEILTTAHAIVLK-- 141
           G    V S L    GLGSSA+I+V +  A+  +  H    K  S +E     H   +   
Sbjct: 131 GLKFTVKSTLPIGAGLGSSASISVCLALAMARMGGHISCDKSISQEEKEFINHWAFIGEC 190

Query: 142 -VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI-----FPIHLIYSGYKTPTAQVLKK 195
            + G  SGID A + +G  + ++  +    K D I      P+ L  +  K  T  ++  
Sbjct: 191 CIHGTPSGIDNAVATYGNAVKFKRQEDGSTKFDQISNFPQLPMVLTNTRIKRSTKILVSG 250

Query: 196 ISYIEIEYPEINE-----INQKIYALMGK--LSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           +  +    P I E     +NQ   AL G   LS IS    ++ +   L + +    GLL 
Sbjct: 251 VGDLVNRKPLITEPILEAMNQ--VALRGSELLSDIS----KDIHYDELLELIRINHGLLV 304

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
            +GVS   L E++ +L ++  I  +K++G+G G C   L   D++    +  +  +H+
Sbjct: 305 AIGVSHPGL-EVIKQLSDELKIGQTKLTGAGGGGCAFTLLNKDVDHSSVRKFHEKLHS 361


>gi|309805047|ref|ZP_07699103.1| mevalonate kinase [Lactobacillus iners LactinV 09V1-c]
 gi|308165638|gb|EFO67865.1| mevalonate kinase [Lactobacillus iners LactinV 09V1-c]
          Length = 306

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 123/287 (42%), Gaps = 15/287 (5%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-L 64
            K+ V   G ++L+GEH V++G  A+   I+   I          I +D+   +Y G  L
Sbjct: 4   RKVIVKTHGKVILIGEHSVVYGKDAMALPIHALNIATSVEAYHDGIWMDTL--RYQGPYL 61

Query: 65  DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
                +     ++  I + I   C   +    ++  + GLGSSA + +  TA  L   + 
Sbjct: 62  TAPAEYNGLKHVVKKILSRIPTPCSIKITYTGEIPMERGLGSSAVVALG-TAKALNEYFA 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHL 180
            + + +EI    +       G +SG+D A      L+ +     PK   EK+     I  
Sbjct: 121 LKMTAEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLSEKLGATLLI-- 178

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           + +G    T + +  + Y +IE+   + + ++    +G L+  +      K+  ++    
Sbjct: 179 MDTGELGNTKEAVSSVKY-QIEH---DIVKKEAIDKLGYLADQTKDYWFKKDAPMVGTIF 234

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 235 NEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|111115520|ref|YP_710138.1| phosphomevalonate kinase, putative [Borrelia afzelii PKo]
 gi|110890794|gb|ABH01962.1| phosphomevalonate kinase, putative [Borrelia afzelii PKo]
          Length = 317

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 75/175 (42%), Gaps = 28/175 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEERGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEMD----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRNDFVFKMFAYLNQNCFFNLESFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP--SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ 163
            I   L  + Y+        EI           QG I SG D+A SI GG++ ++
Sbjct: 116 GIVCGLFFI-YNATNVVEKGEIFKYCLEAYRHSQGGIGSGYDIATSIFGGVVEFE 169


>gi|323342434|ref|ZP_08082666.1| mevalonate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463546|gb|EFY08740.1| mevalonate kinase [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 315

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 134/295 (45%), Gaps = 23/295 (7%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD----- 65
           SA G ++LMGEH V++G  A+        I        +   ID     Y G+L      
Sbjct: 8   SATGKIILMGEHSVVYGKPAIALPFASARIETRVDFHQKETTIDCLY--YQGALSSSPSV 65

Query: 66  LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
           +A      +  +  +N  K + G  + + S L  Q GLGSSAA++V++   L      K 
Sbjct: 66  IAGIKELITITLKFMN--KENYGLHISITSTLPPQRGLGSSAAVSVSVVRGL--FDAFKI 121

Query: 126 PSPDEILTTAHAIVLKVQGIS-SGIDLAASIHGGLICYQMPKY-SIEKIDFIFPIHLIYS 183
              DE L    ++  ++   + SG+D      G  + ++  K   + ++D    + +  +
Sbjct: 122 HLSDENLNYLVSVAERIHHSNPSGLDANTIAMGKPVFFERGKRGEVIEVDMDAILVVADT 181

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA---LRNKNLKVLAQAM 240
           G    T   + +++ +  + P+  E      +LM KL+ ++ +    L+ +N+  +   M
Sbjct: 182 GDSGQTRLAVSEVNAMLKDNPDYVE------SLMNKLADLTNETRVHLQTRNVGEVGNCM 235

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSL 295
           N    +L T+ VS+ KL  +   +  Q   + +K++GSG G C+IAL   + +S+
Sbjct: 236 NLAHEVLRTIRVSNEKLDHLT-AVALQEGALGAKLTGSGKGGCIIALCANESDSV 289


>gi|88604123|ref|YP_504301.1| mevalonate kinase [Methanospirillum hungatei JF-1]
 gi|88189585|gb|ABD42582.1| mevalonate kinase [Methanospirillum hungatei JF-1]
          Length = 289

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 126/291 (43%), Gaps = 42/291 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           SAPG + L GEH VL+    +  AI  RV  Y+T+RK    +                 H
Sbjct: 5   SAPGKVFLFGEHAVLYEKPGIALAIRPRV--YVTVRKTSHPH-----------------H 45

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL---LTLQYHKEPS 127
               +I            F +K    ++SQL   S    + A+T A    +  ++    S
Sbjct: 46  AKSPYIDQCFRE------FGVKGSVYINSQLPSSSGLGSSAAVTVATLAAINDEFDMGRS 99

Query: 128 PDEILTTAHAIVLKVQ-GISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
            ++I   A  I  KVQ G +S  D   S +GG+    + K    K       HL+    +
Sbjct: 100 KEQIAELAWKIEKKVQKGRASATDTTVSTYGGMF---LIKEGTRKRLAPQNYHLVIGNSQ 156

Query: 187 T--PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV-LAQAMNRQ 243
               T+++++K++ ++ ++P I      I  ++  +  I   A+++ +    L + M+  
Sbjct: 157 ISHSTSRMVEKVAEMKSKHPAI------INPVLDSIEAIVMDAMKHLDEPAYLGKLMDMN 210

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
             LLE LGV   +LS +V   R       +KI+G+G G C++AL   ++ +
Sbjct: 211 HCLLEMLGVGHPQLSRLVLAARST-GAFGAKITGAGGGGCMVALAPKNIRA 260


>gi|199598404|ref|ZP_03211823.1| Mevalonate kinase [Lactobacillus rhamnosus HN001]
 gi|258508493|ref|YP_003171244.1| mevalonate kinase [Lactobacillus rhamnosus GG]
 gi|199590723|gb|EDY98810.1| Mevalonate kinase [Lactobacillus rhamnosus HN001]
 gi|257148420|emb|CAR87393.1| Mevalonate kinase [Lactobacillus rhamnosus GG]
 gi|259649803|dbj|BAI41965.1| mevalonate kinase [Lactobacillus rhamnosus GG]
          Length = 311

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 124/295 (42%), Gaps = 51/295 (17%)

Query: 16  LVLMGEHGVLHGHAALVFAINK-RVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFS 74
           ++L+GEH V++G  A+   +   R+   +    D    + S+   + G L+      +F+
Sbjct: 12  IILIGEHAVVYGEPAIALPVKSIRLSAKVEPIPDGRQEVTSAF--FTGDLNAGQL-TNFA 68

Query: 75  FIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
            I M I  +         GF L + S L S+ G+GSSAA  VA+  A            D
Sbjct: 69  GIAMLIRRLLVFFNAADQGFHLTITSALPSERGMGSSAATAVAVVRAFY----------D 118

Query: 130 EILTT-AHAIVLKVQGIS--------SGIDLAAS--------IHG-GLICYQMPKYSIEK 171
              T+ +H+++L   GIS        SG+D A +        + G  L    MP+  +  
Sbjct: 119 AFQTSLSHSVLLNWAGISEKALHGNPSGLDAATASAEKPQWFVRGKSLRSIMMPRNGV-- 176

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-PEINEINQKIYALMGKLSQISCQALRN 230
              +     I    K    QV +K+      Y P I +I        G   + +  AL  
Sbjct: 177 --LLIADTGIAGQTKIAVDQVAQKLKKDPKTYQPLITDI--------GDAVRQAALALAQ 226

Query: 231 KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
            ++  L Q +NR Q  L  LGVS  +L  ++  +        +K++GSG+G C+I
Sbjct: 227 DDIITLGQLLNRDQADLAALGVSSPELDRLI-NVALDNGAYGAKLTGSGMGGCMI 280


>gi|290890630|ref|ZP_06553701.1| hypothetical protein AWRIB429_1091 [Oenococcus oeni AWRIB429]
 gi|290479758|gb|EFD88411.1| hypothetical protein AWRIB429_1091 [Oenococcus oeni AWRIB429]
          Length = 249

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 120/281 (42%), Gaps = 70/281 (24%)

Query: 13  PGSLVLMGEHGV-LHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           PG L+L GE+ V L  H ALVF+I            DR I+ + S               
Sbjct: 7   PGKLMLAGEYAVTLANHLALVFSI------------DRFISKNYS--------------- 39

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                               +++++   + GLGSS A  V     L+T   +   S  +I
Sbjct: 40  --------------------QLVNEKGVKYGLGSSGAYAV-----LMTKMENSSLSDKDI 74

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI--YSGYKTPT 189
              A  +  + Q  +SG D+AAS + GL+ Y+   +  E+I F    +LI  ++G    T
Sbjct: 75  FRQALILSRQTQPQNSGADIAASTYSGLLLYKNGSFP-ERIFFPENWNLIVGWTGKPAIT 133

