BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (324 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040694|gb|ACT57490.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 324

 Score =  280 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY
Sbjct: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL
Sbjct: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
           QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL
Sbjct: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM
Sbjct: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV
Sbjct: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300

Query: 301 NCHMHAKGIDIVPITPSHSTSLYR 324
           NCHMHAKGIDIVPITPSHSTSLYR
Sbjct: 301 NCHMHAKGIDIVPITPSHSTSLYR 324


>gi|315122512|ref|YP_004063001.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495914|gb|ADR52513.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 327

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 227/325 (69%), Positives = 268/325 (82%), Gaps = 3/325 (0%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCL KI V+APGS+VLMGEH VL+G AALVFAI+KR+ L LTLRKDRLINI+SSLGQY
Sbjct: 1   MGQCLQKIRVNAPGSIVLMGEHAVLYGQAALVFAIDKRISLCLTLRKDRLININSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDL M HPSFSFII A+ +IKP  GFDL++ S++D +LGLGSSAAIT +ITAALLTL
Sbjct: 61  CGSLDLPMSHPSFSFIITALEYIKPESGFDLEITSEIDCRLGLGSSAAITASITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFP 177
           QY K+P  +EI   A+ IVLK QG +SGIDLAASI+GGLI Y+M    +YSIE + +  P
Sbjct: 121 QYQKKPPKEEIFKKAYDIVLKTQGKASGIDLAASIYGGLIFYRMSELSEYSIEHVSYNLP 180

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           IHL+YSGYKTPT+QVL KIS +EIEYP I +INQ IYALMG+LS+IS  ALR+ N+K+LA
Sbjct: 181 IHLVYSGYKTPTSQVLNKISQVEIEYPAIKKINQTIYALMGELSEISLHALRDGNIKLLA 240

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
           QAMNRQQGLLETLGVSD  LS+IVW+LREQ  +MA+KISGSGLGDCVIALG+     L Y
Sbjct: 241 QAMNRQQGLLETLGVSDPTLSDIVWRLREQSLVMAAKISGSGLGDCVIALGESRSQFLFY 300

Query: 298 QSVNCHMHAKGIDIVPITPSHSTSL 322
            S++C MH+KGI I PIT S+ST L
Sbjct: 301 PSIDCSMHSKGIYIAPITSSYSTHL 325


>gi|307596392|ref|YP_003902709.1| mevalonate kinase [Vulcanisaeta distributa DSM 14429]
 gi|307551593|gb|ADN51658.1| mevalonate kinase [Vulcanisaeta distributa DSM 14429]
          Length = 330

 Score =  202 bits (514), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 79/310 (25%), Positives = 141/310 (45%), Gaps = 20/310 (6%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID------------ 54
            + V APG ++L GEH V++G  AL  AINK V +    R D  INI+            
Sbjct: 1   MVTVRAPGKVILYGEHAVVYGEPALAMAINKYVYVTARARSDGKININARDLRLAGISVT 60

Query: 55  -SSLGQYCGSLDLAMFHPSFSFIIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAI 109
            S  G      D      + S++  A+     ++    G DL++ S++    GLG+SAA+
Sbjct: 61  ISENGDIIARTDYGAVISALSYVKRAVELAMGYVDKKVGIDLEIRSEMPVGAGLGTSAAV 120

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS- 168
            VA   A +    + +    E+   A  +   VQG +S  D   +  GG++  +    + 
Sbjct: 121 AVATIYAYIKELGY-DIDKRELARLAWQVEKDVQGSASPTDTTMATFGGIMFVKPEGNNA 179

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
           + +         +  GY    +     ++ +  +Y  + ++ + I   +G +++   +AL
Sbjct: 180 VMEPVRPGTNVPLIIGYVPRVSTTKDLVAMVRRKYETMRDVIEPIIRSIGLITRKGREAL 239

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
              +L+++   MN   GLL+ LGVS  +L+E+V+  R     + SK++G+G G C+IAL 
Sbjct: 240 ERGDLELMGVLMNINHGLLDALGVSTRQLNEMVYAAR-NAGALGSKLTGAGGGGCMIALS 298

Query: 289 KGDLNSLPYQ 298
                    +
Sbjct: 299 DKVEVEKAIE 308


>gi|325968145|ref|YP_004244337.1| mevalonate kinase [Vulcanisaeta moutnovskia 768-28]
 gi|323707348|gb|ADY00835.1| mevalonate kinase [Vulcanisaeta moutnovskia 768-28]
          Length = 330

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 81/323 (25%), Positives = 143/323 (44%), Gaps = 20/323 (6%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID------------ 54
            I + APG ++L GEH V++G  AL  AINK + +    R D  INI+            
Sbjct: 1   MITIRAPGKVILYGEHAVVYGEPALAMAINKYLYVTARARDDNKININARDLRLAGISVT 60

Query: 55  -SSLGQYCGSLDLAMFHPSFSFIIMAI----NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
            S  G      D      + S++  AI     ++    G DL++ S++    GLG+SAA+
Sbjct: 61  ISEGGDVVAKTDYGAVISALSYVKRAIELAMEYLDKKVGIDLEIRSEMPVGAGLGTSAAV 120

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYS 168
            VA   A      + +    E+   A  +   VQG +S  D   +  GG++  +     +
Sbjct: 121 AVATILAYAKELGY-DIDKRELSRLAWQVEKDVQGSASPTDTTMATFGGIMYIKPEGNNT 179

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
           + +         +  GY    +     ++ +  +Y  +  I + I   +G +++   +AL
Sbjct: 180 VMEPVKPGANVPLIIGYVPRISTTKDLVAMVRRKYEIMRNIIEPIIKSIGLITKKGREAL 239

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
              +L+++   MN   GLL+ LGVS  +L+++V+  R     + SK++G+G G C+IAL 
Sbjct: 240 EMGDLELMGTLMNINHGLLDALGVSTRQLNDMVYAAR-HAGALGSKLTGAGGGGCMIALS 298

Query: 289 KGDLNSLPYQSVNCHMHAKGIDI 311
                    +     +   G+D 
Sbjct: 299 DRIEVEKAIELTGGSVLRAGLDT 321


>gi|57641409|ref|YP_183887.1| mevalonate kinase [Thermococcus kodakarensis KOD1]
 gi|73920096|sp|Q5JJC6|KIME_PYRKO RecName: Full=Mevalonate kinase; Short=MK
 gi|57159733|dbj|BAD85663.1| mevalonate kinase [Thermococcus kodakarensis KOD1]
          Length = 337

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 92/340 (27%), Positives = 151/340 (44%), Gaps = 35/340 (10%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
            + ++  SAP  ++L GEH V++G  A+  AI+ R  +         I I++   +  G 
Sbjct: 2   SVKRVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVSAEFNDTGAIKIEAHDIRTPGL 61

Query: 64  L------------DLAMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSS 106
           +            D         ++  AI  ++        G  + + SQ+    GLGSS
Sbjct: 62  IVSFTEDSIYFESDYGKAAEVLGYVRQAIELVREEADVNGKGITVSITSQIPVGAGLGSS 121

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           AA+ VA   A+  L    E S +E+    H + L VQG SSGID   S  GG I YQ  K
Sbjct: 122 AAVAVATIGAVSRLLG-LELSNEEVGKLGHKVELLVQGASSGIDPTVSAIGGFIHYQKGK 180

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
           +         P+ + Y+G    T +++     +   Y E+ EI + I   MG+L + + +
Sbjct: 181 FEHLPF-MELPLVVGYTGSSGSTKELVA---MVRKNYEEMPEIFEPILNSMGRLVEKARE 236

Query: 227 ALRNK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLG 281
            + +        + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G
Sbjct: 237 VITSDLDRELKFQTLGKLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGGG 295

Query: 282 DCVIALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
            C+ AL  G  + +           +   +  +G+ I  +
Sbjct: 296 GCMYALAPGKQSEVATAITIAGGTPMITKISREGMRIEEV 335


>gi|242399205|ref|YP_002994629.1| Mevalonate kinase [Thermococcus sibiricus MM 739]
 gi|259494449|sp|C6A3T5|KIME_THESM RecName: Full=Mevalonate kinase; Short=MK
 gi|242265598|gb|ACS90280.1| Mevalonate kinase [Thermococcus sibiricus MM 739]
          Length = 333

 Score =  195 bits (495), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 92/336 (27%), Positives = 152/336 (45%), Gaps = 34/336 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---S 63
           ++  SAP  ++L GEH V++G  A+  AI+ R  +     ++  I I++   +  G   S
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVKAEFNENGRIRIEAKDIRTPGLTVS 61

Query: 64  LDLAMFH---------PSFSFIIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
                 +            S++  AIN      +   G  + + SQ+    GLGSSAA+ 
Sbjct: 62  FSEDQIYFETDYGKAAEVLSYVREAINLVMEEAEKQKGVTVSITSQIPVGAGLGSSAAVA 121

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE 170
           VA   A+  L +  E +P+E+    H + L VQG SSGID   S  GG + YQ   +   
Sbjct: 122 VATIGAVSRL-FGLELTPEEVAKLGHKVELLVQGASSGIDPTVSAIGGFLYYQKGSFESL 180

Query: 171 KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN 230
            +    PI + Y+G    T +++ K   +   Y E+ EI   I   MG+L + + + +  
Sbjct: 181 PVV-ELPIVVGYTGSSGSTKELVAK---VRKNYEEMPEIIDPILNSMGRLVEKAREVILA 236

Query: 231 KN-----LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
           +       K L   MN   GLL+ LGVS   LS++V+    +   + +KI+G+G G C+ 
Sbjct: 237 EYDKEIKFKRLGTLMNINHGLLDALGVSTKSLSDLVY-ASREAGALGAKITGAGGGGCMY 295

Query: 286 ALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
           AL     + +           +   +  +G+ I  I
Sbjct: 296 ALAPEKQSEVATAIKIAGGMPIVTKISREGLRIEDI 331


>gi|18978009|ref|NP_579366.1| mevalonate kinase [Pyrococcus furiosus DSM 3638]
 gi|23821778|sp|Q8U0F3|KIME_PYRFU RecName: Full=Mevalonate kinase; Short=MK
 gi|18893790|gb|AAL81761.1| mevalonate kinase (mvk) [Pyrococcus furiosus DSM 3638]
          Length = 334

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 97/337 (28%), Positives = 152/337 (45%), Gaps = 35/337 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----------- 55
           K+  SAP  ++L GEH V++G  A+  AI+ R  +   L +++ I I++           
Sbjct: 2   KVIASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELIREKKIRIEAHDIKVPGLTVS 61

Query: 56  -SLGQYCGSLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAI 109
            S  +     D        S++  AIN +     K + G  + + SQ+    GLGSSAA+
Sbjct: 62  FSENEIYFETDYGKAAEVLSYVREAINLVLEEADKKNVGIKVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
            VA   A+  L    E S +EI    H   L VQG SSGID   S  GG I Y+  K+  
Sbjct: 122 AVATIGAVSKLLG-LELSKEEIAKMGHKTELLVQGASSGIDPTVSAIGGFIFYEKGKFEH 180

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL- 228
                  PI + Y+G   PT +++     +   Y E+ E+   I   MGK+ + +   + 
Sbjct: 181 LPF-MELPIVVGYTGSSGPTKELVA---MVRKRYEEMPELIVPILEAMGKVVEKAKDVIL 236

Query: 229 ----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
               + +  + L   MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G C+
Sbjct: 237 SNVDKEEKFERLGVLMNINHGLLDALGVSTKKLSELVYAAR-VAGALGAKITGAGGGGCM 295

Query: 285 IALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
            AL       +           +   +  +G+ I  +
Sbjct: 296 YALAPNKQREVATAIRIAGGTPMITEISREGLKIEEV 332


>gi|254172712|ref|ZP_04879387.1| mevalonate kinase [Thermococcus sp. AM4]
 gi|214033641|gb|EEB74468.1| mevalonate kinase [Thermococcus sp. AM4]
          Length = 334

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 150/339 (44%), Gaps = 35/339 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---S 63
           ++  SAP  ++L GEH V++G  A+  AIN R  ++        I I++   +  G   S
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAINLRTYVWAEFNDRGAIRIEAKDIRVPGLTVS 61

Query: 64  LDLAMFH---------PSFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
                 +            S++  AI  +K        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVKEEADKNGRGITVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
            VA   A+  L    E + +EI    H + L VQG SSGID   S  GG I Y+   +  
Sbjct: 122 AVATIGAVSRLLG-LELTNEEIGRLGHRVELLVQGASSGIDPTVSAIGGFIHYEKGNFEH 180

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
                  PI + Y+G    T +++  +     E P   EI + I   MGK+ + + + L 
Sbjct: 181 LPF-MELPIVVGYTGSSGSTKELVAMVRRTREEMP---EIVEPILLSMGKIVERAREILL 236

Query: 230 NK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
           +        + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G C+
Sbjct: 237 SDLDEEVRFERLGRLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGGGGCM 295

Query: 285 IALGKGDLNSLPYQS-------VNCHMHAKGIDIVPITP 316
            AL     + +           +   +  +G+ I  + P
Sbjct: 296 YALAPDRQSEVATAITIAGGTPMITEISREGLRIEEVIP 334


>gi|212223279|ref|YP_002306515.1| mevalonate kinase [Thermococcus onnurineus NA1]
 gi|229486114|sp|B6YST1|KIME_THEON RecName: Full=Mevalonate kinase; Short=MK
 gi|212008236|gb|ACJ15618.1| mevalonate kinase [Thermococcus onnurineus NA1]
          Length = 334

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 92/339 (27%), Positives = 150/339 (44%), Gaps = 35/339 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---S 63
           ++  SAP  ++L GEH V++G  A+  AI+ R  ++        I I++   +  G   S
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVWAEFNNKGAIKIEAKDIKVPGLTVS 61

