PSIBLAST alignment of GI: 254781017 and protein with PDB id: 2r3v

gi|192988174|pdb|2R3V|A Chain A, The Biochemical And Structural Basis For Feedback Inhibition Of Mevalonate Kinase And Isoprenoid Metabolism Length = 396
>gi|192988175|pdb|2R3V|B Chain B, The Biochemical And Structural Basis For Feedback Inhibition Of Mevalonate Kinase And Isoprenoid Metabolism Length = 396
 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 83/375 (22%), Positives = 141/375 (37%), Gaps = 63/375 (16%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           VSAPG ++L GEH V+HG  AL  ++N R  L L    +  +++         + D+A  
Sbjct: 8   VSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARL 67

Query: 70  HP-----------------------------------------SFSFIIMAI-NHIKPSC 87
                                                      +F ++ ++I    +   
Sbjct: 68  QSLDTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSICRKQRALP 127

Query: 88  GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY--------------HKEPSPDEILT 133
             D+ V S+L    GLGSSAA +V + AALLT+                  +   + I  
Sbjct: 128 SLDIVVWSELPPGAGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKEDLELINK 187

Query: 134 TAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVL 193
            A      + G  SG+D A S  GG + Y   K S  K      I L  +     T  ++
Sbjct: 188 WAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVPRNTRALV 247

Query: 194 KKISYIEIEYPEINE----INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
             +    +++PEI          I     ++     +A   +   VL + ++  Q  L  
Sbjct: 248 AGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDMNQHHLNA 307

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
           LGV  + L ++    R +   + SK++G+G G C I L K  L     ++    + + G 
Sbjct: 308 LGVGHASLDQLCQVTRARG--LHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGF 365

Query: 310 DIVPITP-SHSTSLY 323
           D +  +  +   S++
Sbjct: 366 DCLETSIGAPGVSIH 380