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           ++++KK           N+++         + +     ++ K+ +   Q +   +  LE 
Sbjct: 134 SELVKK-----------NQLSSSFVKESDMIVRKMVDFIKAKDFEKFNQEIFLAEKNLEK 182

Query: 250 L-GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           L GV   KL++ + ++ +   I A KISG+G GD VIA  +
Sbjct: 183 LSGVLTDKLAKAI-EIAKNFGIEA-KISGAGGGDNVIAFTR 221


>gi|223934069|ref|ZP_03626019.1| phosphomevalonate kinase [Streptococcus suis 89/1591]
 gi|223897260|gb|EEF63671.1| phosphomevalonate kinase [Streptococcus suis 89/1591]
          Length = 359

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 76/176 (43%), Gaps = 21/176 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLH-GHAALVFAINK----------RVILYLTLRKDRLINIDS 55
           K+ V  PG L L GE+ V+  G+ A++ A+++          R +L+ + + D  +  + 
Sbjct: 2   KVQVKIPGKLFLAGEYAVVEAGYPAVIAAVDQYLTVTIETSDRGLLHSSQQADLYLTWER 61

Query: 56  SLG--QYCGSLDLAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQL-----GLGSS 106
             G     G    A+   +       +     +C   + L V S LD Q      GLGSS
Sbjct: 62  KEGIAHVQGDHPYALIETAMQVTEAYLTAKGYACHGTYSLAVQSDLDDQTSGAKYGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
            A+TVA   ALLT   H+ P        A     K+    S  DLAAS  GGLI Y
Sbjct: 122 GAVTVATVKALLTYYGHR-PGALLAYKLAALAQTKLGMTGSFGDLAASSFGGLIAY 176


>gi|289740201|gb|ADD18848.1| mevalonate kinase [Glossina morsitans morsitans]
          Length = 393

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 108/222 (48%), Gaps = 17/222 (7%)

Query: 80  INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL------LTLQYHKEPSPDEILT 133
           +   K + GF L + ++L+   GLGSSA+  VA+ AA         L  +++P    +++
Sbjct: 135 VKDFKITNGFRLHIDTELNIGSGLGSSASYGVALAAAFLLYARHFDLSSYQDPQNLALIS 194

Query: 134 T-AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIH--LIYSGYKTPTA 190
             A      V G  SG+D     +GG++ + +     + I+ + P++  L+ S  K  TA
Sbjct: 195 NWAFESERIVHGTPSGVDNTICSYGGMLRF-VKGQGFQTINIVRPLNILLVDSKVKRSTA 253

Query: 191 QVLKKISYIEIEYPE-INEINQKIYALMGK---LSQISCQALRN-KNLKVLAQAMNRQQG 245
            ++ K+ ++   +PE IN I   + AL+ +   L +I   +  + +  + L +       
Sbjct: 254 DIVAKVRHLSETFPEVINAIWDALEALVTEAIPLYEIFGNSQDDSEKFEKLERLFQINND 313

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           LL+ +GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 314 LLKAIGVSHPKLEQIFSIAYKRGFF--SKVTGAGAGGYVIVL 353


>gi|329947850|ref|ZP_08294782.1| phosphomevalonate kinase [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328523474|gb|EGF50572.1| phosphomevalonate kinase [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 378

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 79/196 (40%), Gaps = 49/196 (25%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLT---------------------- 44
           I  SAPG L + GE+ V+  GH A++ A+++ + + +T                      
Sbjct: 2   ISQSAPGKLYIAGEYAVVEPGHQAVLVAVDRFITVRITEAEADGSTGPTGHISSTLYEAQ 61

Query: 45  ------LRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCG----FDLKVI 94
                   +D ++ ++     Y             S I M    ++ + G    FDL V 
Sbjct: 62  SLTWYRRPEDGVVEVEKQFNDYV-----------VSAIRMVEQMVREAGGRLRYFDLDVS 110

Query: 95  SQLDS----QLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGID 150
           S+LD     +LGLGSS+A+TVA   A+    Y        +   A      VQ I SG D
Sbjct: 111 SELDDGSGHKLGLGSSSAVTVATVRAVARF-YGLALDDMAVYKLALLATDAVQPIGSGGD 169

Query: 151 LAASIHGGLICYQMPK 166
           +AAS   G + Y  P 
Sbjct: 170 IAASSFTGWVAYTSPD 185


>gi|216263527|ref|ZP_03435522.1| putative phosphomevalonate kinase [Borrelia afzelii ACA-1]
 gi|215980371|gb|EEC21192.1| putative phosphomevalonate kinase [Borrelia afzelii ACA-1]
          Length = 317

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 75/175 (42%), Gaps = 28/175 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEERGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRNDFVFKMFAYLNQNCFFNLESFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP--SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ 163
            I   L  + Y+        EI           QG I SG D+A SI GG++ ++
Sbjct: 116 GIVCGLFFI-YNATNVVEKGEIFKYCLEAYRHSQGGIGSGYDIATSIFGGVVEFE 169


>gi|259047797|ref|ZP_05738198.1| phosphomevalonate kinase [Granulicatella adiacens ATCC 49175]
 gi|259035474|gb|EEW36729.1| phosphomevalonate kinase [Granulicatella adiacens ATCC 49175]
          Length = 369

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 153/373 (41%), Gaps = 85/373 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD- 65
           I   APG L + GE+ V+  GH A+V A+++    YLT+     I++ +S+G    + + 
Sbjct: 12  ITSKAPGKLFIAGEYAVVEPGHGAIVAAVSR----YLTV----TIDVTTSVGTLTSTQNP 63

Query: 66  --------------LAMFHPSF---SFIIMAINHIKPSCG------FDLKVISQLDS--- 99
                         +   HP       I++A  +++  CG      + L + S+LD    
Sbjct: 64  DINVEWAREGELFHIKADHPYRLVEEAILVAEQYVR-ECGTPTNALYSLSITSELDDAKR 122

Query: 100 --QLGLGSSAAITVAITAALLTLQYHKEPSPDEI--LTTAHAIVLKVQGISSGIDLAASI 155
             + GLGSS A+ VA   A+L   Y    +P  +  L+    ++L  +G  S  D+AAS 
Sbjct: 123 GIKYGLGSSGAVVVATIQAVLDF-YETPRTPLLVYKLSVLTNLLLSQRG--SFGDIAASS 179

Query: 156 HGGLICY----------QMPKYSIEKI-DFIF-----------PIHLIYSGYKTPTA--- 190
            GGL+ Y          Q+ K SI+ I D ++           P   +  G+    A   
Sbjct: 180 FGGLVYYTSPDRSDLLEQLQKQSIKDICDAVWKDLTIVRLPEIPNFTLLVGWTGKVAITD 239

Query: 191 ---QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
              Q  +K   +  +     E   K +A++  L QI   A   +++  L + +   + LL
Sbjct: 240 SLIQATEKKRKVATDSVFYKEFLTKSHAIVQDL-QI---AWNKQDIPALQEGIRANRALL 295

Query: 248 ETLGVS-----DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC 302
                      ++   + +  L EQ    A K SG+G GDC I   +   N    Q +  
Sbjct: 296 NQFAKVMQLEIETPALQTLCDLAEQNGACA-KTSGAGGGDCGICFTQ---NEQQRQQIET 351

Query: 303 HMHAKGIDIVPIT 315
                 I ++P+T
Sbjct: 352 QWAHAQIQVLPLT 364


>gi|281490948|ref|YP_003352928.1| phosphomevalonate kinase [Lactococcus lactis subsp. lactis KF147]
 gi|281374706|gb|ADA64226.1| Phosphomevalonate kinase [Lactococcus lactis subsp. lactis KF147]
          Length = 329

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 141/333 (42%), Gaps = 46/333 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVL-HGHAALVFAI--NKRVILYLTLRKDRLINIDSSLGQYCG 62
            K+ +  PG L   GE+ V   G+ AL+  I  N  V +  T  K  +   +  L  +  
Sbjct: 6   KKMTIKVPGKLFFAGEYSVTKEGNLALITTIETNFEVRISATTGKS-IFKTNVGLSDFEF 64

Query: 63  SLDLAMFHPS--FSFIIMAI-NHIKPSCGFDLKVISQL------------------DSQL 101
           SL    F     ++F + A+ N +  +  F+ K +S++                  +++ 
Sbjct: 65  SLSKIEFTKENPWNFALTALKNTLSAADSFEKKSVSKILSSSPEISLEIVSDLGFGENKK 124

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           G GSSA++   +  A+    +  + S ++    A     +VQG  S  D+AA ++GG + 
Sbjct: 125 GYGSSASVVCGLVNAVNQF-FDFQLSLEKRFEIAAKTHFEVQGSGSMGDIAAIMYGGSVF 183

Query: 162 YQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS 221
           YQ  K  I       P+ + ++ Y   T +  K    I+I      +++ + Y    +L 
Sbjct: 184 YQNHKRVI-------PLEIPWATYVVQTGKAAKTSEKIKI------KLSDEFYQASNELV 230

Query: 222 QISCQALRNKNLKVLAQAMNRQQ-GLLETL--GVSDSKLSEIVWKLREQPHIMASKISGS 278
                A+  ++  +  + ++  Q  LLE +  G    +L+  +  L   P   A+KISG+
Sbjct: 231 IELATAIDIQDFALFKEKLSENQLLLLENIPEGYMTKELAIALNLLNSYPE-FAAKISGA 289

Query: 279 GLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI 311
           G G+ +I   +   N+     V   +   GI++
Sbjct: 290 GFGENIILFAQ---NTQAIAEVQNKLSEYGINL 319