Query: 64  LDLAMFH---------PSFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
                 +            S++  AI  ++        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVREEADKNGNGVTVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
            VA   A+  L    E S +EI    H + L VQG SSGID   S  GG + Y+   +  
Sbjct: 122 AVATIGAVSRLLG-LELSNEEIAKLGHKVELLVQGASSGIDPTVSAIGGFLHYEKGNFEH 180

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALR 229
                  PI + Y+G    T +++     +   Y E+ E+ + I   MGK+ + +   L 
Sbjct: 181 LPF-MELPIVVGYTGSSGSTKELVA---MVRRNYEEMPEVIEPILVSMGKIVEKAKDVLL 236

Query: 230 NK-----NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
           ++         L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G C+
Sbjct: 237 SELDNEVRFVQLGRLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGGGGCM 295

Query: 285 IALGKGDLNSLPYQS-------VNCHMHAKGIDIVPITP 316
            AL     + +           +   +  +G+ I  + P
Sbjct: 296 YALAPEKQSEVATAITIAGGTPMITKISDEGLRIEEVLP 334


>gi|332157850|ref|YP_004423129.1| mevalonate kinase [Pyrococcus sp. NA2]
 gi|331033313|gb|AEC51125.1| mevalonate kinase [Pyrococcus sp. NA2]
          Length = 333

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 93/336 (27%), Positives = 148/336 (44%), Gaps = 34/336 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL-- 64
            +  SAP  ++L GEH V++G  A+  AI+ R  +     ++  I I++   +  G +  
Sbjct: 2   MVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVKAEFNEEGRIRIEAHDIKTPGLIVS 61

Query: 65  ----------DLAMFHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAIT 110
                     D        S++  AI  +        G  + + SQ+    GLGSSAA+ 
Sbjct: 62  FSEGKIYFETDYGKAAEVLSYVRHAIELVLEEADKNVGVSVSITSQIPVGAGLGSSAAVA 121

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE 170
           VA   A+  L    E S +EI    H + L VQG SSGID   S  GG + Y+  K+   
Sbjct: 122 VATIGAVSKLLG-LELSREEIAKLGHKVELLVQGASSGIDPTVSAIGGFLYYKQGKFEHL 180

Query: 171 KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-- 228
                 PI + Y+G    T +++     +   Y ++ EI   I   MGKL +I+   +  
Sbjct: 181 PF-MELPIVVGYTGSSGSTKELVA---MVRERYEKMPEIVAPILDSMGKLVEIARDVITS 236

Query: 229 ---RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
                +    L + MN   GLL+ LGVS  KLSE+V+  R     + +K++G+G G C+ 
Sbjct: 237 KLDEEEKFLKLGELMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKLTGAGGGGCMY 295

Query: 286 ALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
           AL  G    +           +   +  +G+ I  +
Sbjct: 296 ALAPGKQKEVATAIKIAGGVPMITRISREGLRIEEV 331


>gi|14520757|ref|NP_126232.1| mevalonate kinase [Pyrococcus abyssi GE5]
 gi|8928195|sp|Q9V187|KIME_PYRAB RecName: Full=Mevalonate kinase; Short=MK
 gi|5457973|emb|CAB49463.1| mvk mevalonate kinase [Pyrococcus abyssi GE5]
          Length = 335

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 91/339 (26%), Positives = 146/339 (43%), Gaps = 34/339 (10%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG- 62
               +  SAP  ++L GEH V++G  A+  AI+ R  +         I I++   +  G 
Sbjct: 1   MPRLVLASAPAKIILFGEHSVVYGKPAIASAIDLRTYVRAEFNDSGNIKIEAHDIKTPGL 60

Query: 63  --SLDLAMFH---------PSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSA 107
             S      +            S++  AI  +        G  + + SQ+    GLGSSA
Sbjct: 61  IVSFSEDKIYFETDYGKAAEVLSYVRHAIELVLEEADKRTGVSVSITSQIPVGAGLGSSA 120

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY 167
           A+ VA   A+  L    E S +EI    H + L VQG SSGID   S  GG + Y+  ++
Sbjct: 121 AVAVATIGAVSKLL-DLELSKEEIAKMGHKVELLVQGASSGIDPTVSAIGGFLYYKQGEF 179

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
                    PI + Y+G    T +++     +   Y E+ E+ + I   MGKL   + + 
Sbjct: 180 EHLPFV-ELPIVVGYTGSSGSTKELVA---MVRRRYEEMPELIEPILESMGKLVDKAKEV 235

Query: 228 L-----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
           +       +    L + MN   GLL+ LGVS  KLSE+V+  R     + +K++G+G G 
Sbjct: 236 IISKLDEEEKFLKLGELMNINHGLLDALGVSTKKLSELVYAAR-TAGAIGAKLTGAGGGG 294

Query: 283 CVIALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
           C+ AL  G    +           +   +  +G+ I  +
Sbjct: 295 CMYALAPGKQREVATAIKIAGGTPMITRISKEGLRIEEV 333


>gi|240103785|ref|YP_002960094.1| mevalonate kinase [Thermococcus gammatolerans EJ3]
 gi|259494448|sp|C5A7L8|KIME_THEGJ RecName: Full=Mevalonate kinase; Short=MK
 gi|239911339|gb|ACS34230.1| Mevalonate kinase (mvk) [Thermococcus gammatolerans EJ3]
          Length = 334

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 151/339 (44%), Gaps = 35/339 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---S 63
           ++  SAP  ++L GEH V++G  A+  AIN R  ++    +   I I++   +  G   S
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAINLRTYVWAEFNERGAIKIEAKDIRVPGLTVS 61

Query: 64  LDLAMFH---------PSFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAI 109
                 +            S++  AI  ++        G  + + SQ+    GLGSSAA+
Sbjct: 62  FSEDEIYFESDYGKAAEVLSYVRQAIELVREEADKNGRGITVSITSQIPVGAGLGSSAAV 121

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSI 169
            VA   A+  L    E + +EI    H + L VQG SSGID   S  GG I Y+  K+  
Sbjct: 122 AVATIGAVSRLLG-LELTNEEIGKLGHRVELLVQGASSGIDPTVSAIGGFIHYEKGKFEP 180

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL- 228
                  PI + Y+G    T +++  +     E P   EI + I   MGK+ + + + L 
Sbjct: 181 LPF-MELPIVVGYTGSSGSTKELVAMVRRTREEMP---EIIEPILLSMGKVVEKAKEILL 236

Query: 229 ----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
                    + L + MN   GLL+ LGVS  KLSE+V+  R     + +KI+G+G G C+
Sbjct: 237 SDLEEKIRFERLGKLMNINHGLLDALGVSTKKLSELVYAAR-TAGALGAKITGAGGGGCM 295

Query: 285 IALGKGDLNSLPYQS-------VNCHMHAKGIDIVPITP 316
            AL     + +           +   +  +G+ I  + P
Sbjct: 296 YALAPEKQSEVATAITIAGGTPMITEISKEGLRIEEVIP 334


>gi|119719800|ref|YP_920295.1| mevalonate kinase [Thermofilum pendens Hrk 5]
 gi|119524920|gb|ABL78292.1| mevalonate kinase [Thermofilum pendens Hrk 5]
          Length = 322

 Score =  192 bits (488), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 77/327 (23%), Positives = 139/327 (42%), Gaps = 22/327 (6%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           +     SAP  ++L GEH V+ G  A+  AI+ R  + +       I + S         
Sbjct: 1   MQATRSSAPAKVILFGEHFVVEGQPAIAAAISLRAHVTVEPADTDGILVYSKNLGLLEEY 60

Query: 65  DLAMFHPSFS-------FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             A                  A+  +    G  + V S++    G+GSSAA+ VA T A 
Sbjct: 61  RFAERGAWSGKMLSIAIAAYTAMESLGRKSGVKVTVDSEIPPGSGMGSSAAVAVATTHAT 120

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
               + +EP   E+   A      V G  SGID   + +GG+I Y+  +  I     +  
Sbjct: 121 FR-AFGEEPDLKEVSRIAFEAEKVVHGKPSGIDNTVATYGGVIAYRKGEGFIPLKAELNG 179

Query: 178 IHLI--YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKV 235
           + L+   SG    T +++K++  ++  YP + E    +Y   G+L   + + L   + + 
Sbjct: 180 VRLVLADSGVPRNTGEMVKRVLELKNTYPSVLE---PLYHAAGRLVVEAARRLEEGDYES 236

Query: 236 LAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSL 295
           L + MN   G L  +GVS  +L ++V+  R     + SK++G+G G  ++AL   +    
Sbjct: 237 LGRLMNVNHGFLSAIGVSTLELEKLVYTARR-AGALGSKLTGAGGGGFIVALVTAEKEKE 295

Query: 296 PYQSVNC--------HMHAKGIDIVPI 314
             +++           + ++G+   P+
Sbjct: 296 VVEALRQLSPRIFSVEISSEGVRKEPL 322


>gi|329926768|ref|ZP_08281176.1| galactokinase [Paenibacillus sp. HGF5]
 gi|328938968|gb|EGG35336.1| galactokinase [Paenibacillus sp. HGF5]
          Length = 392

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/355 (20%), Positives = 133/355 (37%), Gaps = 49/355 (13%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  HK+ +  APG + L+GEH   +G   L  A+     L +  R D  ++  S+   Y
Sbjct: 15  GESQHKVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDNKVSFSSTNIPY 74

Query: 61  CGSLDLAMFHPSF--------SFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAIT 110
             ++ L   +             +I  +N      S G+DL     + +  GL SSA+I 
Sbjct: 75  ELTISLDEDYGYKIDQWTDYPVGVITELNKIGCGLSSGYDLLYHGDIPNGAGLSSSASIE 134

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------- 159
           V    A L ++  +  + +    +     L V   S  +D  A  +G             
Sbjct: 135 VVTAYAFLKMEGKETDTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMCDTL 194

Query: 160 ----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---- 211
               + ++   Y I   +      L+ S Y    ++  + +  ++ E P ++ + Q    
Sbjct: 195 EYELVPFRTGAYKIVISNTNKRRGLVDSKYNERRSECDRALEILQKELPALSYLAQLNPD 254

Query: 212 ------------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-V 252
                             +      +    S +AL+  NL+V  Q MN+    L  L  V
Sbjct: 255 QFATLRDSIRDETVRRRAQHVVEENQRVLDSVKALKEGNLEVFGQYMNQSHDSLRYLYEV 314

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +  +L  +V + +  P  + S+++G+G G C ++L   D        V     A+
Sbjct: 315 TGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSLVHEDAVERFIAEVGQQYEAR 369


>gi|261405465|ref|YP_003241706.1| galactokinase [Paenibacillus sp. Y412MC10]
 gi|261281928|gb|ACX63899.1| galactokinase [Paenibacillus sp. Y412MC10]
          Length = 392

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/355 (20%), Positives = 133/355 (37%), Gaps = 49/355 (13%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  HK+ +  APG + L+GEH   +G   L  A+     L +  R D  ++  S+   Y
Sbjct: 15  GESQHKVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDNKVSFSSTNIPY 74

Query: 61  CGSLDLAMFHPSF--------SFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAIT 110
             ++ L   +             +I  +N      S G+DL     + +  GL SSA+I 
Sbjct: 75  ELTISLDEDYGYKIDQWTDYPVGVITELNKIGCGLSSGYDLLYHGDIPNGAGLSSSASIE 134

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------- 159
           V    A L ++  +  + +    +     L V   S  +D  A  +G             
Sbjct: 135 VVTAYAFLKMEGKETDTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMCDTL 194

Query: 160 ----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---- 211
               + ++   Y I   +      L+ S Y    ++  + +  ++ E P ++ + Q    
Sbjct: 195 EYELVPFRTGAYKIVISNTNKRRGLVDSKYNERRSECDRALEILQKELPALSYLAQLNPD 254

Query: 212 ------------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-V 252
                             +      +    S +AL+  NL+V  Q MN+    L  L  V
Sbjct: 255 QFATLRDSIQDETVRRRAQHVVEENQRVLDSVKALKEGNLEVFGQYMNQSHDSLRYLYEV 314

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +  +L  +V + +  P  + S+++G+G G C ++L   D        V     A+
Sbjct: 315 TGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSLVHEDAVERFIAEVGQQYEAR 369


>gi|315229907|ref|YP_004070343.1| mevalonate kinase [Thermococcus barophilus MP]
 gi|315182935|gb|ADT83120.1| mevalonate kinase [Thermococcus barophilus MP]
          Length = 333

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 90/336 (26%), Positives = 151/336 (44%), Gaps = 34/336 (10%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
           ++  SAP  ++L GEH V++G  A+  AI+ R  ++    K+  I I++   +  G    
Sbjct: 2   RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVWAEFNKNGRIRIEAKDIKIPGLTVS 61

Query: 63  --------SLDLAMFHPSFSFIIMAIN----HIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
                     D        S++  AIN          G  + + SQ+    GLGSSAA+ 
Sbjct: 62  FSESEIYFETDYGKAAEVLSYVREAINLVLEEAGKQKGVTVSITSQIPVGAGLGSSAAVA 121

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE 170
           VA   A+  L    E + +E+    H   L VQG SSGID   S  GG + Y+   +  E
Sbjct: 122 VATIGAVSKLLG-LELTKEEVAKLGHKTELLVQGASSGIDPTVSAIGGFLYYEKGTFE-E 179

Query: 171 KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-- 228
                 PI + Y+G    T +++ K   +   + E+ +I   I   MGK+ + + + +  
Sbjct: 180 LPAIELPIVVGYTGSSGSTKELVAK---VRRSFEEMPDIITPILNSMGKVVEKAKEVILA 236

Query: 229 ---RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
              +    ++L Q MN   GLL+ LGVS   LS++V+    +   + +KI+G+G G C+ 
Sbjct: 237 DYDKEIKFQLLGQLMNINHGLLDALGVSTKSLSDLVY-ASREAGALGAKITGAGGGGCMY 295

