PSIBLAST alignment of GI: 254781017 and protein with PDB id: 1wuu

>gi|58177238|pdb|1WUU|A Chain A, Crystal Structure Of Human Galactokinase Complexed With Mgamppnp And Galactose Length = 399
>gi|58177239|pdb|1WUU|B Chain B, Crystal Structure Of Human Galactokinase Complexed With Mgamppnp And Galactose Length = 399
 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/312 (16%), Positives = 89/312 (28%), Gaps = 48/312 (15%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI--DSSLGQYCGSL 64
           ++ VSAPG + L+GEH   +    L  A+    +L  + RKD L+++   S        L
Sbjct: 36  ELAVSAPGRVNLIGEHTDYNQGLVLPXALELXTVLVGSPRKDGLVSLLTTSEGADEPQRL 95

Query: 65  DLAMFHP----------SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
              +               +++   I +    P  GF   V+S +    GL SSA++ VA
Sbjct: 96  QFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVA 155

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS 168
               L  L                       G   GI           G  +        
Sbjct: 156 TYTFLQQLCPDSGTIAAR-AQVCQQAEHSFAGXPCGIXDQFISLXGQKGHALLIDCRSLE 214

Query: 169 IEKIDFIFPIHLIYSG------------YKTPTAQVLK-----KISYIEIEYPEINEINQ 211
              +    P   +               Y     Q  +         +     E  E  +
Sbjct: 215 TSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAAR 274

Query: 212 KIYALMGK-----------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSE 259
            + +  G             +  +  ALR  + +   +        L     VS  +L +
Sbjct: 275 DLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLXVESHRSLRDDYEVSCPELDQ 334

Query: 260 IVWKLREQPHIM 271
           +V      P + 
Sbjct: 335 LVEAALAVPGVY 346