>gi|216264309|ref|ZP_03436301.1| putative phosphomevalonate kinase [Borrelia burgdorferi 156a]
 gi|221217941|ref|ZP_03589408.1| putative phosphomevalonate kinase [Borrelia burgdorferi 72a]
 gi|224533282|ref|ZP_03673876.1| putative phosphomevalonate kinase [Borrelia burgdorferi CA-11.2a]
 gi|225549960|ref|ZP_03770921.1| putative phosphomevalonate kinase [Borrelia burgdorferi 118a]
 gi|215980782|gb|EEC21589.1| putative phosphomevalonate kinase [Borrelia burgdorferi 156a]
 gi|221192247|gb|EEE18467.1| putative phosphomevalonate kinase [Borrelia burgdorferi 72a]
 gi|224513447|gb|EEF83804.1| putative phosphomevalonate kinase [Borrelia burgdorferi CA-11.2a]
 gi|225369419|gb|EEG98871.1| putative phosphomevalonate kinase [Borrelia burgdorferi 118a]
          Length = 317

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYTILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQ---LDS---------QLGLGSSAAITV 111
            D ++      F+     ++  +C F+L+  +    +D+         + G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLENFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ 163
            I   L  +          EI           QG I SG D+A SI GG+I ++
Sbjct: 116 GIVCGLFLIHNATNVVEKGEIFKYCLEAYRHSQGGIGSGYDIATSIFGGVIEFE 169


>gi|45190937|ref|NP_985191.1| AER335Wp [Ashbya gossypii ATCC 10895]
 gi|44984005|gb|AAS53015.1| AER335Wp [Ashbya gossypii ATCC 10895]
          Length = 428

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 82/363 (22%), Positives = 142/363 (39%), Gaps = 76/363 (20%)

Query: 1   MGQCLHKICV--------SAPGSLVLMGEHGVLHGHAALVFAINK-RVILYL-------- 43
           MGQ +  IC         SAPG +++ GEH  ++   A+  +++  R  L++        
Sbjct: 1   MGQPMTVICTGELLPFITSAPGKVIIFGEHSAVYNKPAIAASVSSLRTYLFVEADAESDA 60

Query: 44  ------------TLRKDRLINI--DSSLGQYCG-SLDLAMF----------------HPS 72
                       + + + L  +  ++ +  +C   LD  +                 H +
Sbjct: 61  VRMEFPDIGFQYSWKHEALTAVPREAVVRAFCSRELDAEVLAHVDRLLMGLEGALARHAA 120

Query: 73  FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEIL 132
             F+ +     +   G    V S L    GLGSSA+I V +  A+  L  H +     + 
Sbjct: 121 LCFLYIYTCLCREVQGVRFTVKSTLPIGAGLGSSASIAVCLALAMGRLGGHVQCESGALT 180

Query: 133 TTAHAIVLK--------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FP-IHLI 181
                 V +        + G  SGID A + +G  + +Q       K D +  FP + +I
Sbjct: 181 KEQQDFVNRWALVGEQCIHGTPSGIDNAVATYGDAVLFQRQPDGSTKFDHLSDFPQMPMI 240

Query: 182 YSGYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA------LRNKNL 233
            +  K P  T  ++  +  +  + P I         ++  ++Q+  QA      L+  + 
Sbjct: 241 LTNTKVPKSTKVLVANVGKLVEQEPLITA------PILNTMAQVVTQAHELLPLLQGDDT 294

Query: 234 --KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
               L Q +    GLL  LGVS   L E V  L +   I A+K++G+G G C + L K D
Sbjct: 295 VYTRLLQLVRINHGLLVALGVSHPSL-EHVRALCDTLGIGATKLTGAGGGGCALTLLKRD 353

Query: 292 LNS 294
           +  
Sbjct: 354 VED 356


>gi|309806243|ref|ZP_07700257.1| mevalonate kinase [Lactobacillus iners LactinV 03V1-b]
 gi|308167390|gb|EFO69555.1| mevalonate kinase [Lactobacillus iners LactinV 03V1-b]
          Length = 288

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 122/288 (42%), Gaps = 17/288 (5%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-L 64
            K+ V   G ++L+GEH V++G  A+   I+   I          I +D+   +Y G  L
Sbjct: 4   RKVIVKTHGKVILIGEHSVVYGKDAMALPIHALNIATSVEAYHDGIWMDTL--RYQGPYL 61

Query: 65  DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
                +     ++  I + I   C   +    ++  + GLGSSA + +  TA  L   + 
Sbjct: 62  TAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG-TARALNEYFA 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHL 180
            + + +EI    +       G +SG+D A      L+ +     PK   EK+     I  
Sbjct: 121 LKMTSEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLSEKLGATLLI-- 178

Query: 181 IYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           + +G    T + +  + Y IE +  +   I++     +G L+  +      K+  ++   
Sbjct: 179 MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYWFKKDAPMVGTI 233

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 234 FNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|118488329|gb|ABK95983.1| unknown [Populus trichocarpa]
          Length = 387

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 144/348 (41%), Gaps = 81/348 (23%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN-----------------------KRVILYLTLRKD 48
           APG ++L GEH V+HG  A+  +I                        K + L  +    
Sbjct: 7   APGKIILSGEHAVVHGSTAVAASIGLCTYVSLQVPPSNENDDRLTLQLKDMALEFSWPIG 66

Query: 49  RLINIDSSLG-------QYCGS-------------------LDLAMFHPSFSFIIMAINH 82
           R+    SSLG         C +                   + LA    +F ++  +I  
Sbjct: 67  RIKEALSSLGGPFPSTPTSCSAESFKLILALIEEQNILEEKISLASGVSAFLWLYTSILG 126

Query: 83  IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPDEILTTAHAI 138
           IKP+    + V S L    GLGSSAA+ VA +AALL    T+    +     +   +   
Sbjct: 127 IKPA---TVVVTSDLPLGSGLGSSAALCVAFSAALLACSDTVNIDMKQEGWLVFGESELE 183

Query: 139 VLK---------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT-- 187
           +L          + G  SGID   S +G +I ++    ++ +I    P+ ++ +  K   
Sbjct: 184 LLNKWAFEGEKIIHGKPSGIDNTVSTYGNMIKFR--SGNLTRIKSSMPLKMLITNTKVGR 241

Query: 188 PTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR---- 242
            T  ++  +S   +  P+ ++ +   + ++  +L+ +  Q   + +L + A+        
Sbjct: 242 NTKALVAGVSERTLRNPDAMSSVFNAVDSISKELANV-IQTPASDDLSITAKEEKLEELM 300

Query: 243 --QQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVIAL 287
               GLL+ +GVS + +  +   LR    + +ASK++G+G G CV+ L
Sbjct: 301 EMNHGLLQCMGVSHASIETV---LRTTLKYKLASKLTGAGGGGCVLTL 345


>gi|15672388|ref|NP_266562.1| mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|12723280|gb|AAK04504.1|AE006277_4 mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|326405982|gb|ADZ63053.1| phosphomevalonate kinase [Lactococcus lactis subsp. lactis CV56]
          Length = 329

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 141/333 (42%), Gaps = 46/333 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVL-HGHAALVFAI--NKRVILYLTLRKDRLINIDSSLGQYCG 62
            K+ +  PG L   GE+ V   G+ AL+  I  N  V +  T  K  +   +  L  +  
Sbjct: 6   KKMSIKVPGKLFFAGEYSVTKEGNLALITTIETNFEVRISATTGKS-IFKTNVGLSDFEF 64

Query: 63  SLDLAMFHPS--FSFIIMAI-NHIKPSCGFDLKVISQL------------------DSQL 101
           SL    F     ++F + A+ N +  +  F+ K +S++                  +++ 
Sbjct: 65  SLSKIEFTKENPWNFALTALKNTLSAADSFEKKSVSKILSSSPEISLEIVSDLGFGENKK 124

Query: 102 GLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC 161
           G GSSA++   +  A+    +  + S ++    A     +VQG  S  D+AA ++GG + 
Sbjct: 125 GYGSSASVVCGLVNAVNQF-FDFQLSLEKRFEIAAKTHFEVQGSGSMGDIAAIMYGGSVF 183

Query: 162 YQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS 221
           YQ  K  I       P+ + ++ Y   T +  K    I+I      +++ + Y    +L 
Sbjct: 184 YQNHKRVI-------PLEIPWATYVVQTGKAAKTSEKIKI------KLSDEFYQASNELV 230

Query: 222 QISCQALRNKNLKVLAQAMNRQQ-GLLETL--GVSDSKLSEIVWKLREQPHIMASKISGS 278
                A+  ++  +  + ++  Q  LLE +  G    +L+  +  L   P   A+KISG+
Sbjct: 231 IELATAIDIQDFALFKEKLSENQLLLLENIPEGYMTKELAIALNLLNSYPE-FAAKISGA 289

Query: 279 GLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI 311
           G G+ +I   +   N+     V   +   GI++
Sbjct: 290 GFGENIILFAQ---NTQAIAEVQNKLSEYGINL 319


>gi|78707210|ref|NP_001027412.1| CG33671 [Drosophila melanogaster]
 gi|7303424|gb|AAF58481.1| CG33671 [Drosophila melanogaster]
 gi|16767914|gb|AAL28175.1| GH04687p [Drosophila melanogaster]
 gi|220944910|gb|ACL84998.1| CG33671-PA [synthetic construct]
 gi|220954802|gb|ACL89944.1| CG33671-PA [synthetic construct]
          Length = 390

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 94/219 (42%), Gaps = 25/219 (11%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKV---- 142
            GF ++V SQL    GLGSSA+   A+    L L  H +   D  L+ A+  ++      
Sbjct: 137 TGFQVQVDSQLTVGAGLGSSASFGAALATTFLILAGHFD--RDSYLSEANQALISSWAYE 194

Query: 143 -----QGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKI 196
                 G  SG+D     +GG++ Y +   +   KI     I L+ S     TA ++ K+
Sbjct: 195 SERVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLKIQKPLNILLVDSRVSRSTADIVAKV 254