Query: 286 ALGKGDLNSLPYQS-------VNCHMHAKGIDIVPI 314
           AL  G  + +           +   +  +G+ I  +
Sbjct: 296 ALAPGKQSEVATAIKIAGGMPMITKISREGLRIEEV 331


>gi|14591399|ref|NP_143478.1| mevalonate kinase [Pyrococcus horikoshii OT3]
 gi|8928178|sp|O59291|KIME_PYRHO RecName: Full=Mevalonate kinase; Short=MK
 gi|3258054|dbj|BAA30737.1| 335aa long hypothetical mevalonate kinase [Pyrococcus horikoshii
           OT3]
          Length = 335

 Score =  189 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 94/340 (27%), Positives = 148/340 (43%), Gaps = 35/340 (10%)

Query: 5   LHK-ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG- 62
           + K +  SAP  ++L GEH V++G  A+  AI  R  +         I I++   +  G 
Sbjct: 1   MVKYVLASAPAKVILFGEHSVVYGKPAIASAIELRTYVRAQFNDSGNIKIEAHDIKTPGL 60

Query: 63  --SLDLAMFH---------PSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSA 107
             S      +            S++  AI           G D+ + SQ+    GLGSSA
Sbjct: 61  IVSFSEDKIYFETDYGKAAEVLSYVRYAIELALEESDKRVGIDVSITSQIPVGAGLGSSA 120

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY 167
           A+ VA   A+  L    E S +EI    H + L VQG SSGID   S  GG + Y+  K+
Sbjct: 121 AVAVATIGAVSRLLG-LELSKEEIAKLGHKVELLVQGASSGIDPTVSAVGGFLYYKQGKF 179

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
                    PI + Y+G    T +++     +   Y E+ E+ + I   MGKL   + + 
Sbjct: 180 EPLPF-MELPIVVGYTGSTGSTKELVA---MVRKRYEEMPELVEPILEAMGKLVDKAKEI 235

Query: 228 L-----RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
           +       + L  L + MN   GLL+ LGVS  KL E+V+  R     + +K++G+G G 
Sbjct: 236 ILSKLDEEEKLTKLGELMNINHGLLDALGVSTKKLGELVYAAR-TAGAIGAKLTGAGGGG 294

Query: 283 CVIALGKGDLNSLPYQS-------VNCHMHAKGIDIVPIT 315
           C+ AL  G    +           +   +  +G+ I  ++
Sbjct: 295 CMYALAPGRQREVATAIKIAGGIPMITRVSREGLRIEEVS 334


>gi|315645839|ref|ZP_07898960.1| galactokinase [Paenibacillus vortex V453]
 gi|315278600|gb|EFU41914.1| galactokinase [Paenibacillus vortex V453]
          Length = 386

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/355 (20%), Positives = 136/355 (38%), Gaps = 49/355 (13%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  H++ +  APG + L+GEH   +G   L  A+     L +  R D+ ++  S+   Y
Sbjct: 15  GESRHEVRIFNAPGRVNLIGEHLDYNGGYVLPAALEFGTTLIIRPRDDKKVSFSSTNIPY 74

Query: 61  CGSLDLAMFHPSFS--------FIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAIT 110
             ++ L   +   S         +I  ++ I    S G+DL     + +  GL SSA+I 
Sbjct: 75  ELTISLDEDYRYKSDQWTDYPVGVITELHKIGSNLSSGYDLLYHGDIPNGAGLSSSASIE 134

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------- 159
           V    ALL+++     + +    +     L V   S  +D  A  +G             
Sbjct: 135 VVTAYALLSMEGKAADTVEIAKLSQRVENLFVGVNSGIMDQFAVANGKQDHAILLMCDTL 194

Query: 160 ----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---- 211
               + +Q   Y I   +      L+ S Y    ++  + +  ++ E P +  + Q    
Sbjct: 195 EYELVPFQTGPYKIVISNTNKRRGLVDSKYNERRSECDRALEILQNELPALTYLAQLNPD 254

Query: 212 ------------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-V 252
                             +      +    S +AL+N +L+   Q MN+    L  L  V
Sbjct: 255 QFVTLQDNIQDETVRRRAQHVVEENQRVLDSVKALKNGDLESFGQYMNQSHDSLRYLYEV 314

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +  +L  +V + +  P  + S+++G+G G C ++L   D        V     ++
Sbjct: 315 TGDELDALVEEAQRIPGTLGSRMTGAGFGGCTVSLVHEDAVECFIAEVGQQYESR 369


>gi|308070306|ref|YP_003871911.1| galactokinase [Paenibacillus polymyxa E681]
 gi|305859585|gb|ADM71373.1| Galactokinase (Galactose kinase) [Paenibacillus polymyxa E681]
          Length = 392

 Score =  186 bits (471), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 73/355 (20%), Positives = 132/355 (37%), Gaps = 49/355 (13%)

Query: 2   GQCLHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  +++ +  APG + L+GEH   +G   L  A+     L L  R D  I+  S+   Y
Sbjct: 15  GESSNELRIFHAPGRVNLIGEHIDYNGGYVLPAALEFGTTLILRARNDDEIHFASTNLSY 74

Query: 61  CGSL----------DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
             S+          D  + +P    + +A   + PS G+DL    ++ +  GL SSA+I 
Sbjct: 75  EVSISRGEIGKNKTDEWVDYPVGVLVELAEKGVYPSNGYDLLYHGEIPNGAGLSSSASIE 134

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG------------- 157
           V    A LT++  +  + +  L +  A    V      +D  A  +G             
Sbjct: 135 VVTGYAFLTIEKQETDTVEIALLSQRAENNYVGVNCGIMDQFAVANGAADHAILLMCDTL 194

Query: 158 --GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP----------- 204
               + ++   Y +   +      L+ S Y    +Q  + +S ++ + P           
Sbjct: 195 DYRKVPFRTGDYKLVIGNTNKRRGLVDSAYNERRSQCAEALSILQQQEPSLEYLAQLDEA 254

Query: 205 EINEINQKIYALMGKLSQIS-----------CQALRNKNLKVLAQAMNRQQGLLETLG-V 252
              E+ + I     +                  AL    L    Q MN     L  L  V
Sbjct: 255 RFGELQRHIADETVRRRAQHVVEENARVLASVDALAANELAAFGQLMNASHDSLRDLYEV 314

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           S ++L  +V + R  P  + ++++G+G G C ++L   D      + V      +
Sbjct: 315 SCTELDVMVEEARRIPGTLGARMTGAGFGGCTVSLVHEDDVERFVKEVGEAYQTR 369


>gi|147921498|ref|YP_684687.1| mevalonate kinase [uncultured methanogenic archaeon RC-I]
 gi|110620083|emb|CAJ35361.1| mevalonate kinase [uncultured methanogenic archaeon RC-I]
          Length = 299

 Score =  186 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 82/300 (27%), Positives = 134/300 (44%), Gaps = 15/300 (5%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            +  SAPG + L GEH V++G  A+  AI+ R  + +T  +   I I S+        D 
Sbjct: 1   MVKYSAPGKVFLFGEHAVVYGKRAIACAIDLRTTVEITSSRQG-IRIQSAFK------DE 53

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              +P     +          G ++ V S++    GLGSSAA+T+A  AAL   +Y    
Sbjct: 54  PDKNPYIRVALKKFQQCAAVDGINISVSSKIPVASGLGSSAAVTIATIAALND-EYQTNL 112

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
           S DEI    H   L+VQG +S  D   S  GG +         +       + + Y+G  
Sbjct: 113 SLDEIAAMGHQTELEVQGAASPTDTFVSTMGGTVI---VPDKKKLPPITCGVVVGYTGIS 169

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             T++++ ++  ++  YP   EI   I   +G +S    + +   +   + + MN  QGL
Sbjct: 170 KSTSRMVSRVRTLKERYP---EIIDGIMDCIGNMSTRGEELVAKNDYVSIGELMNVNQGL 226

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L+ +GVS  +LS  V   R       +KI+G+G G C++AL + D       ++      
Sbjct: 227 LDAIGVSIPELSLQVNAAR-SCGAYGAKITGAGGGGCMVALCEPDRCKEIATAIGKSCGD 285


>gi|21227864|ref|NP_633786.1| mevalonate kinase [Methanosarcina mazei Go1]
 gi|20906278|gb|AAM31458.1| Mevalonate kinase [Methanosarcina mazei Go1]
          Length = 301

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 86/312 (27%), Positives = 144/312 (46%), Gaps = 17/312 (5%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            +  SAPG + L GEH V++G  A+  A+  R  +   L     I I S +G+     + 
Sbjct: 1   MVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELNDS--ITIQSQIGRTGLDFE- 57

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              HP  S +I  +    P  G  L V S +    GLGSSAA+T+A   AL  L      
Sbjct: 58  --KHPYVSAVIEKMRKSIPINGVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGF-GL 114

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
           S  EI    H I +KVQG +S  D   S  GG++     +           I +  +G  
Sbjct: 115 SLQEIAKLGHEIEIKVQGAASPTDTYVSTFGGVVTIPERRKLKTP---DCGIVIGDTGVF 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           + T +++  +  +   YP   ++ + +   +GK+S+I  Q + + +   + + MN  QGL
Sbjct: 172 SSTKELVANVRQLRESYP---DLIEPLMTSIGKISRIGEQLVLSGDYASIGRLMNVNQGL 228

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L+ LGV+  +LS++++  R       +KI+G+G G C++AL   +  +   ++V      
Sbjct: 229 LDALGVNILELSQLIYSARA-AGAFGAKITGAGGGGCMVALTAPEKCNQVAEAV----AG 283

Query: 307 KGIDIVPITPSH 318
            G  +    P+ 
Sbjct: 284 AGGKVTITKPTE 295


>gi|325958575|ref|YP_004290041.1| mevalonate kinase [Methanobacterium sp. AL-21]
 gi|325330007|gb|ADZ09069.1| mevalonate kinase [Methanobacterium sp. AL-21]
          Length = 329

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 86/330 (26%), Positives = 148/330 (44%), Gaps = 19/330 (5%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            ++  SAPG  +L GEH V++G  A+  A++KR  + ++ R+D L ++        G LD
Sbjct: 5   RQVTASAPGKTILFGEHAVVYGKPAIAAAVDKRAYVTISKREDHLTHVTVGDLGVSGFLD 64

Query: 66  LAMFH-----------PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           L                   +I+ A+   K     ++ V   +    GLGSSAA+TVA  
Sbjct: 65  LKNRTIQLENGSGMQRGILEYILKALIKAKTEDSVEVDVRLDIPIGAGLGSSAAVTVATI 124

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDF 174
            A  +       + + +   AH + L VQG +S ID + S +GG+I        + K++ 
Sbjct: 125 MAAASFN-QITLTNETMANLAHQVELDVQGAASPIDTSLSTYGGVIYLSKQPQKLVKLEI 183

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLK 234
              + ++  GY +      + +  +  +     E+   I   M  ++  + QA+   + K
Sbjct: 184 PHELPIVI-GYTSTRGNTGELVKLVRQKKDARPEVINPILDSMEAVANGARQAIIKGDHK 242

Query: 235 VLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
            +   MN  QGLL+ LGV+  +LS++V+  R Q   M SK++G+G G  +IA   G    
Sbjct: 243 TIGLLMNINQGLLDALGVNTEELSKMVFTARNQ-GAMGSKLTGAGGGGSMIAYCPG-REE 300

Query: 295 LPYQSVNCHMHAKGIDIVPITPSHSTSLYR 324
               S+N    A  I++          L +
Sbjct: 301 EVVSSINQFERAFQINV----AHEGVRLEK 326


>gi|322369525|ref|ZP_08044090.1| mevalonate kinase [Haladaptatus paucihalophilus DX253]
 gi|320551257|gb|EFW92906.1| mevalonate kinase [Haladaptatus paucihalophilus DX253]
          Length = 327

 Score =  184 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/331 (24%), Positives = 132/331 (39%), Gaps = 33/331 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG------ 62
             SAPG + L GEH V++G  A+  AI +R  + +  R D  + + +      G      
Sbjct: 3   VSSAPGKVYLFGEHAVVYGEPAVPCAIERRASVTVEARDDDRLRVHAKDLSIDGFTVEYS 62

Query: 63  ---------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
                    ++  ++      +I  AI   +     P  GFD+ V S +    GLGSSAA
Sbjct: 63  SETNATPDVNVSESLVRAGVGYIDAAIEQARDATDTPDAGFDITVESNIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           +TVA   A          S +       A +    G +S  D      GG +  +     
Sbjct: 123 VTVAAIDAATRELGVTLSSDEIADRAYKAELAVQDGEASRADTYCCATGGAVRVEGDDCR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
             +     PI + + G    T +++  +  +  EY    E  + I    G + +   Q L
Sbjct: 183 SIE-APDLPIVVGFDGGAGDTGKLVAGVRALRDEYDFAAETVENI----GDIVRQGEQVL 237

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
            + +L  L + MN   GLLE LGVS   L  +VW  R+    M +K++G+G G C++AL 
Sbjct: 238 ADGDLDELGKLMNFNHGLLEALGVSSRSLDNMVWAARD-AGAMGAKLTGAGGGGCIVALD 296

Query: 289 KGDLNSLPY-------QSVNCHMHAKGIDIV 312
             D              +    +  +G+ + 
Sbjct: 297 PTDETKTALRFTPGCEDAFRAELDTEGVRVE 327


>gi|229541583|ref|ZP_04430643.1| galactokinase [Bacillus coagulans 36D1]
 gi|229326003|gb|EEN91678.1| galactokinase [Bacillus coagulans 36D1]
          Length = 393

