PSIBLAST alignment of GI: 254781017 and protein with PDB id: 2a2d

>gi|71042624|pdb|2A2D|A Chain A, X-Ray Structure Of Human N-Acetyl Galactosamine Kinase Complexed With Mn-Amppnp And N-Acetyl Glactosamine Length = 478
>gi|73536058|pdb|2A2C|A Chain A, X-Ray Structure Of Human N-Acetyl Galactosamine Kinase Complexed With Mg-Adp And N-Acetyl Galactosamine 1- Phosphate Length = 478
 Score = 90.2 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 49/399 (12%), Positives = 118/399 (29%), Gaps = 98/399 (24%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC-- 61
            + K  V APG + ++GEH    G++ L  A+ + V++ +   K   + + ++   Y   
Sbjct: 52  SIPKFYVRAPGRVNIIGEHIDYCGYSVLPMAVEQDVLIAVEPVKTYALQLANTNPLYPDF 111

Query: 62  ----GSLDLAMFHPSF-SFIIMAINHIKPS------CGFDLKVISQLDSQLGLGSSAAIT 110
                ++ +    P + ++ +  +  I+         G +  V   +    GL SS+A+ 
Sbjct: 112 STSANNIQIDKTKPLWHNYFLCGLKGIQEHFGLSNLTGMNCLVDGNIPPSSGLSSSSALV 171

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH---GGLICYQMPKY 167
                  LT+   +  S  E+          +     G+D + S     G     +    
Sbjct: 172 CCAGLVTLTVLG-RNLSKVELAEICAKSERYIGTEGGGMDQSISFLAEEGTAKLIEFSPL 230

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-------------------IEYPEINE 208
               +        + +       +       I                     +   + E
Sbjct: 231 RATDVKLPSGAVFVIANSCVEMNKAATSHFNIRVMECRLAAKLLAKYKSLQWDKVLRLEE 290

Query: 209 INQKIYALMGKLSQISCQALRNKNLK--VLAQAMNRQQGLLETLGVSDSKLSEIVWKL-- 264
           +  K+   + ++  ++  AL  +      + + +      L T  +S +    +++KL  
Sbjct: 291 VQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQ 350

Query: 265 -REQPHIMASK---------------------------IS-------------------- 276
             +  +  A++                           +S                    
Sbjct: 351 RAKHVYSEAARVLQFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELDQLVDICR 410

Query: 277 --GS--------GLGDCVIALGKGDLNSLPYQSVNCHMH 305
             G+        G G C +++   D       +V+   +
Sbjct: 411 KFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYY 449