Query: 197 SYIEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            ++   +P++         E+      L          + + + L+ L Q  N    LL+
Sbjct: 255 RHLGDAFPQLIEAIWQACEELVAAAVPLYESFGNAQDDSSKFEQLERLFQINND---LLK 311

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 312 AIGVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 348


>gi|225551787|ref|ZP_03772730.1| putative phosphomevalonate kinase [Borrelia sp. SV1]
 gi|225371582|gb|EEH01009.1| putative phosphomevalonate kinase [Borrelia sp. SV1]
          Length = 317

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 69/174 (39%), Gaps = 26/174 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKD---RLINIDSSLGQYCGS 63
           I  S PG+L+LMGE+ +L      L  AINKR   + + +K    R  +    +      
Sbjct: 4   ISFSVPGNLLLMGEYAILEEKGLGLAIAINKRA--FFSFKKSDSWRFFSKKKEID----- 56

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDL------------KVISQLDSQLGLGSSAAITV 111
            D ++      F+     ++  +C F+L                   ++ G GSSA + +
Sbjct: 57  -DFSLIENRSDFVFKMFAYLSQNCFFNLGNFAYDVYIDTSNFFFNDGTKKGFGSSAVVAI 115

Query: 112 AITAALLTLQYHKEP-SPDEILTTAHAIVLKVQG-ISSGIDLAASIHGGLICYQ 163
            I   L  +          EI           QG I SG D+A SI GG+I ++
Sbjct: 116 GIACGLFLVHNATNVVEKGEIFKYCLEAYRHSQGGIGSGYDIATSIFGGVIEFE 169


>gi|169859430|ref|XP_001836355.1| cystathionine beta-lyase [Coprinopsis cinerea okayama7#130]
 gi|116502644|gb|EAU85539.1| cystathionine beta-lyase [Coprinopsis cinerea okayama7#130]
          Length = 914

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/365 (21%), Positives = 142/365 (38%), Gaps = 86/365 (23%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID-SSLGQYCGSLDLAM 68
           VSAPG ++L GEH V+HG  A+  +++ R     T R D  ++     LG +    D+  
Sbjct: 448 VSAPGKVILFGEHAVVHGVTAIAASVDLRCYGLTTPRTDNKLSAHFKDLGNFYHEWDIDS 507

Query: 69  F-------------HP-------------------------------SFSFIIMAINHIK 84
                         HP                               +F ++ M +   +
Sbjct: 508 LPWDALTPIPPGEEHPEELDQRLIEALSQSVLAELGDENKQARAATLAFLYLYMTLARGQ 567

Query: 85  PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL------LTLQYHKEPSPDEILTTAH-- 136
               F+    + L    GLGSSA+ +     AL      +++     PS +  +  +H  
Sbjct: 568 HRPSFNFTARATLPVGAGLGSSASFSACAATALLLLHRRISVPAKPAPSTETHIHVSHEG 627

Query: 137 ---------------AIVLK--VQGISSGIDLAASIHGGLICYQMPKY----SIEKIDFI 175
                          A V +  + G  SG+D + ++ GG + Y  P +     +E+I   
Sbjct: 628 RRALPASVAEDVNRWAFVAEKILHGNPSGVDNSVAVFGGALAYTRPGFGKKGGMEQIQGF 687

Query: 176 FPIHLIYSGYKTP--TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL----- 228
             +  + +  + P  T +++  +   +   PE+  +N  I A +  +S  + +AL     
Sbjct: 688 KSLKFLLTNSQVPRDTKKLVAGVGEKKENEPEL--VN-GILAAIQSISDEARRALADPEL 744

Query: 229 -RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            R+  L  L + +      L TLGVS   L +I  K  E P+ + +K++G+G G C + L
Sbjct: 745 SRDALLSALQELIKENHDHLVTLGVSHPSLEKIREKTSE-PYGLKTKLTGAGGGGCAVTL 803

Query: 288 GKGDL 292
              D 
Sbjct: 804 IPDDF 808


>gi|312872991|ref|ZP_07733051.1| mevalonate kinase [Lactobacillus iners LEAF 2062A-h1]
 gi|311091513|gb|EFQ49897.1| mevalonate kinase [Lactobacillus iners LEAF 2062A-h1]
          Length = 306

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 122/288 (42%), Gaps = 17/288 (5%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-L 64
            K+ V   G ++L+GEH V++G  A+   I+   I          I +D+   +Y G  L
Sbjct: 4   RKVIVKTHGKVILIGEHSVVYGKDAMALPIHALNIATSVEAYHDGIWMDTL--RYQGPYL 61

Query: 65  DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
                +     ++  I + I   C   +    ++  + GLGSSA + +  TA  L   + 
Sbjct: 62  TAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG-TAKALNEYFA 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHL 180
            + + +EI    +       G +SG+D A      L+ +     PK   EK+     I  
Sbjct: 121 LKMTSEEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLSEKLGATLLI-- 178

Query: 181 IYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           + +G    T + +  + Y IE +  +   I++     +G L+  +      K+  ++   
Sbjct: 179 MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYWFKKDAPMVGTI 233

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 234 FNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|260890996|ref|ZP_05902259.1| mevalonate kinase [Leptotrichia hofstadii F0254]
 gi|260859023|gb|EEX73523.1| mevalonate kinase [Leptotrichia hofstadii F0254]
          Length = 257

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 94/211 (44%), Gaps = 12/211 (5%)

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTT-AHAIVLKV 142
           K +     KV SQ+  + G+GSSAA+++A   A+    Y +E   DE+L    H   +  
Sbjct: 29  KENAKIKYKVTSQIPPKRGMGSSAAVSIAAIRAVF--DYFEENLDDELLEKLVHMAEIVA 86

Query: 143 QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTPTAQVLKKISYIE 200
               SG+D    +    I + +       ID     +L+   +G    T   ++K+  + 
Sbjct: 87  HSTPSGLDAKTCLSNKAIKF-IKNKGFSYIDLNLDAYLVIADTGIYGNTGDAIQKVKNL- 144

Query: 201 IEYPEINEINQKIYALMGKLSQISCQALRNKNLKV--LAQAMNRQQGLLETLGVSDSKLS 258
                 +    K+  L  ++++I  + + +K  KV  + + M +    L  L ++  K +
Sbjct: 145 --GSNADSSLNKLGELTDEMAKILTENIESKEEKVHKIGKIMTKANIELRNLNITIEK-T 201

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           ++  K   +     +KISG GLG CVIAL K
Sbjct: 202 DLFVKTAIENGASGAKISGGGLGGCVIALAK 232


>gi|195582823|ref|XP_002081225.1| GD25827 [Drosophila simulans]
 gi|194193234|gb|EDX06810.1| GD25827 [Drosophila simulans]
          Length = 391

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 94/219 (42%), Gaps = 25/219 (11%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKV---- 142
            GF ++V SQL    GLGSSA+   A+    L L  H +   D  L+ A+  ++      
Sbjct: 138 TGFQVQVDSQLTVGAGLGSSASFGAALATTFLILAGHFD--RDSYLSEANQALISSWAYE 195

Query: 143 -----QGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKI 196
                 G  SG+D     +GG++ Y +   +   KI     I L+ S     TA ++ K+
Sbjct: 196 SERVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLKIQKPLNILLVDSRVSRSTADIVAKV 255

Query: 197 SYIEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            ++   +P++         E+      L          + + + L+ L Q  N    LL+
Sbjct: 256 RHLGEAFPQLIEAIWQACEELVAAAVPLYESFGNAQDDSSKFEQLERLFQINND---LLK 312

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 313 AIGVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 349


>gi|47200914|emb|CAF88123.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 173

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 60/126 (47%), Gaps = 23/126 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHA-------ALVFAINKRVILYLTLRKD-----RLINIDS 55
           I VSAPG  +L GEH V+HG         AL  ++N R  L L           L NID+
Sbjct: 1   IYVSAPGKAILHGEHAVVHGKVTSNKAKMALAVSLNLRSYLRLEATSTGTVGVNLPNIDT 60

Query: 56  SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCG---FDLKVISQLDSQLGLGSSAAITVA 112
            L  +    +L  F PS S       + + + G     + V S+L +  GLGSSAA TV 
Sbjct: 61  FL--HWNLSELKQFAPSVS------GNEQLTLGAAQLTVSVWSELPTGAGLGSSAAYTVC 112

Query: 113 ITAALL 118
           + AALL
Sbjct: 113 LAAALL 118


>gi|319940311|ref|ZP_08014662.1| mevalonate kinase [Streptococcus anginosus 1_2_62CV]
 gi|319810498|gb|EFW06837.1| mevalonate kinase [Streptococcus anginosus 1_2_62CV]
          Length = 292

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 132/280 (47%), Gaps = 28/280 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC-GSLDLAMFH 70
           A   ++L+GEH V++G+ AL   +    +        R++  D +   Y   +L +A+F 
Sbjct: 10  AHSKIILIGEHAVVYGYPALALPLTNIEV------TGRILPSDHAWILYEEDTLSMAVF- 62

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
            S  F+ +   +I+  C    ++ S +  + G+GSSAA+++A   A+    Y ++   + 
Sbjct: 63  ASLEFLGVQEAYIR--C----EIESMVPEKRGMGSSAAVSIAAIRAVFDY-YEQDLDRET 115

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY--SGYKTP 188
           +   A+   +      SG+D    +    I + +      + +     +L+   +G    
Sbjct: 116 LEILANRAEMIAHMNPSGLDAKTCLSDRAIKF-IKNVGFSEFETNLGAYLVIADTGIYGH 174

Query: 189 TAQVLKKISYIEIE-YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
           T + ++++  + +   P +++        +GKL+    +AL+ K+L+ +  AM+     L
Sbjct: 175 TREAIQEVEQLGMTALPHLHQ--------LGKLTNEVEEALKVKDLERIGIAMSEAHLSL 226