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 125/361 (34%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           APG + L+GEH   +G      AI          R DR I   S   +  G ++      
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAITMGTYALAKKRDDRNIRFVSLNFKEKGVIEFTLDDL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    + ++K        GFD  V   + +  GL SSA+I + +T  +L 
Sbjct: 84  AYNKAHDWANYPKGMLKYLKEAGHEIEQGFDCLVYGNIPNGAGLSSSASIEL-LTGVMLE 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
             ++ +    +++        +  G++SGI    ++  G                    +
Sbjct: 143 KLFNLKVERLDLVKLGQKTENQFIGVNSGIMDQFAVGMGKKDAGILLDCATLAYEYAPIK 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------EINEINQKIY 214
           +  + I  ++      L  S Y    A+    +  ++ +           E  E N++I 
Sbjct: 203 LDHHKILIMNTNKRRELADSKYNERRAECESALKQLQKKLDIETLGDLTEEAFEKNKEII 262

Query: 215 AL------------MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  +  AL+  +L    + +N     L     V+  +L  + 
Sbjct: 263 DNEIVRKRAKHAVYENARTLKALDALKRGDLPAFGELINASHRSLRDDYEVTGKELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+ + D      ++V      + G      T S   
Sbjct: 323 ETAWKQEGVLGARMTGAGFGGCAIAIVENDKVDAFIKNVGDVYEKEIGYRADFYTASIGD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|307265740|ref|ZP_07547292.1| galactokinase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919254|gb|EFN49476.1| galactokinase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 391

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/366 (16%), Positives = 130/366 (35%), Gaps = 52/366 (14%)

Query: 7   KICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
           +I V  APG + L+GEH   +G      A++      +  R D+ + + S        LD
Sbjct: 19  EIRVFYAPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDLKVELD 78

Query: 66  LAMF-----HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAA 116
           +        H   ++    +  ++       GF++     + +  GL SSA+I V    A
Sbjct: 79  IDNIIYDKSHDWANYPKGVLQVLQDEGYTFSGFEIVFEGDIPNGAGLSSSASIEVVTAVA 138

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LI 160
           +  + ++      E++           G++ GI    ++  G                 +
Sbjct: 139 INEV-FNLNIDRIELVKMCQRAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYV 197

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEI--------- 209
             ++  Y I   +      L+ S Y    ++  K + Y++   P   ++EI         
Sbjct: 198 PLKLEDYKILITNTNKRRGLLDSKYNERRSECEKALFYLQKALPIHNLSEISIEQFEEYK 257

Query: 210 ----------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
                       +      +    + +AL +K+L    + M      L     V+  +L 
Sbjct: 258 HLIPEEVLIKRARHVITENQRVLEAVKALNDKDLIKFGKLMVESHNSLRDDYEVTGKELD 317

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID--IVPIT 315
            +V +  +   ++ S+++G+G G C +++ K +      + V+ +   K G +  +    
Sbjct: 318 TLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEEAVPEFVEVVSKNYKQKIGYEPTVYITG 377

Query: 316 PSHSTS 321
                 
Sbjct: 378 IGEGAR 383


>gi|76802067|ref|YP_327075.1| mevalonate kinase [Natronomonas pharaonis DSM 2160]
 gi|76557932|emb|CAI49516.1| mevalonate kinase [Natronomonas pharaonis DSM 2160]
          Length = 329

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/332 (21%), Positives = 129/332 (38%), Gaps = 32/332 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG------ 62
             SAPG + L GEH V++G  A+  AI +R  + +  R D  + + ++     G      
Sbjct: 3   TSSAPGKVYLFGEHAVVYGEPAVPCAIQRRARVTVEERDDDRLQVQANDLTLDGFTVTWG 62

Query: 63  ---------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
                     +   +   +  +I  AI           CGFD+ V S +    GLGSSAA
Sbjct: 63  GETNDRPDVDVPAPLVEAAMGYIDGAIEQALDAVDVEECGFDITVESDIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           + VA   A +     +  +                G +S  D   S  GG +  +     
Sbjct: 123 VVVAGIDAAVRELGGELDAQAVAERAYEVEYEVQSGEASRADTFCSAVGGAVRVRGDDCR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
                   P  + Y G    T +++  +  +  EY    +  + I    G + +    AL
Sbjct: 183 RLDDVPTLPFVVGYDGGTGDTGELVAGVRELREEYDFAADTVESI----GDIVRKGEAAL 238

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
           +  +++ + + M+   GLL  LGVS   L  +VW  RE    + +K++G+G G C++AL 
Sbjct: 239 QRGDIEEVGRLMDFNHGLLSALGVSARSLDTMVWAARE-ADALGAKLTGAGGGGCIVALD 297

Query: 289 KGDLNSLPYQ-------SVNCHMHAKGIDIVP 313
           + +      +       +    +   G+ +  
Sbjct: 298 RTEQTHTALEYTPGCETAFRAALDTDGVRVEE 329


>gi|172056418|ref|YP_001812878.1| galactokinase [Exiguobacterium sibiricum 255-15]
 gi|229874589|sp|B1YIH8|GAL1_EXIS2 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|171988939|gb|ACB59861.1| galactokinase [Exiguobacterium sibiricum 255-15]
          Length = 390

 Score =  182 bits (461), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 62/344 (18%), Positives = 123/344 (35%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           APG + L+GEH   +G      A+          R D +    S   +  G +++A    
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCALTLGTHAVARKRDDVVFRFYSLNFEDDGIIEVAGDDL 83

Query: 70  -----HPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I+ ++        G D+ +   + +  GL SSA++ + I   L  
Sbjct: 84  TPQSAHGWANYAKGMIHVLREAGYRIDTGCDILIKGDIPNGAGLSSSASLELVIGVLLDK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L Y+ +    +++     +  +  G++SGI    +I  G                     
Sbjct: 144 L-YNLDIDRIDLVKYGQQVENQYIGVNSGIMDQFAIGMGKAGSGLLLDCETLDYTYAPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +  Y+I  ++      L  S Y    ++    ++Y++   P                   
Sbjct: 203 LSGYTIIIMNTNKRRELADSKYNERRSECEAALAYLQQYRPYASLGQWSMNEFETVSFED 262

Query: 205 EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
           E  E   +      + +  +  AL+   L+   Q MN     L     V+  +L  +V  
Sbjct: 263 ERLERRARHAISENERTLQALDALKEDRLEAFGQLMNASHRSLRVDYEVTGKELDTLVEA 322

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              QP ++ ++++G+G G C IA+ + D       +V      +
Sbjct: 323 AWAQPGVLGARMTGAGFGGCAIAIVEDDTVETFMTAVGHAYETE 366


>gi|300770437|ref|ZP_07080316.1| galactokinase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762913|gb|EFK59730.1| galactokinase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 384

 Score =  182 bits (461), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 71/364 (19%), Positives = 133/364 (36%), Gaps = 48/364 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V +PG + ++GEH   +    L  AINK V + +  R+D  I + ++  +    +  A
Sbjct: 20  IIVKSPGRINIIGEHTDYNDGFVLPAAINKAVYVAVAPRQDNNICLYAADFREMFQVSSA 79

Query: 68  MFHPSFS----FIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              P+      +I+  ++ I+       GF+L +   + +  GL SSAA+  A   AL  
Sbjct: 80  DLQPAEKGWPNYILGVVDQIQKRGLHVGGFNLFIDGDVPAGAGLSSSAAVECATAFALNE 139

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI--HGGLICYQMPKYS--------- 168
           L +    S  +I            G+  GI    +         +++   S         
Sbjct: 140 L-FSLNLSRIDIARIGQLAEHTYVGVKCGIMDQFASVLSEKDQVFRLDCRSLAYEYFPLE 198

Query: 169 -----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
                I  ++      L  S Y     +    +S+I   YPE+  +      ++ ++ + 
Sbjct: 199 LGEYMILLLNTNVKHSLGDSQYNKRREKCELGVSWIRENYPEVKSLRDVTIEMLDEVVKK 258

Query: 224 S---------------------CQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                                 CQA+   +L  L Q +      L +   VS  +L  +V
Sbjct: 259 RDEDVYIKCRYVVEENLRVVAACQAMEKGDLVSLGQHIYASHKGLSKAYQVSCEELDFLV 318

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                 P ++ +++ G G G C I L K D +    + ++     + G+ + P     + 
Sbjct: 319 DATYAYPDVLGARMMGGGFGGCTINLVKKDFSDQFIKEISESYQQQFGVSLTPYIVETAD 378

Query: 321 SLYR 324
              R
Sbjct: 379 GTTR 382


>gi|89094694|ref|ZP_01167630.1| GHMP kinase [Oceanospirillum sp. MED92]
 gi|89081040|gb|EAR60276.1| GHMP kinase [Oceanospirillum sp. MED92]
          Length = 309

 Score =  182 bits (461), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 116/310 (37%), Positives = 171/310 (55%), Gaps = 5/310 (1%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           +  I V  PGS++LMGEH VL G  AL  A++K + + L  R D  I+IDS+L QY   L
Sbjct: 1   MSTIKVKVPGSIMLMGEHAVLFGEKALACAVDKYIHIELVPRPDSEIHIDSALAQYQSVL 60

Query: 65  DLAMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
           +     P  SF+I A+         GF L++ S+   ++GLGSSAA+T  + AAL     
Sbjct: 61  EDIADEPKLSFVIAAVRRYSAKLPSGFLLRIQSEFSHKVGLGSSAAVTAGVVAALSAFTN 120

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIY 182
                          +    +G  SG DL ASI+G ++ Y++    I  +  +  I L Y
Sbjct: 121 QSLEPQALFDKALKIVHQVQEGRGSGTDLVASIYGAVVSYRVEPREITSLPALPEISLFY 180

Query: 183 SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR 242
           +GYKT T  VLK +    ++ P   E+  +IY LMG +++ +  AL+ KN   L + MN 
Sbjct: 181 AGYKTKTPDVLKIVEAKAVKQP---EVYSEIYKLMGLVTEKAEVALKQKNWLALGELMNN 237

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC 302
            QGL++ LGVSD  L +I++ LR    I+ +KISGSGLGDCV++LG     +LPY+ +  
Sbjct: 238 YQGLMDALGVSDRSLCDIIYSLRGSGRILGAKISGSGLGDCVLSLGNDSGLTLPYEQIPV 297

Query: 303 HMHAKGIDIV 312
            + A+G+ I 
Sbjct: 298 GVSAEGVTIE 307


>gi|289580123|ref|YP_003478589.1| mevalonate kinase [Natrialba magadii ATCC 43099]
 gi|289529676|gb|ADD04027.1| mevalonate kinase [Natrialba magadii ATCC 43099]
          Length = 328

 Score =  181 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 75/332 (22%), Positives = 125/332 (37%), Gaps = 33/332 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL----------- 57
             SAPG + L GEH V++G  A+  AI  R  + +  R D  + + +             
Sbjct: 3   VSSAPGKVYLFGEHAVVYGEPAVPCAIEVRARVGVERRDDSKLRVHADDLSLDGFTVEYG 62

Query: 58  GQYCGSLDLAMFHPSF----SFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
           G   G  D+ +          ++  AI  ++        GFD+ + S +    GLGSSAA
Sbjct: 63  GDADGRPDIDVSESLLVAATQYVDSAIEQVRDVTGEEDVGFDVTIESDIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           + VA   A            +              G +S  D   S  GG +  +     
Sbjct: 123 VVVAAIDAGTRALGTTLEPAELAERAYRTEYDVQDGQASRADTFCSATGGAVRVEGDDCR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
                   PI + + G    T +++  +  +  EY    E        +G + +   QAL
Sbjct: 183 SLD-APDLPIVIGFDGGAGETGELVAGVRGLREEY----EFAADTVETVGDVVRNGEQAL 237

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
              +++ L + MN   GLL  LGVS   L  +VW  R+      +K++G+G G C++AL 
Sbjct: 238 AAGDVEELGRLMNFNHGLLSALGVSSRSLDTMVWAARD-AGAYGAKLTGAGGGGCIVALD 296

Query: 289 KGDLNSLPY-------QSVNCHMHAKGIDIVP 313
             D              +    +  +G+  + 
Sbjct: 297 PTDETETALSFTPGCEDAFRAELAEEGVRRIE 328


>gi|289578904|ref|YP_003477531.1| galactokinase [Thermoanaerobacter italicus Ab9]
 gi|289528617|gb|ADD02969.1| galactokinase [Thermoanaerobacter italicus Ab9]
          Length = 390

 Score =  181 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/371 (16%), Positives = 131/371 (35%), Gaps = 52/371 (14%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+   +I V  APG + L+GEH   +G      A++      +  R D+ + + S     
Sbjct: 14  GRNEVEIRVFYAPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDL 73

Query: 61  CGSLDLAMF-----HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITV 111
              +DL        H   ++    +  ++       GF++     + +  GL SSA+I +
Sbjct: 74  KVEVDLDALNFDKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIEL 133

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------------- 158
               A+  + ++      E++           G++ GI    ++  G             
Sbjct: 134 VTAVAVNEV-FNLNIDRIELVKMCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTL 192

Query: 159 ---LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP----------- 204
               +  ++  Y I   +      L+ S Y    ++  K +SY++   P           
Sbjct: 193 EYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSECEKALSYLQRALPIHNLSEVSIEQ 252

Query: 205 ----------EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVS 253
                     E+     +      +    + +AL +K+L    + M      L+    V+
Sbjct: 253 FEEYKHLIPEEVLVKRARHVITENQRVLEAVKALNDKDLIKFGKLMVESHNSLKNDYEVT 312

Query: 254 DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI- 311
             +L  +V +  +   ++ S+++G+G G C +++ K +      + V+ +   K G +  
Sbjct: 313 GKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEEEVPDFIKVVSKNYKRKIGYEPT 372

Query: 312 -VPITPSHSTS 321
                      
Sbjct: 373 AYITGVGEGAR 383


>gi|29653946|ref|NP_819638.1| mevalonate kinase [Coxiella burnetii RSA 493]
 gi|154707393|ref|YP_001424027.1| phosphomevalonate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|161830011|ref|YP_001596533.1| mevalonate kinase [Coxiella burnetii RSA 331]
 gi|165918997|ref|ZP_02219083.1| mevalonate kinase [Coxiella burnetii RSA 334]
 gi|212212909|ref|YP_002303845.1| phosphomevalonate kinase [Coxiella burnetii CbuG_Q212]
 gi|29541209|gb|AAO90152.1| phosphomevalonate kinase [Coxiella burnetii RSA 493]
 gi|154356679|gb|ABS78141.1| phosphomevalonate kinase [Coxiella burnetii Dugway 5J108-111]
 gi|161761878|gb|ABX77520.1| mevalonate kinase [Coxiella burnetii RSA 331]
 gi|165917322|gb|EDR35926.1| mevalonate kinase [Coxiella burnetii RSA 334]
 gi|212011319|gb|ACJ18700.1| phosphomevalonate kinase [Coxiella burnetii CbuG_Q212]
          Length = 313

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 107/301 (35%), Positives = 162/301 (53%), Gaps = 4/301 (1%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
              APGSL+L+GE+ VL G  A+V AI+K + + L+ R D  INIDS LG+         
Sbjct: 4   KTKAPGSLMLLGEYAVLQGKTAIVAAIDKFISISLSPRHDEKINIDSPLGKLTLDCQSIK 63

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
             P F F++ A+   K   G D+ + S L   +GLGSSAA+TVA+  AL         + 
Sbjct: 64  LSPPFEFVLAALASKKLPSGCDINIQSTLPPAIGLGSSAAVTVALLTALNAWLQM-SMTK 122

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           +++   A  ++  VQG  SG D AASI+GG++ +  P +S+  +    PI  IYSG K  
Sbjct: 123 NDLWQQALTVIKTVQGKGSGADCAASIYGGVLAFSNPPFSVTSLKSRPPITAIYSGKKLT 182

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           TA+ +  ++    + P   +  Q+I   M +L+  + + +  KN   L + +N  Q L+ 
Sbjct: 183 TARAIDIVNQRRQKQP---DFYQQIDQRMNELTVQAIEIINAKNWPALGRLLNLGQELMA 239

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           T GVS+  L  ++  LR+QP I  +KISG+GLGDCVI +G    +  P  +    +  K 
Sbjct: 240 TFGVSNEILESLIEGLRKQPTIFGAKISGAGLGDCVIGIGTLKPDRFPRNNTEKKLGVKQ 299

Query: 309 I 309
           I
Sbjct: 300 I 300


>gi|156740995|ref|YP_001431124.1| galactokinase [Roseiflexus castenholzii DSM 13941]
 gi|229889779|sp|A7NI09|GAL1_ROSCS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|156232323|gb|ABU57106.1| galactokinase [Roseiflexus castenholzii DSM 13941]
          Length = 391

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/344 (16%), Positives = 110/344 (31%), Gaps = 44/344 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + V APG + L+GEH   +       AI++   +   LR D+L+ + SS      +  + 
Sbjct: 21  VIVRAPGRVNLIGEHTDYNDGFVFPVAIDRATYVAARLRHDQLVRVASSDLNEEDTFAID 80

Query: 68  M-------FHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                   +H     + +A+     P  G DL + S +    GL SSAA+ VA+  A   
Sbjct: 81  QIERSNRPWHNYIRGVALALRVAGHPLLGADLLIASDVPRGAGLSSSAALEVAVGYAFQV 140

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIF 176
           L        +  L    A    V      +D   ++ G     +       S   +    
Sbjct: 141 LNNLNILGEELALLAQGAENNFVGVQCGIMDQLIAVLGRADHALLIDCRDLSYRAVPLPP 200

Query: 177 PIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ-------------- 211
            + ++              Y     +    +  +   YP I  +                
Sbjct: 201 SVAVVICDSHIPRTLAASAYNQRRQECDMAVQLLRRWYPGIRALRDVSEDHLAAHSDALP 260

Query: 212 -------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                  +      + +    +AL   ++    + MN     L     VS   +  +V  
Sbjct: 261 EPIRSRARHVVRENRRTLQGAEALERGDVVTFGRLMNESHASLRDDYQVSLPDIDILVET 320

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    S+++G+G G C ++L + +      + +    H  
Sbjct: 321 AHHLAGCYGSRLTGAGFGGCTVSLVERNEVESFSRDLLRVYHNA 364


>gi|227538909|ref|ZP_03968958.1| galactokinase [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241418|gb|EEI91433.1| galactokinase [Sphingobacterium spiritivorum ATCC 33300]
          Length = 384

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 70/364 (19%), Positives = 131/364 (35%), Gaps = 48/364 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V +PG + ++GEH   +    L  AINK V + +  R+D  I + ++  +    +  A
Sbjct: 20  IIVKSPGRINIIGEHTDYNDGFVLPAAINKAVYVAVAPRQDNEICLYAADFREMFQVSAA 79

Query: 68  MFHPSFS----FIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              P+      +I+  ++ ++       GF+L +   + +  GL SSAA+  A   AL  
Sbjct: 80  DLQPAEKGWPNYILGVVDQLQKRGLHVGGFNLFIDGDVPAGAGLSSSAAVECATAFALNE 139

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI--HGGLICYQMPKYS--------- 168
           L +    S  +I            G+  GI    +         +++   S         
Sbjct: 140 L-FSLNLSRIDIARIGQLAEHTYVGVKCGIMDQFASVLSEKDQVFRLDCRSLAYEYFPLE 198

Query: 169 -----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQI 223
                I  ++      L  S Y     +    +S I   YPE+  +      ++ ++ + 
Sbjct: 199 LGDYMILLLNTNVRHSLGDSQYNKRREKCELGVSLIRERYPEVKSLRDVTVEILDEVVKN 258

Query: 224 S---------------------CQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                                 CQA+   +L  L Q +      L +   VS  +L  +V
Sbjct: 259 RDEDVYIKCRYVVEENLRVVAACQAMEKGDLISLGQHIYASHKGLSKAYQVSCEELDFLV 318

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                 P ++ +++ G G G C I L K D      + ++     + G+ + P     + 
Sbjct: 319 DTTYAYPDVLGARMMGGGFGGCTINLVKKDFLDQFVKEISASYQQQFGVSLTPYVVETAD 378

Query: 321 SLYR 324
              R
Sbjct: 379 GTTR 382


>gi|297545126|ref|YP_003677428.1| galactokinase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296842901|gb|ADH61417.1| galactokinase [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 390

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/371 (16%), Positives = 131/371 (35%), Gaps = 52/371 (14%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+   +I V  APG + L+GEH   +G      A++      +  R D+ + + S     
Sbjct: 14  GRNEVEIRVFYAPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDL 73

Query: 61  CGSLDLAMF-----HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITV 111
              +DL        H   ++    +  ++       GF++     + +  GL SSA+I +
Sbjct: 74  KVEVDLDALNFDKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIEL 133

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------------- 158
               A+  + ++      E++           G++ GI    ++  G             
Sbjct: 134 VTAVAVNEV-FNLNIDRIELVKMCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTL 192

Query: 159 ---LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP----------- 204
               +  ++  Y I   +      L+ S Y    ++  K +SY++   P           
Sbjct: 193 EYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSECEKALSYLQRALPIHNLSEVSIEQ 252

Query: 205 ----------EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVS 253
                     E+     +      +    + +AL +K+L    + M      L+    V+
Sbjct: 253 FEEYKHLIPEEVLVKRARHVITENQRVLEAVKALNDKDLIKFGKLMVESHNSLKNDYEVT 312

Query: 254 DSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI- 311
             +L  +V +  +   ++ S+++G+G G C +++ K +      + V+ +   K G +  
Sbjct: 313 GKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEEEVPDFIKVVSKNYKQKIGYEPT 372

Query: 312 -VPITPSHSTS 321
                      
Sbjct: 373 AYITGVGEGAR 383


>gi|298674294|ref|YP_003726044.1| mevalonate kinase [Methanohalobium evestigatum Z-7303]
 gi|298287282|gb|ADI73248.1| mevalonate kinase [Methanohalobium evestigatum Z-7303]
          Length = 304

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/297 (26%), Positives = 143/297 (48%), Gaps = 13/297 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            I  SAPG + L GEH V++G  A+  AI  R  +         I I+S LG+   + + 
Sbjct: 1   MITSSAPGKIYLFGEHAVVYGENAICCAIELRTHVQAEFNDH--IEINSVLGRSGLNFE- 57

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              HP  S  I  +    P  G  + + S+L    GLGSSAA+TV+   AL  L +H   
Sbjct: 58  --KHPYVSAAIERMKEFAPVDGVKININSELPVGSGLGSSAALTVSTIQALNHL-FHCGL 114

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
           S ++I    + +   VQG +S  D   S  GG   + +P     +++    I +  +   
Sbjct: 115 SLEQIADLGYNVEWDVQGNASPTDTYVSTMGG--VFMLPSRRKLELN-DCGIVIGDTKKN 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           + T +++  ++ ++  +P   EI   I + +GK++     ++ N + + + + MN  QGL
Sbjct: 172 SSTKKLVTNVAELKNRFP---EIVTSILSTIGKITYCGEYSVCNGDYESIGKLMNINQGL 228

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           L+++GV   +LS++++  R +     +K++G+G G C+IAL           ++   
Sbjct: 229 LDSIGVGSLELSQLIYSARSK-GAYGAKLTGAGGGGCMIALADASKTVDVSDAIKSA 284


>gi|84489658|ref|YP_447890.1| putative mevalonate kinase [Methanosphaera stadtmanae DSM 3091]
 gi|84372977|gb|ABC57247.1| putative mevalonate kinase [Methanosphaera stadtmanae DSM 3091]
          Length = 322

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 93/309 (30%), Positives = 152/309 (49%), Gaps = 15/309 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           KI   APG ++L GEH V++   A+  AI++ V + L  R D  I +   L  Y     L
Sbjct: 2   KIKAFAPGKIILFGEHTVVYKKPAIAVAIDRGVNVELIPRNDDNITVKLDLIDYYKKSQL 61

Query: 67  AMFHPSFS----------FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                ++           +I   IN  +   GFDL V  ++    GLGSSAA+TV+   A
Sbjct: 62  VNKKLNYKIDSQKKMITDYIYEVINLFEFEKGFDLTVDIKMYLGAGLGSSAAVTVSTLKA 121

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
            ++L  +K+     I  TA  I +K+QG +S ID + S +GG+I        + +IDF  
Sbjct: 122 -VSLYVNKQIDKKTIAQTAREIEIKIQGAASPIDTSMSTYGGIIFID-ENSKLNRIDFNM 179

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
            + LI S  +       K +  + ++Y +   I   I+  M +++  +  AL   N +++
Sbjct: 180 KLPLIVSNCEIS-GNTGKLVESVRLKYEKYPTIVGNIFKAMEQIAIDAKVALEKGNSELI 238

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
              MN  QGLL+ +GV+ ++LS++V+K RE      SK++GSG G C+IA    + +   
Sbjct: 239 GDLMNINQGLLDAIGVNTTELSDMVYKAREY-GAKGSKLTGSGGGGCIIAYTPENSDE-I 296

Query: 297 YQSVNCHMH 305
           Y+ +     
Sbjct: 297 YKQLRKDYA 305


>gi|300711103|ref|YP_003736917.1| mevalonate kinase [Halalkalicoccus jeotgali B3]
 gi|299124786|gb|ADJ15125.1| mevalonate kinase [Halalkalicoccus jeotgali B3]
          Length = 327

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/331 (21%), Positives = 129/331 (38%), Gaps = 33/331 (9%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG------ 62
             SAPG + L GEH V++G  A+  AI++R  + +  R D  +++ +      G      
Sbjct: 3   TASAPGKVYLFGEHAVVYGEPAVPCAISRRARVTVERRGDSRLHVHAEDLSLDGFTVEYS 62

Query: 63  ---------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
                     +   +   +  ++  A++  +     P  GFD+ V S +    GLGSSAA
Sbjct: 63  GEADATPDVDVSTDLVEAAMGYVDAAVSQAREAAGVPEAGFDVTVESAIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           + VA   A       +  + +       A     +G +S  D   S  GG +  +     
Sbjct: 123 VVVAGIDAATRELGVELSTTEIADRAYRAEYDVQEGQASRADTFCSATGGAVRVEGEDCR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
                   P  + + G    T +++  +  +   Y             +G + +   +AL
Sbjct: 183 AID-APDLPFVIGFDGGAGNTGELVAGVRELREHYS----FAANTVETVGDIVRQGERAL 237

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
              +L  L   M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++AL 
Sbjct: 238 AAGDLAELGTLMDFNHGLLSALGVSSRSLDRMVWAARD-AGAHGAKLTGAGGGGCIVALD 296

Query: 289 KGDLNSLPY-------QSVNCHMHAKGIDIV 312
           + +             +     + A+G+ + 
Sbjct: 297 ETEETETALRFTPGCEEGFRAELDAEGVRVE 327


>gi|251795042|ref|YP_003009773.1| galactokinase [Paenibacillus sp. JDR-2]
 gi|247542668|gb|ACS99686.1| galactokinase [Paenibacillus sp. JDR-2]
          Length = 390

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/368 (20%), Positives = 134/368 (36%), Gaps = 52/368 (14%)

Query: 7   KICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
           +I    APG + L+GEH   +G      A+     L +  R DR + + ++      SLD
Sbjct: 21  EIKAFHAPGRVNLIGEHTDYNGGYVFPAALTFGTTLLIRKRDDRQLGLATTNFPSSKSLD 80

Query: 66  LAM--------FHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
           +          +      I+  +    I+ S G+DL    ++ +  GL SSA+I V    
Sbjct: 81  IDKIAFDEADDWMNYPKGIVYELGQKGIQFSSGYDLLFHGEIPNGAGLSSSASIEVVTAY 140

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------- 159
           ALLT++  K     +I   +     +  G+  GI    ++  G                 
Sbjct: 141 ALLTMEG-KPTDTVQIALLSQKSENEFNGVQCGIMDQFAVANGKKDHAILLMCDTLEYEL 199