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + LGVS  +   +V   +E    + +K+SG GLG C+IAL
Sbjct: 227 KNLGVSCPEADRLVATAQENG-ALGAKMSGGGLGGCIIAL 265


>gi|195333836|ref|XP_002033592.1| GM20348 [Drosophila sechellia]
 gi|194125562|gb|EDW47605.1| GM20348 [Drosophila sechellia]
          Length = 391

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 94/219 (42%), Gaps = 25/219 (11%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKV---- 142
            GF ++V SQL    GLGSSA+   A+    L L  H +   D  L+ A+  ++      
Sbjct: 138 TGFQVQVDSQLTVGAGLGSSASFGAALATTFLILAGHFD--RDSYLSEANQALISSWAYE 195

Query: 143 -----QGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKI 196
                 G  SG+D     +GG++ Y +   +   KI     I L+ S     TA ++ K+
Sbjct: 196 SERVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLKIQKPLNILLVDSRVTRSTADIVAKV 255

Query: 197 SYIEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            ++   +P++         E+      L          + + + L+ L Q  N    LL+
Sbjct: 256 RHLGEAFPQLIEAIWQACEELVAAAVPLYESFGNAQDDSSKFEQLERLFQINND---LLK 312

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 313 AIGVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 349


>gi|194883578|ref|XP_001975878.1| GG22565 [Drosophila erecta]
 gi|190659065|gb|EDV56278.1| GG22565 [Drosophila erecta]
          Length = 390

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 93/219 (42%), Gaps = 25/219 (11%)

Query: 87  CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKV---- 142
            GF ++V SQL    GLGSSA+   A+    L L  H +   D  L  A+  ++      
Sbjct: 137 TGFQVQVDSQLTVGAGLGSSASFGAALATTFLILAGHFD--RDSYLAEANQALISTWAFE 194

Query: 143 -----QGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKI 196
                 G  SG+D     +GG++ Y +   +   KI     I L+ S     TA ++ K+
Sbjct: 195 SERVNHGTPSGLDNTVCTYGGMLRYVKGQGFQSLKIQKPLNILLVDSRVSRSTADIVAKV 254

Query: 197 SYIEIEYPEI--------NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
            ++   +P++         E+      L          + + + L+ L Q  N    LL+
Sbjct: 255 RHLGEAFPQLIEAIWHACEELVIAAVPLYESFGNAQDDSAKFEQLERLFQINND---LLK 311

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            +GVS  KL +I     ++     SK++G+G G  VI L
Sbjct: 312 AIGVSHPKLEQIFTIAFKRGFF--SKLTGAGAGGYVIVL 348


>gi|312148080|gb|ADQ30739.1| mevalonate kinase [Borrelia burgdorferi JD1]
          Length = 297

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 124/285 (43%), Gaps = 32/285 (11%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           +  P  ++ +GEH  ++G       I   V +Y+ L     I   S   +Y G     + 
Sbjct: 4   IRKPAKILFLGEHSAVYGFPV----IGATVPIYMDL-----IYSVSKNWKYLGKPSTRL- 53

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
           +   SFI+   + + P    +  +IS++   +GLGSSA++++     + +   H E    
Sbjct: 54  NSLISFIVSNYSKVNP---IEFDIISEIPIGVGLGSSASLSLCFAEYITS---HFEYKDC 107

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
             +  A+ I     G SSG+D+       LI      Y  +K + +    + YSG+    
Sbjct: 108 NKILLANQIENIFHGKSSGMDIR------LIDLNGTFYLEKKENVLHSKKIKYSGFYFLI 161

Query: 190 AQVLKKISYIEIEYPEINEI--NQKIYALMGKLS---QISCQALRNKNLKVLAQAMNRQQ 244
             + + ++  EI      ++  N  ++  + KL      S  + +NK++  LA  MN  Q
Sbjct: 162 GAIKRDLTTKEIVVNLKKDLLSNAYLFVFIEKLGLAVSNSYASFQNKDVYSLANEMNIAQ 221

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHI--MASKISGSGLGDCVIAL 287
             L+ LG+S+  L    W + E   +  ++ K+SG+G G   I L
Sbjct: 222 CCLKRLGLSNDTLD---WLISEGIKLGALSGKLSGAGKGGAFIFL 263


>gi|254496229|ref|ZP_05109123.1| putative mevalonate kinase [Legionella drancourtii LLAP12]
 gi|254354534|gb|EET13175.1| putative mevalonate kinase [Legionella drancourtii LLAP12]
          Length = 293

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 124/279 (44%), Gaps = 16/279 (5%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM---FH 70
           G  +L+GEH V+ GHAALVF I ++ +      K   +  D     Y GS    M   F 
Sbjct: 12  GKWILVGEHAVVRGHAALVFPIKEKKLTLSYSAKSASLGAD-----YTGSSGADMQLLFW 66

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
                 +  +       G    + S +   +G+G+SAA+ VA++    T Q  +E   + 
Sbjct: 67  SVLEHGMQLLGRSLNQLGGHFLLDSTIPVGVGMGASAALCVAMSRWFCTQQMLEESQCNA 126

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP-T 189
               A  +     G SSG+D+A     G + Y    Y++     + P + + S  +   T
Sbjct: 127 F---AKELEHLFHGKSSGLDVAGVAADGGV-YFKAGYTVPLKQIVQPKYFLSSCNQIGIT 182

Query: 190 AQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           +  ++++  +  + P +  ++++++   + + ++++ +         LAQA+N+      
Sbjct: 183 SHCIQQVQGLWDKNPALARKLDEQMVESV-EEAKVALEQGGADAESFLAQAINKAADCFV 241

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             G+    L + + +L  +  I A K +GSG G  V++L
Sbjct: 242 QWGLVSEGLQQHMNRLTAEGAI-AVKPTGSGGGGFVLSL 279


>gi|194468009|ref|ZP_03073995.1| mevalonate kinase [Lactobacillus reuteri 100-23]
 gi|194452862|gb|EDX41760.1| mevalonate kinase [Lactobacillus reuteri 100-23]
          Length = 316

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 129/278 (46%), Gaps = 14/278 (5%)

Query: 16  LVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGSLD---LAMFHP 71
           ++LMGEH V++G  A+   + + ++ + L+ R+D    I S    Y GSL+    +M   
Sbjct: 14  IILMGEHSVVYGQPAIALPLPSVQLSVTLSSRQDNQRIIKSRY--YHGSLENLPSSMIGI 71

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEI 131
                 ++        G+ LK+ SQL ++ G+GSSAA  +AI  A     Y+ EP    +
Sbjct: 72  KKLIDTLSARFNDHETGWVLKIESQLPAERGMGSSAASAIAIIRAF--FDYYDEPLDRTL 129

Query: 132 LTTAHAIVLKVQGIS-SGIDLAASIHGGLICYQMPKYSIE-KIDFIFPIHLIYSGYKTPT 189
           L     +  ++   S SG+D A       + Y   +  +  +++    + +  +G K  T
Sbjct: 130 LLQLADVEEQITHRSPSGLDAATVSSDKPLFYVKGRIGVPIEMNLDASLVIADTGKKGAT 189

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            +    I  ++ E    +E  ++    +G+L + +   L   ++  L  A+N  Q  L  
Sbjct: 190 KEA---ILAVKGELKNNSEKAEEHIKHLGELVKQTKDYLAQNDIAKLGDALNFAQTDLAA 246

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L VSD  L  ++   R+    + +K++G G G C+IAL
Sbjct: 247 LNVSDPVLDHLIHVARDNG-ALGAKLTGGGRGGCMIAL 283


>gi|329768012|ref|ZP_08259523.1| hypothetical protein HMPREF0428_01220 [Gemella haemolysans M341]
 gi|328838497|gb|EGF88105.1| hypothetical protein HMPREF0428_01220 [Gemella haemolysans M341]
          Length = 329

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 86/173 (49%), Gaps = 21/173 (12%)

Query: 12  APGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDS----SLGQYCGSLDL 66
           A G L L GE+ +L  +A AL+ ++ K++ +++    D+    D+    S+G +  + + 
Sbjct: 12  AYGKLYLAGEYAILEDYASALITSVPKKITVFVE-ESDKTTIFDTINKTSVGLFEENSNF 70

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQL---DSQLGLGSSAAITVAITAALLTLQYH 123
            +      FI     +   +  F L + ++L   D + GLGSS A+ VAI  A+L+    
Sbjct: 71  TLVQQ---FIQFLTEYTISNKTFALTIFNELHSDDKKYGLGSSGAVLVAIARAILSF--- 124

Query: 124 KEPSPDEILTTAHAIVL-KVQGISSGI--DLAASIHGGLICYQMPKYSIEKID 173
            E  P   LT    + L  ++   SG   D+AASI+ G+  YQ  K++ E ++
Sbjct: 125 -ENIPYNNLTIFKLVALFNIKHNLSGSMGDVAASINDGITFYQ--KFNAEFVN 174


>gi|307173496|gb|EFN64406.1| Mevalonate kinase [Camponotus floridanus]
          Length = 387

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 129/347 (37%), Gaps = 89/347 (25%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           +  +SAPG ++L GEH V++G  AL  ++N R  L    +    I+I+      C S+ L
Sbjct: 3   QFSISAPGKVILHGEHAVVYGKTALAASLNLRTKLKFNEQDLNNIDINCPDIHLCLSIPL 62

Query: 67  AM----FHPSFSF------------------------------------------IIMAI 80
            +    F PS+ F                                          I +A 
Sbjct: 63  DVILECFQPSYPFNENTNRLLDQVEQFITLKKDFSGTYTGSKQQKLSLQAILYLLIYIAY 122

Query: 81  NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL---TLQ------YHKEPSPDEI 131
                   F L + ++L    GLGSSA+  V I A       LQ         E   ++I
Sbjct: 123 EEQMQIKSFSLHLSTELTIGAGLGSSASFAVCIAACFFHWARLQKSDVHNTFNEDDLEKI 182