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK 219
           + +Q   Y +   +      L+ S Y    +Q  + +  ++  +PE+  + Q        
Sbjct: 200 VPFQSGAYKLVIGNTNKRRGLVDSAYNERRSQCEQAVVDLQAAFPELKLLGQINLEQFNA 259

Query: 220 LSQISC----------------------QALRNKNLKVLAQAMNRQQGLLETLG-VSDSK 256
              +                         AL+  +L+   Q MN     L  L  V+ S+
Sbjct: 260 NKHLIKDEVVRNRAQHVVEEIDRVLRSMDALKANDLEAFGQYMNGSHDSLRDLYEVTGSE 319

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPIT 315
           L  +V   R+ P ++ S+++G+G G C ++L   D      + V      A G+      
Sbjct: 320 LDAMVAAARQVPGVLGSRMTGAGFGGCTVSLVHEDSIERFKEEVGRKYTEATGLTPDFYV 379

Query: 316 PSHSTSLY 323
            S    + 
Sbjct: 380 CSIGNGVE 387


>gi|110668819|ref|YP_658630.1| mevalonate kinase [Haloquadratum walsbyi DSM 16790]
 gi|109626566|emb|CAJ53030.1| mevalonate kinase [Haloquadratum walsbyi DSM 16790]
          Length = 338

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/337 (22%), Positives = 127/337 (37%), Gaps = 34/337 (10%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG------ 62
             SAPG + L GEH V++G  A+  AI +R  + +  R D  I +++      G      
Sbjct: 3   ISSAPGKVYLFGEHAVVYGEPAVPCAIERRATVTVERRSDDHIRVEARDLSLDGFTVEYT 62

Query: 63  ---------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAA 108
                     +  A+   +  ++  A+   +     P  GFD+ V S +    GLGSSAA
Sbjct: 63  GDTEYRPDVDVPTALVDAAMGYVDAAVEQARDAADMPDAGFDIIVESDIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           + VA   A            +      +A      G +S  D   S  GG++  +  +  
Sbjct: 123 VVVAGIDAATRELNTPLDCREVARRAYNAEYDVQDGQASRADTFCSAMGGVVYVEGDECR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA- 227
                   P  + + G    T +++  +  +  EY    +    I  ++ +   +   A 
Sbjct: 183 RMT-APNLPFVIGFDGGAGDTGELVAGVRRLRSEYDFAAKTVGSIGEIVRQGETLLQNAN 241

Query: 228 ----LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDC 283
                    L  L Q M+   GLLE LGVS   L  +VW  RE      +K++G+G G C
Sbjct: 242 PETTPGQALLTELGQFMDFDHGLLEALGVSSRTLDNMVWAARE-AGAYGAKLTGAGGGGC 300

Query: 284 VIALGKGDLNSLPYQ-------SVNCHMHAKGIDIVP 313
           ++AL +        +            +   G+ +  
Sbjct: 301 IVALDETSETETALEYTAECHDVFRAELDRIGVRVEE 337


>gi|153207704|ref|ZP_01946351.1| mevalonate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218971|ref|YP_002305758.1| phosphomevalonate kinase [Coxiella burnetii CbuK_Q154]
 gi|120576400|gb|EAX33024.1| mevalonate kinase [Coxiella burnetii 'MSU Goat Q177']
 gi|212013233|gb|ACJ20613.1| phosphomevalonate kinase [Coxiella burnetii CbuK_Q154]
          Length = 313

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 106/301 (35%), Positives = 161/301 (53%), Gaps = 4/301 (1%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
              APGSL+L+GE+ VL G  A+V AI+K + + L+ R D  INIDS LG+         
Sbjct: 4   KTKAPGSLMLLGEYAVLQGKTAIVAAIDKFISISLSPRHDEKINIDSPLGKLTLDCQSIK 63

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
             P F F++ A+   K   G D+ + S L   +GLGSSAA+TVA+  AL         + 
Sbjct: 64  LSPPFEFVLAALASKKLPSGCDINIQSTLPPAIGLGSSAAVTVALLTALNAWLQM-SMTK 122

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
           +++   A  ++  VQG  SG D AASI+GG++ +  P +S+  +    PI  IYSG K  
Sbjct: 123 NDLWQQALTVIKTVQGKGSGADCAASIYGGVLAFSNPPFSVTSLKSRPPITAIYSGKKLT 182

Query: 189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE 248
           TA+ +  ++    + P   +   +I   M +L+  + + +  KN   L + +N  Q L+ 
Sbjct: 183 TARAIDIVNQRRQKQP---DFYPQIDQRMNELTVQAIEIINAKNWPALGRLLNLGQELMA 239

Query: 249 TLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG 308
           T GVS+  L  ++  LR+QP I  +KISG+GLGDCVI +G    +  P  +    +  K 
Sbjct: 240 TFGVSNEILESLIEGLRKQPTIFGAKISGAGLGDCVIGIGTLKPDRFPRNNTEKKLGVKQ 299

Query: 309 I 309
           I
Sbjct: 300 I 300


>gi|256750683|ref|ZP_05491569.1| galactokinase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750523|gb|EEU63541.1| galactokinase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 387

 Score =  179 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 57/363 (15%), Positives = 125/363 (34%), Gaps = 51/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL     
Sbjct: 25  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDLKVEVDLDALNF 84

Query: 70  ---HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     + +  GL SSA+I +    A+  + +
Sbjct: 85  DKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEV-F 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +      +++           G++ GI    ++  G                 +  ++  
Sbjct: 144 NLNIDRIKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEG 203

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K +SY++   P                     E
Sbjct: 204 YKILITNTNKRRGLLDSKYNERRSECEKALSYLQKALPVKNLSEITIEQFEEYKDLIPDE 263

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     K      K    + +AL +K+L    + M      L     V+  +L  +V + 
Sbjct: 264 VLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMIESHNSLRDDYEVTGKELDTLVEEA 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGID--IVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D+     + V  +     G    +          
Sbjct: 324 LKLKGVIGSRMTGAGFGGCTVSIVKEDVVEEFIEVVTHNYTQKIGYRPTVYITGIGEGAG 383

Query: 322 LYR 324
             +
Sbjct: 384 EIK 386


>gi|315151526|gb|EFT95542.1| galactokinase [Enterococcus faecalis TX0012]
          Length = 387

 Score =  179 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFCVARKRDDQKIRMFSDNFKEVGLIEFTLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|257388644|ref|YP_003178417.1| mevalonate kinase [Halomicrobium mukohataei DSM 12286]
 gi|257170951|gb|ACV48710.1| mevalonate kinase [Halomicrobium mukohataei DSM 12286]
          Length = 327

 Score =  179 bits (454), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 73/332 (21%), Positives = 131/332 (39%), Gaps = 31/332 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL------INIDSSLGQY 60
            +  SAPG + L GEH V++G  A+  AI +R  + +  R + L      + +D    +Y
Sbjct: 1   MVTASAPGKVYLFGEHAVVYGEPAVPCAIERRARVTVEERDEGLRVHLDDLTLDGFTIEY 60

Query: 61  CGS--------LDLAMFHPSFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSA 107
            G         +  ++      +I  A+         P  GF++ V S +    G+GSSA
Sbjct: 61  SGDATGRPDVNVSESLVEAGVGYINEAVEQARDAADAPDAGFEISVESSIPLGAGIGSSA 120

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKY 167
           A+ V +  A       +  + +              G +S  D   S  GG +  +    
Sbjct: 121 AVVVGVIKAATAELGIEIDAREVAERAYRVEHTVQDGEASRADTFCSAMGGAVRVEGDDC 180

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQA 227
              +     P  + Y G    T  ++  +  +  EY    +  + +    G + +   +A
Sbjct: 181 RRIEGVDTLPFVIGYDGGAGDTGALVAGVRQLRSEYDFAADTVEAV----GDIVREGERA 236

Query: 228 LRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           L+  +L  L + M+   GLL  LGVS   L  +VW  R+    + +K++G+G   CV+AL
Sbjct: 237 LQAGDLSELGELMDFNHGLLSALGVSSRSLDGMVWAARD-AGALGAKLTGAGGNGCVVAL 295

Query: 288 GKGDLNSLPY-------QSVNCHMHAKGIDIV 312
            + D              +    +  +G+ I 
Sbjct: 296 DETDATETALSYTPGCENAFRAALDTEGVRIE 327


>gi|301604944|ref|XP_002932110.1| PREDICTED: mevalonate kinase-like [Xenopus (Silurana) tropicalis]
          Length = 388

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 79/370 (21%), Positives = 139/370 (37%), Gaps = 54/370 (14%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            ++ VSAPG ++L GEH V+HG  AL   +N R  + +   KD  + I+        S D
Sbjct: 5   RELFVSAPGKVILHGEHAVVHGKMALAVGLNLRTFIRIRPCKDDTVLINLPNIGTKLSWD 64

Query: 66  LAMFH--------------------------------PSFSFIIMAINHIKPSCG-FDLK 92
           ++                                      +F+ + ++         D+ 
Sbjct: 65  VSQLQSLLPSFQDDPQNMEILKNFAGLTDGCKDTESLAVLAFLYLYLSISGRDLPSVDVV 124

Query: 93  VISQLDSQLGLGSSAAITVAITAALLTLQY--------------HKEPSPDEILTTAHAI 138
           V SQL +  GLGSSAA  V + AA+LT                   +   D I   A   
Sbjct: 125 VWSQLPTGAGLGSSAAYCVCLAAAMLTYCGRIADPMREEAKTSRWSQTELDLINQWAFQG 184

Query: 139 VLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISY 198
              + G  SG+D A    GG + YQ  + +  +   +  I L  +     T  ++  +  
Sbjct: 185 EKVIHGNPSGVDNAVGTWGGALQYQSGRITPIERVPMLHILLTNTKVPRSTKVLVAGVKE 244

Query: 199 IEIEYPEINE----INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSD 254
             +++P+I E        I     ++ +     L   +  VL + ++  Q  L  +GV  
Sbjct: 245 KLLKFPDIIEPVLSSIHAISQECQRVLKEMTAGLSMDHYSVLEELIDINQHHLNVIGVGH 304

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI 314
             L+ I     E+   + SK++G+G G C + L + D +    ++V   +   G      
Sbjct: 305 PSLNTICRVTAERG--LHSKLTGAGGGGCAVTLLRPDTDHTVVEAVKQELTDCGFQCWET 362

Query: 315 TPSH-STSLY 323
           +      S++
Sbjct: 363 SIGALGVSVH 372


>gi|222480241|ref|YP_002566478.1| mevalonate kinase [Halorubrum lacusprofundi ATCC 49239]
 gi|222453143|gb|ACM57408.1| mevalonate kinase [Halorubrum lacusprofundi ATCC 49239]
          Length = 338

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 72/334 (21%), Positives = 128/334 (38%), Gaps = 34/334 (10%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--------- 62
           APG + L GEH V++G  A+  AI +R  +    R D  + +++      G         
Sbjct: 6   APGKVYLFGEHAVVYGEPAVPAAIERRATVTAEPRSDDHVRVEAEDLSLNGFTVEYAGGT 65

Query: 63  ------SLDLAMFHPSFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSAAITV 111
                  +   +   +  ++  A+         P  GFD+ V S +    GLGSSAA+ V
Sbjct: 66  GDRPDVDVPAPLVEAAMGYVDAAVRQARDAADAPDAGFDITVESDIPLGAGLGSSAAVVV 125

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
           A   A            +      HA      G +S  D   S  GG +  +       +
Sbjct: 126 AGIDAATRALGEPLDRRELADRAYHAEYEVQDGQASRADTFCSTMGGAVRIEGDDCEPIE 185

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL--- 228
                P  + + G    T +++  +  +  EY    +  + I  ++    ++   A+   
Sbjct: 186 -APNLPFVVGFDGGAGDTGELVAGVGELREEYGFAADTVESIGDVVRTGEKLLADAVSEA 244

Query: 229 --RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
               + L  L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++A
Sbjct: 245 DPSPELLAELGELMDFNHGLLSALGVSARSLDAMVWAARD-AGAHGAKLTGAGGGGCIVA 303

Query: 287 LGKGDLNSLPY-------QSVNCHMHAKGIDIVP 313
           L   D +           ++    +  +G+ +V 
Sbjct: 304 LDASDASETALSFTHGCEEAFRAELATEGVRVVE 337


>gi|320160996|ref|YP_004174220.1| mevalonate kinase [Anaerolinea thermophila UNI-1]
 gi|319994849|dbj|BAJ63620.1| mevalonate kinase [Anaerolinea thermophila UNI-1]
          Length = 313

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 66/307 (21%), Positives = 128/307 (41%), Gaps = 13/307 (4%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINK-RVILYLTL---RKDRLINIDSSLGQY 60
           +  I  +APG ++L GEH V++G+ A+   +N+ R  + +      K   + I++     
Sbjct: 1   MTGIFATAPGKIILFGEHAVVYGYPAIAVPVNQVRAKVLILPIPANKPDEVYIEAPDIHL 60

Query: 61  CGSLDLAMFHPSFSFIIMAIN---HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
              L+   F      +I  +     +       +++ S +    GLGS AA++VA+  AL
Sbjct: 61  NSHLNQLAFKDPLRIVIEEVQNILRLSYLPPMRIRITSTIPVAAGLGSGAAVSVALARAL 120

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM-PKYSIEKIDFIF 176
                H     + I   A        G  SGID     +   + +Q    Y +  ++  F
Sbjct: 121 ANYLGH-PLPDETICQIAFRAEHSYHGTPSGIDNTVITYNQPLFFQKGKPYELLGVEKPF 179

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
            I +  +G  +PT +V+ ++     + P   E    ++  +G++   + + + + N+  L
Sbjct: 180 FIVIGNTGIASPTGEVVAEVRKNREQNP---EKYNALFEKIGQIVLYARKLIEHGNVVDL 236

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
              +     LL+ +GVS  +L  +V           +K+SG G G  +IAL   +     
Sbjct: 237 GSMLTENHCLLKEMGVSCKELDILVETAI-HAGAYGAKLSGGGKGGNMIALASSEKLPQI 295