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI-----FPIHLIYSGYK 186
              A +    + G  SGID +   +G +I +Q      E ++ +       I L+ S   
Sbjct: 183 SKYALSCERIMHGSPSGIDNSVCTYGSIIKFQRG----EPVNILPNMPSLNILLVNSMIS 238

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN---------------- 230
             T  +L+++  +   YP I +    I+  +  +S+ + Q LR                 
Sbjct: 239 RNTKDLLERVIKMRQSYPAIID---PIFDSIDAVSKAALQILREIYDIQSTNDADLLESR 295

Query: 231 -KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKIS 276
            KNL  L +     Q LL  L VS SKL  I    R+  H  A K++
Sbjct: 296 YKNLFALVRT---NQALLSALDVSHSKLDIICSIARD--HSFAGKLT 337


>gi|323332135|gb|EGA73546.1| Erg12p [Saccharomyces cerevisiae AWRI796]
 gi|323353152|gb|EGA85452.1| Erg12p [Saccharomyces cerevisiae VL3]
          Length = 285

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 109/238 (45%), Gaps = 39/238 (16%)

Query: 89  FDLKVISQLDSQLGLGSSAAITVAITAALLTL-------QYHKEPSPDEILTTAHAIVLK 141
           F LK  S L    GLGSSA+I+V++  A+  L          K    D+ +    A + +
Sbjct: 14  FSLK--STLPIGAGLGSSASISVSLALAMAYLGGLIGSNDLEKLSENDKHIVNQWAFIGE 71

Query: 142 --VQGISSGIDLAASIHGGLICYQMPKY--SIEKIDFIF-------PIHLIYSGYKTPTA 190
             + G  SGID A + +G  + ++   +  +I   +F F       P+ L Y+     T 
Sbjct: 72  KCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFLDDFPAIPMILTYTRIPRSTK 131

Query: 191 QVLKKISYIEIE-YPEI--------NEINQKIYALMGKLSQISCQALRNKNLKV------ 235
            ++ ++  +  E +PE+         E   +   +M KLS+  C+   ++ ++       
Sbjct: 132 DLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMTKLSK--CKGTDDEAVETNNELYE 189

Query: 236 -LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
            L + +    GLL ++GVS   L E++  L +   I ++K++G+G G C + L + D+
Sbjct: 190 QLLELIRINHGLLVSIGVSHPGL-ELIKNLSDDLRIGSTKLTGAGGGGCSLTLLRRDI 246


>gi|325475074|gb|EGC78260.1| galactokinase [Treponema denticola F0402]
          Length = 399

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/342 (20%), Positives = 139/342 (40%), Gaps = 60/342 (17%)

Query: 2   GQCLHKICVSA-PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI--------- 51
           G    KI  +A P  + ++GEH   +G   L  A+N  + + L  RKD+ I         
Sbjct: 21  GNSEEKIIFAASPARINIIGEHIDYNGGLVLPAAVNLYLRIALRKRKDKKILYRSMKAEK 80

Query: 52  ----NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSA 107
                +D +LG +    D A +     F+ +    +K   GF+L + S +    G+ SSA
Sbjct: 81  VFEFELDGNLG-FDKENDFANYLNGM-FLFLKERGLKADTGFELLITSDIPQGSGISSSA 138

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------- 158
           A+ +     +++  +  E    E       +  +  G+ SGI    +I  G         
Sbjct: 139 ALELCF-GKIISHAFGFELDGIEFAKIGRRVENEFLGLKSGIMDQFAIAMGKKNQALLLD 197

Query: 159 -------LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE----------- 200
                   I  +   Y I  ++   P  L  S Y     +  K +++++           
Sbjct: 198 TSSLDYEYIPLETEPYRIVIMNSNKPRKLTESKYNERKEECEKALAFLQKKTDIDFLCDL 257

Query: 201 -------IEYPEINEINQKIY-------ALMGKLSQISCQALRNKNLKVLAQAMNRQQ-G 245
                  +E   I+ + +KI+         M ++ + S +AL+NK+LK+L  ++N+    
Sbjct: 258 SVSDFEKLEEDLISNLGEKIFRRVRHCVTEMDRVRR-SAEALKNKDLKLLGASLNQSHLS 316

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L +   V+  +L  + +   ++   + ++++G+G   C IA+
Sbjct: 317 LKDDYEVTGKELDALFFAAIKEKSCIGARMTGAGFSGCAIAI 358


>gi|47226511|emb|CAG08527.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 394

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 128/319 (40%), Gaps = 71/319 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-----RLINIDSSLGQYCG 62
           I VSAPG  +L GEH V+HG  AL  ++N R  L L           L NID+ L  +  
Sbjct: 6   IYVSAPGKAILHGEHAVVHGKVALAVSLNLRSYLRLEATSTGTVGVNLPNIDTFL--HWN 63

Query: 63  SLDLAMFHPSFS-------------------FIIMAINHIKPS----------------- 86
             +L  F PS +                   ++ +A  ++  S                 
Sbjct: 64  LSELKQFAPSVTGGTGQVKLLDPDLLRRLREYVGVANGNLNTSQMATLTFLYLYLSAFGS 123

Query: 87  ---CGFDLKVISQLDSQLGLGSSAAITVAITAALL---------------TLQYHKEPSP 128
                  + V S+L +  GLGSSAA TV + AALL               T ++ +E   
Sbjct: 124 GELPSLTVSVWSELPTGAGLGSSAAYTVCLAAALLCASGAISSPLKEWEHTARWCQE-EL 182

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           + I + A    + + G  SG+D A    GG++ +   K  I  +  +  + ++ +  K P
Sbjct: 183 ELINSWAFQGEMIIHGNPSGVDNAVGTWGGMLRFLAGK--IIPLSRVPLLRILLTNTKVP 240

Query: 189 ------TAQVLKKIS-YIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
                  ++V  KI+ +  +  P ++ ++         LS+++ + +  ++   L + ++
Sbjct: 241 RSTKVLVSRVKDKINKFPSVMAPVLDSVDAISCTCEKVLSEMTSEPITGEHYNALEELID 300

Query: 242 RQQGLLETLGVSDSKLSEI 260
             Q  L  +GV    L  +
Sbjct: 301 INQHHLNVMGVGHPALDTL 319


>gi|16417946|gb|AAL18925.1|AF429384_1 mevalonate kinase [Hevea brasiliensis]
 gi|164604974|dbj|BAF98283.1| mevalonate kinase [Hevea brasiliensis]
          Length = 386

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 142/347 (40%), Gaps = 80/347 (23%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN----------------------KRVILYLTLRKDR 49
           APG ++L GEH V+HG  A+  +IN                      K + L  +    R
Sbjct: 7   APGKIILSGEHAVVHGSTAVAASINLYTYVTLSFATAENDDSLKLQLKDLALEFSWPIGR 66

Query: 50  LINIDSSLGQYCGS--------------------------LDLAMFHPSFSFIIMAINHI 83
           +    S+LG    S                          + L     +F ++  +I   
Sbjct: 67  IREALSNLGAPSSSTRTSCSMESIKTISALVEEENIPEAKIALTSGVSAFLWLYTSIQGF 126

Query: 84  KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT-----------LQYHKEPSPDEIL 132
           KP+    + V S L    GLGSSAA  VA++AALL            L +      D  L
Sbjct: 127 KPAT---VVVTSDLPLGSGLGSSAAFCVALSAALLAFSDSVNVDTKHLGWSIFGESDLEL 183

Query: 133 TTAHAIVLK--VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT--P 188
               A+  +  + G  SGID   S +G +I ++    ++ +I    P+ ++ +  +    
Sbjct: 184 LNKWALEGEKIIHGKPSGIDNTVSAYGNMIKFK--SGNLTRIKSNMPLKMLVTNTRVGRN 241

Query: 189 TAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR----- 242
           T  ++  +S   + +P  ++ +   + ++  +L+ I  Q+    ++ +  +         
Sbjct: 242 TKALVAGVSERTLRHPNAMSFVFNAVDSISNELANI-IQSPAPDDVSITEKEEKLEELME 300

Query: 243 -QQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVIAL 287
             QGLL+ +GVS + +  +   LR    + +ASK++G+G G CV+ L
Sbjct: 301 MNQGLLQCMGVSHASIETV---LRTTLKYKLASKLTGAGGGGCVLTL 344


>gi|116511266|ref|YP_808482.1| phosphomevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
 gi|116106920|gb|ABJ72060.1| phosphomevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
          Length = 329

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 139/335 (41%), Gaps = 50/335 (14%)

Query: 6   HKICVSAPGSLVLMGEHGVL-HGHAALVFAINKRVILYLTLRKDR-LINIDSSLGQYCGS 63
            KI    PG L   GE+ V   G+ AL+  I     + ++   D+ ++  +  L  +  S
Sbjct: 6   KKIKTKIPGKLFFAGEYAVTKEGNLALITTIETNFEMSISRASDKSILKTNVGLADFEFS 65

Query: 64  LDLAMFHPS--FSFIIMAINHIKPSCGFDLKV----ISQL---------------DSQLG 102
           L    F     ++F + A+ +   +     K     IS+L               +++ G
Sbjct: 66  LSKIEFDKESPWNFALTALKNTLSAADSSKKESVSKISELSVEICLEIRSDLGFGENKKG 125

Query: 103 LGSSAAITVAITAA---LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL 159
            GSSA++   +  A      LQ   E    EI    H    +VQG  S  D+AA ++GG 
Sbjct: 126 YGSSASVVCGVVNAVNQFFDLQLSLEKRF-EIAAKTH---FEVQGSGSMGDIAAIMYGGS 181

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK 219
           + YQ         + I P+ + +  Y   T +  K    I+I      +++ + Y    +
Sbjct: 182 VFYQNH-------NRILPLEIPWKTYVVQTGKAAKTAEKIKI------KLSDEFYQTSNE 228

Query: 220 LSQISCQALRNKNLKVLAQAMNRQQ-GLLETL--GVSDSKLSEIVWKLREQPHIMASKIS 276
           L      A+  ++  +  + ++  Q  LLE +  G    +L+  +  L   P  +A+KIS
Sbjct: 229 LVIEMATAIDIQDFSLFKEKLSENQLLLLENIPEGYMTKELALALNLLNSYPE-LAAKIS 287

Query: 277 GSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI 311
           G+G G+ +I   +   NS+    V   ++  GI++
Sbjct: 288 GAGFGENLILFAQ---NSMAIAEVQKKLYEYGINL 319


>gi|116514015|ref|YP_812921.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
 gi|116093330|gb|ABJ58483.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
          Length = 291

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 125/288 (43%), Gaps = 37/288 (12%)

Query: 18  LMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAMFHPSFSF 75
           ++GEH V++G+ AL   I             + ++I +++  Y G   +D  ++   F  
Sbjct: 1   MIGEHSVVYGYDALAMPI-------------QTLHIKTTVSDYAGPVWMDTKLYQGPFFD 47

Query: 76  IIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
                N +K            +    L    ++  + GLGSSA +    T AL   QY  
Sbjct: 48  APADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVALS--QYLG 105

Query: 125 -EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            + S  E++   +       G +SG+D AA+++   + +   +  ++K+       L+  
Sbjct: 106 LKLSASEVMNITNQAETINHGKASGLD-AATVNSDYLVFFNKQRGVKKLSSKLGASLLIM 164

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + +  ++ +  E P+     +K    +G+L+     A   ++ + + +  N
Sbjct: 165 DTGDLGNTREAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQDPESVGKFFN 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
             Q LL +  +S SK+  I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 221 EAQELLASFNLSTSKIDRIC-QIADKGGALGCKLSGGGLGGIVIALCK 267


>gi|317495994|ref|ZP_07954356.1| GHMP kinase N terminal domain-containing protein [Gemella
           moribillum M424]
 gi|316913898|gb|EFV35382.1| GHMP kinase N terminal domain-containing protein [Gemella
           moribillum M424]
          Length = 328

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 83/164 (50%), Gaps = 21/164 (12%)

Query: 12  APGSLVLMGEHGVLHGHA-ALVFAINKRVILYLTLRKDRLINIDS----SLGQYCGSLDL 66
           A G L + GE+ +L  ++ AL+ +++K++I ++    +  I  D+    S+G Y  + + 
Sbjct: 12  AYGKLYIAGEYAILEDYSKALITSVDKKIIAFVEPANEITI-FDTVHKISIGLYEKNDNF 70

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQL---DSQLGLGSSAAITVAITAALLTLQYH 123
            +      F+I    + + +  F L + ++L   D + GLGSS A+ VAI  A+L  +  
Sbjct: 71  KLIQE---FLIFLQQYTQSNKKFALTIYNELHGEDKKYGLGSSGAVLVAIAKAMLNFEKI 127

Query: 124 KEPSPDEI----LTTAHAIVLKVQGISSGIDLAASIHGGLICYQ 163
           K    D+I    L T   +   + G S G D+AAS+  G+  YQ
Sbjct: 128 K---FDDITIFKLVTLFNLTHNISG-SMG-DVAASLTKGITYYQ 166


>gi|309807497|ref|ZP_07701457.1| mevalonate kinase [Lactobacillus iners LactinV 01V1-a]
 gi|308169262|gb|EFO71320.1| mevalonate kinase [Lactobacillus iners LactinV 01V1-a]
          Length = 306

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 121/288 (42%), Gaps = 17/288 (5%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-L 64
            K+ V   G ++L+GEH V++G  A+   I+   I          I +D+   +Y G  L
Sbjct: 4   RKVIVKTHGKVILIGEHSVVYGKDAMALPIHALNIATSVEAYHDGIWMDTL--RYQGPYL 61

Query: 65  DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
                +     ++  I + I   C   +    ++  + GLGSSA + +  TA  L   + 
Sbjct: 62  TAPAEYNGLKHVVKKILSKIPTPCSIKITYTGEIPMERGLGSSAVVALG-TARALNEYFA 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFPIHL 180
            + +  EI    +       G +SG+D A      L+ +     PK   EK+     I  
Sbjct: 121 LKMTSKEITDITNEAETINHGKASGLDAATVQSDYLVFFNKNMGPKVLSEKLGATLLI-- 178

Query: 181 IYSGYKTPTAQVLKKISY-IEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           + +G    T + +  + Y IE +  +   I++     +G L+  +      K+  ++   
Sbjct: 179 MDTGELGNTKEAVSSVKYQIEHDIAKKEAIDK-----LGYLADQTKDYWFKKDAPMVGTI 233

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
            N  Q +L   G+S ++++ +   +  +      K+SG GLG  VIAL
Sbjct: 234 FNEAQDILANFGLSTTRINNLC-NIANKNGAYGCKLSGGGLGGIVIAL 280


>gi|42527714|ref|NP_972812.1| galactokinase [Treponema denticola ATCC 35405]
 gi|41818542|gb|AAS12731.1| galactokinase [Treponema denticola ATCC 35405]
          Length = 399

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/342 (20%), Positives = 141/342 (41%), Gaps = 60/342 (17%)

Query: 2   GQCLHKICVSA-PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLI--------- 51
           G    KI  +A P  + ++GEH   +G   L  A+N  + + L  RKD+ I         
Sbjct: 21  GNSEEKIIFAASPARINIIGEHIDYNGGLVLPAAVNLYLRIALRKRKDKKILYRSMKTEK 80

Query: 52  ----NIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSA 107
                +D +LG +    D A +     F+ +    +K   GF+L + S +    G+ SSA
Sbjct: 81  IFEFELDGNLG-FDKENDFANYLNGM-FLFLKERGLKADTGFELLITSDIPQGSGISSSA 138

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAA------------- 153
           A+ +     +++  +  E    E       +  +  G+ SGI D  A             
Sbjct: 139 ALELCF-GKIISHAFGFELDGIEFAKIGRRVENEFLGLKSGIMDQFAIAMGKKNQAILLD 197

Query: 154 --SIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE----------- 200
             S++   I  +   Y I  ++   P  L  S Y     +  K +++++           
Sbjct: 198 TSSLNYEYIPLETEPYRIVIMNSNKPRKLTESKYNERKEECEKALAFLQKKTDIDFLCDL 257

Query: 201 -------IEYPEINEINQKIY-------ALMGKLSQISCQALRNKNLKVLAQAMNRQQ-G 245
                  +E   I+ + +K++         M ++ + S +AL+NK+LK+L  ++N+    
Sbjct: 258 SVSDFEKLEEDLISNLGEKLFRRVRHCVTEMDRVRR-SAEALKNKDLKLLGASLNQSHLS 316

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L +   V+  +L  + +   ++   + ++++G+G   C IA+
Sbjct: 317 LKDDYEVTGKELDALFFAAIKEKSCIGARMTGAGFSGCAIAI 358


>gi|229491845|ref|ZP_04385666.1| galactokinase [Rhodococcus erythropolis SK121]
 gi|229321526|gb|EEN87326.1| galactokinase [Rhodococcus erythropolis SK121]
          Length = 376

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 8/128 (6%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS--SLGQYCGSL-DLA 67
           +APG + L+GEH   +G   L  A+ +R ++ + LR D ++ + S  S   Y G L D+A
Sbjct: 26  AAPGRVNLIGEHTDYNGGLCLPVALEQRTLVAVALRSDGVVRVHSRQSAETYTGPLGDIA 85

Query: 68  MFHPSFSFIIMA--INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
               ++   ++        P  G DL V S +    GL SSAA+T ++  AL   + H  
Sbjct: 86  TGWAAYPTAVLWSLARRGLPIEGIDLAVDSSVPVGAGLSSSAALTCSV--ALAVNELHDS 143

Query: 126 P-SPDEIL 132
           P + DE++
Sbjct: 144 PFARDELV 151


>gi|307190642|gb|EFN74609.1| Galactokinase [Camponotus floridanus]
          Length = 394

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 80/351 (22%), Positives = 133/351 (37%), Gaps = 58/351 (16%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDR---------LINIDSSLG 58
           +C  APG + L+GEH   +    L  A+    ++       R         ++++ +   
Sbjct: 29  VCAYAPGRVNLIGEHTDYNEGFVLPMALPMITMIAGKSHDGRKSKIISASDIVDVTNEFE 88

Query: 59  QYCGSL-DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
              G   D+    P ++  I     N I     F+  ++S + +  GL SSAA+ VA   
Sbjct: 89  FEAGKRSDIKPGEPKWANYIKGCIANFICDVPAFNAVIVSTVPAGAGLSSSAALEVATYT 148

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG------LICYQMPKYS 168
            L  L   K   P++             G+  GI D   S+ G       L C  +    
Sbjct: 149 FLEALSEKKPEKPEQKALACQKAEHNFAGVPCGIMDQFISVMGKEGCALLLDCRDLTTKQ 208

Query: 169 IEKI---DFIF-------PIHLIYSGYKT------PTAQVLKKISYIEIEYPEINEI--- 209
           I  I   D++F       P  L  S Y          A++L K S   +   +IN+I   
Sbjct: 209 IPMIYIDDYVFLITNSNAPHKLSSSAYCERRDCCYDAAKILGKKS---LRDADINDILAL 265

Query: 210 ----NQKIYALMG--------KLSQISCQALRNKNLKVLAQAMNRQ-QGLLETLGVSDSK 256
               N   Y +          + +Q +  AL   + ++  + MN     L +   VS  +
Sbjct: 266 TSRNNASDYIVRRARHVVTEIQRTQDAAIALEKGDFQLFGRLMNESHDSLRDDYEVSSKE 325