Query: 297 YQSVNCH 303
            Q++   
Sbjct: 296 TQALRDA 302


>gi|257876601|ref|ZP_05656254.1| galactokinase [Enterococcus casseliflavus EC20]
 gi|257810767|gb|EEV39587.1| galactokinase [Enterococcus casseliflavus EC20]
          Length = 388

 Score =  179 bits (453), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 63/364 (17%), Positives = 123/364 (33%), Gaps = 56/364 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      AI          R+D+LI + S      G +       
Sbjct: 25  APGRINLIGEHTDYNGGYVFPAAITLGTYAVARKREDQLIQLYSENFPEKGVISFSLDEL 84

Query: 66  ----LAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD+     + +  GL SSA+I + +T   L 
Sbjct: 85  DYRKEDDWTNYPKGVVRFLKEAGQVIDRGFDIAFYGNIPNGAGLSSSASIEL-LTGVCLK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +    +  +++     +  +  G++SGI    +I  G                 +   
Sbjct: 144 DLFDLTLTTLDLVKIGKKVENEFIGVNSGIMDQFAIGMGQKDHALLLDTNTLNYEVVPAA 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
              Y +  ++      L  S Y    A+  + ++ ++                       
Sbjct: 204 FGDYVVAIMNTNKRRELADSKYNERRAECEEALARLQKSLAIDSLGALDEATFFANTALI 263

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
             P + +  +       + +  +  AL   +L+   Q +N     L     V+  +L  +
Sbjct: 264 DDPRLIKRAKHAVTE-NQRTLKAKAALTAGDLEEFGQLLNASHASLRDDYEVTGHELDTL 322

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPS 317
           V   +  P ++ ++++G+G G C IAL K    +    SV     A+ G   DI   +  
Sbjct: 323 VAAAQAHPAVLGARMTGAGFGGCGIALVKESEWADFEASVKAAYLAEIGYATDIYQASID 382

Query: 318 HSTS 321
               
Sbjct: 383 DGAR 386


>gi|167039736|ref|YP_001662721.1| galactokinase [Thermoanaerobacter sp. X514]
 gi|300915015|ref|ZP_07132330.1| galactokinase [Thermoanaerobacter sp. X561]
 gi|307724936|ref|YP_003904687.1| galactokinase [Thermoanaerobacter sp. X513]
 gi|166853976|gb|ABY92385.1| galactokinase [Thermoanaerobacter sp. X514]
 gi|300888739|gb|EFK83886.1| galactokinase [Thermoanaerobacter sp. X561]
 gi|307581997|gb|ADN55396.1| galactokinase [Thermoanaerobacter sp. X513]
          Length = 387

 Score =  179 bits (453), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 57/363 (15%), Positives = 124/363 (34%), Gaps = 51/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL     
Sbjct: 25  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDLKVEVDLDALNF 84

Query: 70  ---HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     + +  GL SSA+I +    A+  + +
Sbjct: 85  DKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEV-F 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +      +++           G++ GI    ++  G                 +  ++  
Sbjct: 144 NLNIDRIKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEG 203

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K +SY++   P                     E
Sbjct: 204 YKILITNTNKRRGLLDSKYNERRSECEKALSYLQKALPVKNLSEITIEQFEEYKDLIPDE 263

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     K      K    + +AL +K+L    + M      L     V+  +L  +V + 
Sbjct: 264 VLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMVESHNSLRDDYEVTGKELDTLVEEA 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGID--IVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D      + V  +     G    +          
Sbjct: 324 LKLKGVIGSRMTGAGFGGCTVSIVKEDAVEEFIKVVTHNYTQKIGYRPTVYITGIGEGAG 383

Query: 322 LYR 324
             +
Sbjct: 384 EIK 386


>gi|254478396|ref|ZP_05091774.1| galactokinase [Carboxydibrachium pacificum DSM 12653]
 gi|214035654|gb|EEB76350.1| galactokinase [Carboxydibrachium pacificum DSM 12653]
          Length = 409

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 53/360 (14%), Positives = 119/360 (33%), Gaps = 51/360 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL     
Sbjct: 44  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRDDKKVFMASLNFDLKVEVDLDSIFY 103

Query: 67  AMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     +    GL SSA+I +    A+  + +
Sbjct: 104 DKEHDWANYPKGVLKILQEEGYEFSGFEIVFGGNIPVGAGLSSSASIEMVTAVAVNEV-F 162

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +       ++           G++ GI    ++  G                 +   +  
Sbjct: 163 NLNIDRINLVKLCQRAENTFVGVNCGIMDQFAVGMGKKGHAILLKSDTLEYSYVPLNLEG 222

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K ++Y++   P                     E
Sbjct: 223 YKILITNTNKKRGLLDSKYNERRSECEKALTYLKKALPVKNLSEVTVERFEEYKDLIPDE 282

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     +      K    + +AL + ++    + M      L     V+  +L  +V + 
Sbjct: 283 VLRKRARHVITENKRVLDAVKALNDNDIVKFGKLMIESHNSLRNDFEVTGKELDTLVEEA 342

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGI--DIVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D      + V  +     G    +          
Sbjct: 343 LKLKGVVGSRMTGAGFGGCTVSIVKEDAVEEFIEVVTRNYTQKIGYAPTVYVTGVGEGAG 402


>gi|167037025|ref|YP_001664603.1| galactokinase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320115444|ref|YP_004185603.1| galactokinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855859|gb|ABY94267.1| galactokinase [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928535|gb|ADV79220.1| galactokinase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 387

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/363 (15%), Positives = 125/363 (34%), Gaps = 51/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL  F  
Sbjct: 25  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDLKVEVDLDAFIY 84

Query: 70  ---HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     + +  GL SSA+I +    A+  + +
Sbjct: 85  DKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEV-F 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +      +++           G++ GI    ++  G                 +  ++  
Sbjct: 144 NLNIDRIKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEG 203

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K +SY++   P                     E
Sbjct: 204 YKILITNTNKRRGLLDSKYNERRSECEKALSYLQKALPVKNLSEITIEQFEEYKDLIPDE 263

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     K      K    + +AL +K+L    + M      L     V+  +L  +V + 
Sbjct: 264 VLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMIESHNSLRDDYEVTGKELDTLVEEA 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGID--IVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D      + V  +     G    +          
Sbjct: 324 LKLKGVIGSRMTGAGFGGCTVSIVKEDAVEEFIKVVTHNYTQKIGYRPTVYITGIGEGAG 383

Query: 322 LYR 324
             +
Sbjct: 384 EIK 386


>gi|284162110|ref|YP_003400733.1| mevalonate kinase [Archaeoglobus profundus DSM 5631]
 gi|284012107|gb|ADB58060.1| mevalonate kinase [Archaeoglobus profundus DSM 5631]
          Length = 292

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 99/307 (32%), Positives = 161/307 (52%), Gaps = 15/307 (4%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPG ++L GEH V++G  A+V AIN R         D  I I+S LG+        
Sbjct: 1   MIASAPGKVILFGEHAVVYGRHAVVSAINLRCYAKAEKASD--ITIESPLGKTSLDF--- 55

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S+ I   + I+P  G  LK+ S +    GLGSS+A+TVA+    L L +    S
Sbjct: 56  KVHPYVSYAIKRFSEIRPVKGVYLKIWSDIPIASGLGSSSAVTVAVLK-SLDLLFETNLS 114

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
            +EI   A  + L VQGI SG D   S  GG      P+     I     + +IY+G  +
Sbjct: 115 NEEIFELARKVELDVQGIGSGTDPFVSTFGGTWLI--PERERIDIGDYLDLTVIYTGKAS 172

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL 247
            T+ +++K++ +   Y    ++ ++I+  +  +S  S  AL++++ + L+  +   Q LL
Sbjct: 173 ITSDMVRKVANLREMY---GDVIERIFDAIDSISLRSISALKDRDFEALSFLVRTNQLLL 229

Query: 248 ETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           + LGVS  ++ EIV KL  +   + +KI+G+G G  VIALG  DL+   Y+ ++  ++A+
Sbjct: 230 KALGVSCREIDEIVNKL--ENLGIPAKITGAGGGGSVIALGSVDLDG--YKCLSVSLNAE 285

Query: 308 GIDIVPI 314
           G+    +
Sbjct: 286 GVREEKV 292


>gi|326389714|ref|ZP_08211279.1| galactokinase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994196|gb|EGD52623.1| galactokinase [Thermoanaerobacter ethanolicus JW 200]
          Length = 387

 Score =  178 bits (452), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 57/363 (15%), Positives = 124/363 (34%), Gaps = 51/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL     
Sbjct: 25  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNFDLKVEVDLDALNF 84

Query: 70  ---HPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     + +  GL SSA+I +    A+  + +
Sbjct: 85  DKSHDWANYPKGVLKVLQDEGYDFSGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEV-F 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +      +++           G++ GI    ++  G                 +  ++  
Sbjct: 144 NLNIDRIKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEG 203

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K +SY++   P                     E
Sbjct: 204 YKILITNTNKRRGLLDSKYNERRSECEKALSYLQEALPVKNLSEITIEQFEEYKDLIPDE 263

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     K      K    + +AL +K+L    + M      L     V+  +L  +V + 
Sbjct: 264 VLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMIESHNSLRDDYEVTGKELDTLVEEA 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGID--IVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D      + V  +     G    +          
Sbjct: 324 LKLKGVIGSRMTGAGFGGCTVSIVKEDAVEEFIKVVTHNYTQKIGYRPTVYITGIGEGAG 383

Query: 322 LYR 324
             +
Sbjct: 384 EIK 386


>gi|148227080|ref|NP_001085920.1| galactokinase 1 [Xenopus laevis]
 gi|49118537|gb|AAH73540.1| MGC82807 protein [Xenopus laevis]
          Length = 388

 Score =  178 bits (452), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 64/363 (17%), Positives = 117/363 (32%), Gaps = 49/363 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS----LGQYCG 62
           +I V APG + L+GEH   +G   L  A+    ++  + R D  I+I ++       +  
Sbjct: 25  RISVFAPGRVNLIGEHTDYNGGFVLPMALPLVTVIVGSPRDDGHISIVTTAEGADKPHTV 84

Query: 63  SLDLAMFHPSF--------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
             +                +++   I H    P  GF+  + S +    GL SSA++ VA
Sbjct: 85  EFEAPQQGKPLVPGAPKWSNYVKGVIEHYRAGPVPGFNAVIASNVPLGGGLSSSASLEVA 144

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH---GGLICYQMPKYSI 169
               L  L      +  + L    A           +D   S+    G  +        +
Sbjct: 145 TYTFLQQLCNDDGDTVQKALACQKAEHTFAGVPCGIMDQFISVMGREGHALLIDCRSLDV 204

Query: 170 EKIDFIFPIHLIYSG------------YKTPTAQVLKKISYIEIE------YPEINEINQ 211
             +    P   +               Y     Q  +    ++ E        ++  + +
Sbjct: 205 TSLPLADPGLAVLITNSNVRHELTGSEYPERRRQCEETARTLKKESLRDASMEDLEAMKE 264

Query: 212 KIYALMGKLSQISC----------QALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
            +     K +               AL+  + K   + M      L     VS  +L E+
Sbjct: 265 SLTKTCYKRAHHVISEITRTTDAADALQRGDYKAFGKFMVESHNSLRDDYEVSCPELDEL 324

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI-TPSHS 319
           V    E P +  S+++G G G C + L +        Q +      +G     I  PS  
Sbjct: 325 VAIALEVPGVYGSRMTGGGFGGCTVTLLETSAAERAKQQIKAKY--RGTPTFYIAKPSAG 382

Query: 320 TSL 322
           + +
Sbjct: 383 SGI 385


>gi|307130125|ref|YP_003882141.1| galactokinase [Dickeya dadantii 3937]
 gi|306527654|gb|ADM97584.1| galactokinase [Dickeya dadantii 3937]
          Length = 383

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 63/347 (18%), Positives = 113/347 (32%), Gaps = 45/347 (12%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYC 61
              + V APG + L+GEH   +    L  AIN    +    R DR I +   D    Q  
Sbjct: 18  PAALTVQAPGRVNLIGEHTDYNDGFVLPCAINYSTTISAAPRDDRQIRVIAMDYDNQQDQ 77

Query: 62  GSLDLAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAI 113
            SLD  + H       +++   I H+K       G DL +   +    GL SSA++ VA+
Sbjct: 78  FSLDAPIEHHPQWQWANYVRGVIKHLKTRSDAFGGADLVISGDVPQGAGLSSSASLEVAV 137

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS- 168
             A+  L Y        +         +  G + GI           G  +         
Sbjct: 138 GKAIQAL-YQLPLDNVALALNGQEAENQFVGCNCGIMDQMISAQGKRGHALLIDCRSLET 196

Query: 169 ----------IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------- 202
                     +  I+      L+ S Y T   Q      + +++                
Sbjct: 197 RAVSMPDNVAVMIINSNVKRGLVDSEYNTRRQQCEAAARHFQVKALRDVSEADFATHVAG 256

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             E+     +        +  +  AL   +L+ + + M      +     ++   +  +V
Sbjct: 257 LDEVVARRARHIITENARTLAAADALTRGDLRQMGELMAASHVSMRDDFEITVPPIDTLV 316

Query: 262 WKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             ++         +++G G G C++AL      +    +V     AK
Sbjct: 317 EIVKAVIGAEGGVRMTGGGFGGCIVALIPQQHVTAVQNAVMREYPAK 363


>gi|20808332|ref|NP_623503.1| galactokinase [Thermoanaerobacter tengcongensis MB4]
 gi|24211715|sp|Q8R8R7|GAL1_THETN RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|20516938|gb|AAM25107.1| Galactokinase [Thermoanaerobacter tengcongensis MB4]
          Length = 390

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 53/360 (14%), Positives = 119/360 (33%), Gaps = 51/360 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      A++      +  R D+ + + S        +DL     
Sbjct: 25  SPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRDDKKVFMASLNFDLKVEVDLDSIFY 84