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           L  +V   RE   ++ S+++G+G G C + L + D  +   Q    HM AK
Sbjct: 326 LDSLVSAAREVDGVLGSRLTGAGFGGCTVTLLRKDAVNKAIQ----HMKAK 372


>gi|269139911|ref|YP_003296612.1| galactokinase [Edwardsiella tarda EIB202]
 gi|267985572|gb|ACY85401.1| galactokinase [Edwardsiella tarda EIB202]
 gi|304559746|gb|ADM42410.1| Galactokinase [Edwardsiella tarda FL6-60]
          Length = 385

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 17/128 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---------DS-S 56
           ++CV APG + L+GEH   +    L  AI+ + ++    R+DR + +         DS S
Sbjct: 23  QLCVQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRRDRRVRVIAADYDDQQDSFS 82

Query: 57  LGQYCGSLDLAMFHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVA 112
           L Q   + D  M+    +++   I H++  C    G D+ +   +    GL SSA++ VA
Sbjct: 83  LDQPIDARDDMMWS---NYVRGVIKHLQQRCDGVGGVDMVISGNVPQGAGLSSSASLEVA 139

Query: 113 ITAALLTL 120
           +  AL  L
Sbjct: 140 VGQALQAL 147


>gi|332840392|ref|XP_003313984.1| PREDICTED: mevalonate kinase isoform 2 [Pan troglodytes]
          Length = 344

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 111/271 (40%), Gaps = 28/271 (10%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + VSAPG ++L GEH V+HG  AL  ++N R  L L    +  +++         + D+A
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVA 65

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY----- 122
                 +  +   +   P+     + + +L    GL    A+T  +  A+L   Y     
Sbjct: 66  RLQSLDASFLEQGDVTTPTS----EQVEKLKEVAGLPDDCAVTERL--AVLAFLYLYLSI 119

Query: 123 -HKEPSPDEILTTAHAIVLK----VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             K+    E L   +    +    + G  SG+D A S  GG + Y   K S  K      
Sbjct: 120 CRKQRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQ 179

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQALR 229
           I L  +     T  ++  +    +++PE        I+ I+ +   ++G++     +A  
Sbjct: 180 ILLTNTKVPRNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMG----EAPA 235

Query: 230 NKNLKVLAQAMNRQQGLLETLGVSDSKLSEI 260
            +   VL + ++  Q  L  LGV  + L ++
Sbjct: 236 PEQYVVLEELIDMNQHHLNALGVGHASLDQL 266


>gi|104773999|ref|YP_618979.1| mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           11842]
 gi|103423080|emb|CAI97801.1| Mevalonate kinase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           11842]
          Length = 291

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 125/288 (43%), Gaps = 37/288 (12%)

Query: 18  LMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS--LDLAMFHPSFSF 75
           ++GEH V++G+ AL   I             + ++I +++  Y G   +D  ++   F  
Sbjct: 1   MIGEHSVVYGYDALAIPI-------------QTLHIKTTVSDYAGPVWMDTKLYQGPFFD 47

Query: 76  IIMAINHIK-----------PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
                N +K            +    L    ++  + GLGSSA +    T AL   QY  
Sbjct: 48  APADYNGLKYVVKELLTRSGKNPQIKLTYTGEIPMERGLGSSATVAYGTTVALS--QYLG 105

Query: 125 -EPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY- 182
            + S  E++   +       G +SG+D AA+++   + +   +  ++K+       L+  
Sbjct: 106 LKLSASEVMNITNQAETINHGKASGLD-AATVNSDYLVFFNKQRGVKKLSSKLGASLLIM 164

Query: 183 -SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            +G    T + +  ++ +  E P+     +K    +G+L+     A   ++ + + +  N
Sbjct: 165 DTGDLGNTRKAVTMVAKLLNESPDAQVRMRK----LGQLADEVKAAWLEQDPESVGKFFN 220

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
             Q LL +  +S SK+  I  ++ ++   +  K+SG GLG  VIAL K
Sbjct: 221 EAQELLASFNLSTSKIDRIC-QIADKGGALGCKLSGGGLGGIVIALCK 267


>gi|145474541|ref|XP_001423293.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124390353|emb|CAK55895.1| unnamed protein product [Paramecium tetraurelia]
          Length = 281

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 133/290 (45%), Gaps = 41/290 (14%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V AP  +++ GEH V++GH AL  AINK   + +   K   I I      +   L+L   
Sbjct: 3   VRAPAKIIISGEHSVVYGHKALCAAINKYTKIKIHSNKANSIEIRWG-NDWHEVLNLDSN 61

Query: 70  HPSFSFIIMA-INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           + +     +A I +IKPS    ++V S+    L   S+ A++ A+  ++           
Sbjct: 62  NTNSQLAQVARILNIKPSI---IEVESEDPQPL---SAVALSKAMNGSI--------EQA 107

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF-IFPIHLIYSGYKT 187
            EI    H          SG+D+  + HGG+  +Q+ K  I+K++  I  I LI SG + 
Sbjct: 108 IEIENIFHG------KRGSGLDVQVTNHGGICIFQIGK-PIQKVNLPIQNILLIDSGDRK 160

Query: 188 P--TAQVLKKISYIEIEYPEINEINQKI-YALMGKLSQISCQALRNKNLKVLAQAMNRQQ 244
              T   + K+          N + QK    ++ ++S+++ Q ++   +K L   +    
Sbjct: 161 QKGTEGSIAKVK---------NCVEQKDGRQILNRISEVTEQIIKEGLVKEL---IYENH 208

Query: 245 GLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            LL  LG+   ++++I+   + +   + +K++G+G G   IA  K +  S
Sbjct: 209 DLLNRLGICTDRINDIIRICKREG--VPAKMTGAGDGGFCIAFPKDEQES 256


>gi|326500036|dbj|BAJ90853.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 334

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 120/264 (45%), Gaps = 36/264 (13%)

Query: 72  SFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL------------- 118
           +F ++  +I   +P     + V S L    GLGSSAA +V+++ ALL             
Sbjct: 64  AFLYLYTSILGCRPG---KVVVSSGLPMGAGLGSSAAFSVSLSGALLMAAGVVCAEGAVA 120

Query: 119 --TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
               Q   +   + + T A      + G  SGID A S  G +I ++  K  +  +    
Sbjct: 121 GTEWQLLGKDHLELVNTWAFQGEKIIHGKPSGIDNAVSTFGSMIKFK--KGELTNLKSGN 178

Query: 177 PIHLIYSGYKTP--TAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQ 226
           P+ ++ +  +    T  ++  +S     +P+        ++ I++++ +++ +L+     
Sbjct: 179 PVKMLITDTRVGRNTKALVAGVSERASRHPDSMASVFHAVDTISEELSSIV-ELAATDEI 237

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQ-PHIMASKISGSGLGDCVI 285
           A+ +K  K LA+ M   QGLL+ +GVS S +  +   LR    + + SK++G+G G CV+
Sbjct: 238 AMTSKEEK-LAELMEMNQGLLQCMGVSHSSIETV---LRSTLKYNLVSKLTGAGGGGCVL 293

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGI 309
            L    L  L  + V   + + G 
Sbjct: 294 TLIPTLLPKLVLEKVTTELESHGF 317


>gi|50546973|ref|XP_500956.1| YALI0B16038p [Yarrowia lipolytica]
 gi|49646822|emb|CAG83209.1| YALI0B16038p [Yarrowia lipolytica]
          Length = 449

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 144/377 (38%), Gaps = 101/377 (26%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT---------------------LRKD 48
           +SAPG ++L GEH  + G  A+  AI+ R  L +                      ++ D
Sbjct: 5   ISAPGKVILFGEHAAVFGKPAIAAAIDLRTYLLVETTTSDTPTVTLEFPDIHLNFKVQVD 64

Query: 49  RLINI------DSSLGQYCGSLDLAMF----------HPSF---------SFIIMAINHI 83
           +L ++      D        +LD  +F           P           SF+ + I+  
Sbjct: 65  KLASLTAQTKADHLNWSTPKTLDKHIFDSLSSLALLEEPGLTKVQQAAVVSFLYLYIHLC 124

Query: 84  KPSCGFD---LKVISQLDSQLGLGSSAAITVAITAALLTL--QYHKEPSPDEILTTAHAI 138
            PS   D     V S L    GLGSSA+I V + A LL L  Q   + + D    T   +
Sbjct: 125 PPSVCEDSSNWVVRSTLPIGAGLGSSASICVCLAAGLLVLNGQLSIDQARDFKSLTEKQL 184

Query: 139 VLK----------VQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
            L           + G  SGID A +  GG + +Q P   +  +D I  + L+ +  K P
Sbjct: 185 SLVDDWSFVGEMCIHGNPSGIDNAVATQGGALLFQRPNNRVPLVD-IPEMKLLLTNTKHP 243

Query: 189 --TAQVLKKISYIEIEYPEI--------NEINQKIYALMGK------------------- 219
             TA ++  +  +  E+  I         EI+ +   ++ +                   
Sbjct: 244 RSTADLVGGVGVLTKEFGSIMDPIMTSVGEISNQAMEIISRGKKMVDQSNLEIEQGILPQ 303

Query: 220 -LSQISCQALRN----KNLKVLAQAMNR----QQGLLETLGVSDSKLSEIVWKLREQPHI 270
             S+ +C  + +    + L+ +   M        GLL  +GVS  KL EI+       ++
Sbjct: 304 PTSEDACNVMEDGATLQKLRDIGSEMQHLVRINHGLLIAMGVSHPKL-EIIRTASIVHNL 362

Query: 271 MASKISGSGLGDCVIAL 287
             +K++G+G G C I L
Sbjct: 363 GETKLTGAGGGGCAITL 379


>gi|328777424|ref|XP_624545.3| PREDICTED: mevalonate kinase-like [Apis mellifera]
          Length = 382

 Score = 47.4 bits (111), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 139/340 (40%), Gaps = 74/340 (21%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-------------------------