Query: 67  AMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              H   ++    +  ++       GF++     +    GL SSA+I +    A+  + +
Sbjct: 85  DKEHDWANYPKGVLKILQEEGYEFSGFEIVFGGNIPVGAGLSSSASIEMVTAVAVNEV-F 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +       ++           G++ GI    ++  G                 +   +  
Sbjct: 144 NLNIDRINLVKLCQRAENTFVGVNCGIMDQFAVGMGKKGHAILLKSDTLEYSYVPLNLEG 203

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------------------E 205
           Y I   +      L+ S Y    ++  K ++Y++   P                     E
Sbjct: 204 YKILITNTNKKRGLLDSKYNERRSECEKALTYLKKALPVKNLSEVTVERFEEYKDLIPDE 263

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     +      K    + +AL + ++    + M      L     V+  +L  +V + 
Sbjct: 264 VLRKRARHVITENKRVLDAVKALNDNDIVKFGKLMIESHNSLRNDFEVTGKELDTLVEEA 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGI--DIVPITPSHSTS 321
            +   ++ S+++G+G G C +++ K D      + V  +     G    +          
Sbjct: 324 LKLKGVVGSRMTGAGFGGCTVSIVKEDAVEEFIEVVTRNYTQKIGYAPTVYVTGVGEGAG 383


>gi|329765805|ref|ZP_08257371.1| mevalonate kinase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137648|gb|EGG41918.1| mevalonate kinase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 351

 Score =  178 bits (451), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 81/317 (25%), Positives = 141/317 (44%), Gaps = 18/317 (5%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD--- 65
             SAPG  +L GEH V++G  A++ AINKRV +      +  I + S +G+    L+   
Sbjct: 40  KASAPGKAILFGEHFVVYGIKAILCAINKRVTITAEKIPENKILVKSKIGELDLPLNKPI 99

Query: 66  ---LAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
               +   P +      I   K + G  + V S++ S +GLGSS+A  VA  AA+  L  
Sbjct: 100 SEINSPLKPFYYLANKMIEKHKQNTGIKIIVESEIPSGVGLGSSSACCVAGAAAISRL-- 157

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFIFPIHLI 181
            +E + ++IL  A      +   +SG D      GGL+ Y   K +S  +    F + + 
Sbjct: 158 FEESTKEKILEMAIEAERTIFQNTSGADCTVCTFGGLMEYDKSKGFSQIQSKSNFHLVIA 217

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            S  +  T +V+ K+   + +  +       +     +L       L+N +L+ L ++M+
Sbjct: 218 NSNIEHSTDEVVSKVRKFKEKNEK---TFSDMCQKESELINRVSTMLKNNDLEGLGKSMH 274

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN 301
             +  LE LG+S+ KL ++V    E      +KI+G+G G C+I+L          +   
Sbjct: 275 ENEEYLEILGISNDKLRDMVKIAGEA--SFGAKITGAGGGGCIISLTDESN----LEKTI 328

Query: 302 CHMHAKGIDIVPITPSH 318
             +  +  D   +    
Sbjct: 329 LKLRERNYDCFSVKIDF 345


>gi|310643493|ref|YP_003948251.1| galactokinase [Paenibacillus polymyxa SC2]
 gi|309248443|gb|ADO58010.1| Galactokinase [Paenibacillus polymyxa SC2]
          Length = 399

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/355 (20%), Positives = 133/355 (37%), Gaps = 49/355 (13%)

Query: 2   GQCLHKI-CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  +++    APG + L+GEH   +G   L  A+     L L  R D  I+  S+   Y
Sbjct: 22  GESSNELLIFHAPGRVNLIGEHIDYNGGYVLPAALEFGTTLILRARNDDQIHFASTNLSY 81

Query: 61  CGSL----------DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAIT 110
             S+          D  + +P    + +A   + PS G+DL    ++ +  GL SSA+I 
Sbjct: 82  EVSIPRGEIGKSKTDEWVDYPVGVLVELAEKGVYPSSGYDLLYHGEIPNGAGLSSSASIE 141

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG------------- 157
           V    A LT +  K  + +  L +  A    V      +D  A  +G             
Sbjct: 142 VVTGYAFLTTEKQKTDTVEIALLSQRAENNYVGVNCGIMDQFAVANGAANHAILLMCDTL 201

Query: 158 --GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEI------ 209
               + ++   Y +   +      L+ S Y    +Q  + +S ++ + P +  +      
Sbjct: 202 EYRKVPFRTGAYKLVIGNTNKRRGLVDSAYNERRSQCAEALSILQQQEPSLEYLAQLDEA 261

Query: 210 ----------NQKIYALMGKLSQISCQAL------RNKNLKVLAQAMNRQQGLLETLG-V 252
                     ++ +      + + + + L          L    Q MN     L  L  V
Sbjct: 262 RFGGLQHHIADETVRRRAQHVVEENARVLASVEALAANELAAFGQLMNASHDSLRDLYEV 321

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           S ++L  +V + R  P  + ++++G+G G C ++L   D      + V      +
Sbjct: 322 SCTELDVMVEEARRIPGTLGARMTGAGFGGCTVSLVHEDDVDRFVKEVGEAYQTR 376


>gi|282164309|ref|YP_003356694.1| mevalonate kinase [Methanocella paludicola SANAE]
 gi|282156623|dbj|BAI61711.1| mevalonate kinase [Methanocella paludicola SANAE]
          Length = 299

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/297 (24%), Positives = 138/297 (46%), Gaps = 15/297 (5%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
            SAPG + L GEH V++G  A+  AI+ R  + ++ RK R ++I S+        D    
Sbjct: 4   CSAPGKVFLFGEHAVVYGKRAIACAIDLRTTVEVS-RKSRGVHIHSAFK------DEPDK 56

Query: 70  HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
           +      +  +         ++ V S++    GLGSSAA+TVA   AL   ++    S  
Sbjct: 57  NLYIKTAVKRMQKCADIRNVNIAVSSRIPVASGLGSSAAVTVATIGALNE-EFSAGLSKK 115

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
           +I   A+   L+VQG +S  D   S  GG +       ++  I     I + ++G    T
Sbjct: 116 DIAYMAYQTELEVQGAASPTDTFVSTMGGTVVV-PDMRTLPPIT--CGIVVGHTGISKST 172

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
           ++++ ++  ++ +YP   ++   I   +G +S      ++  + + + + MN  QGLL+ 
Sbjct: 173 SRMVSRVRTLKEKYP---DVIDGIMDSIGDISARGEDLIKQNDYRSIGELMNVNQGLLDA 229

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           LG++  +LS  ++  R Q     +KI+G+G G C++A+           ++      
Sbjct: 230 LGITIPELSLQIYAAR-QHGAYGAKITGAGGGGCMVAICDDKNCKEIATAIGRSYGD 285


>gi|315174591|gb|EFU18608.1| galactokinase [Enterococcus faecalis TX1346]
          Length = 387

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIVFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFDQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|229546250|ref|ZP_04434975.1| galactokinase [Enterococcus faecalis TX1322]
 gi|300859706|ref|ZP_07105794.1| galactokinase [Enterococcus faecalis TUSoD Ef11]
 gi|307290714|ref|ZP_07570616.1| galactokinase [Enterococcus faecalis TX0411]
 gi|229308628|gb|EEN74615.1| galactokinase [Enterococcus faecalis TX1322]
 gi|300850524|gb|EFK78273.1| galactokinase [Enterococcus faecalis TUSoD Ef11]
 gi|306498214|gb|EFM67729.1| galactokinase [Enterococcus faecalis TX0411]
 gi|315030070|gb|EFT42002.1| galactokinase [Enterococcus faecalis TX4000]
 gi|315145476|gb|EFT89492.1| galactokinase [Enterococcus faecalis TX2141]
 gi|315162730|gb|EFU06747.1| galactokinase [Enterococcus faecalis TX0645]
          Length = 387

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/362 (19%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY------PEINEINQKIYALMG 218
             Y+I  ++      L  S Y    A+  + +  ++ E          +E  ++  AL+G
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELNSETFEQYQALIG 262

Query: 219 KLSQIS---------------CQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
             + I                 QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|227518324|ref|ZP_03948373.1| galactokinase [Enterococcus faecalis TX0104]
 gi|307272321|ref|ZP_07553579.1| galactokinase [Enterococcus faecalis TX0855]
 gi|312904797|ref|ZP_07763942.1| galactokinase [Enterococcus faecalis TX0635]
 gi|227074229|gb|EEI12192.1| galactokinase [Enterococcus faecalis TX0104]
 gi|306511016|gb|EFM80028.1| galactokinase [Enterococcus faecalis TX0855]
 gi|310631888|gb|EFQ15171.1| galactokinase [Enterococcus faecalis TX0635]
 gi|315146456|gb|EFT90472.1| galactokinase [Enterococcus faecalis TX4244]
 gi|315576814|gb|EFU89005.1| galactokinase [Enterococcus faecalis TX0630]
 gi|327534702|gb|AEA93536.1| galactokinase [Enterococcus faecalis OG1RF]
          Length = 387

 Score =  178 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|229550438|ref|ZP_04439163.1| galactokinase [Enterococcus faecalis ATCC 29200]
 gi|257423013|ref|ZP_05600003.1| galactokinase [Enterococcus faecalis X98]
 gi|307275198|ref|ZP_07556346.1| galactokinase [Enterococcus faecalis TX2134]
 gi|312952939|ref|ZP_07771796.1| galactokinase [Enterococcus faecalis TX0102]
 gi|229304418|gb|EEN70414.1| galactokinase [Enterococcus faecalis ATCC 29200]
 gi|257164837|gb|EEU94797.1| galactokinase [Enterococcus faecalis X98]
 gi|306508140|gb|EFM77262.1| galactokinase [Enterococcus faecalis TX2134]
 gi|310629135|gb|EFQ12418.1| galactokinase [Enterococcus faecalis TX0102]
 gi|315153638|gb|EFT97654.1| galactokinase [Enterococcus faecalis TX0031]
 gi|315156452|gb|EFU00469.1| galactokinase [Enterococcus faecalis TX0043]
 gi|315160057|gb|EFU04074.1| galactokinase [Enterococcus faecalis TX0312]
          Length = 387

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGIDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|225871237|ref|YP_002747184.1| galactokinase [Streptococcus equi subsp. equi 4047]
 gi|225700641|emb|CAW95199.1| galactokinase [Streptococcus equi subsp. equi 4047]
          Length = 390

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 60/354 (16%), Positives = 119/354 (33%), Gaps = 50/354 (14%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G      AI+         R+D+ +   S+  +  
Sbjct: 15  GKEPDAVFFS-PGRINLIGEHTDYNGGHVFPAAISLGTYGLARKREDQQLRFFSANFEEA 73

Query: 62  GSLDL----------AMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAI 109
           G +++           ++      ++  +         GF+L V   + +  GL SSA++
Sbjct: 74  GIIEVDLNQLTFDQADLWANYPKGVLSFLQKAGHLIDTGFELYVFGNIPNGSGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
            +        L        D I     A    +   S  +D  A   G            
Sbjct: 134 ELLTGIVAQELFGLDVERLDLIKIGQQAENHFIGVNSGIMDQFAIGMGADKQALYLDTNT 193

Query: 160 -----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-------------I 201
                +   +  + I  ++      L  S Y    A+  + +  +               
Sbjct: 194 LAYEAVPLDLGDHVIVIMNTNKRRELADSKYNERRAECEQALEELNALLDIKALGELDAQ 253

Query: 202 EYPEINEINQ--------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGV 252
            + E + + +        +   L  + +  + QAL    L+   + MN     LE    V
Sbjct: 254 RFDEYSYLIKDGKRLKRARHAVLENQRTLQARQALEAGALEQFGRLMNASHVSLEHDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +L  +V    EQ  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 314 TGPELDTLVHTAWEQEGVLGARMTGAGFGGCGIAIVAKDKVDSFIETVGKAYTK 367


>gi|255973257|ref|ZP_05423843.1| galactokinase [Enterococcus faecalis T1]
 gi|255964275|gb|EET96751.1| galactokinase [Enterococcus faecalis T1]
          Length = 388

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGIDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|256618650|ref|ZP_05475496.1| galactokinase [Enterococcus faecalis ATCC 4200]
 gi|256965531|ref|ZP_05569702.1| galactokinase [Enterococcus faecalis HIP11704]
 gi|257089480|ref|ZP_05583841.1| galactokinase [Enterococcus faecalis CH188]
 gi|256598177|gb|EEU17353.1| galactokinase [Enterococcus faecalis ATCC 4200]
 gi|256956027|gb|EEU72659.1| galactokinase [Enterococcus faecalis HIP11704]
 gi|256998292|gb|EEU84812.1| galactokinase [Enterococcus faecalis CH188]
          Length = 388

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|315169111|gb|EFU13128.1| galactokinase [Enterococcus faecalis TX1341]
          Length = 387

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGYVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPALIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|256852722|ref|ZP_05558092.1| galactokinase [Enterococcus faecalis T8]
 gi|256711181|gb|EEU26219.1| galactokinase [Enterococcus faecalis T8]
          Length = 388

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/362 (19%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY------PEINEINQKIYALMG 218
             Y+I  ++      L  S Y    A+  + +  ++ E          +E  ++  AL+G
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELNSETFEQYQALIG 263

Query: 219 KLSQIS---------------CQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
             + I                 QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|195978837|ref|YP_002124081.1| galactokinase [Streptococcus equi subsp. zooepidemicus MGCS10565]
 gi|195975542|gb|ACG63068.1| galactokinase GalK [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 390

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 61/354 (17%), Positives = 119/354 (33%), Gaps = 50/354 (14%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G      AI+         R+D+ +   S+  +  
Sbjct: 15  GKEPDAVFFS-PGRINLIGEHTDYNGGHVFPAAISLGTYGLARKREDQQLRFFSANFEEA 73

Query: 62  GSLDL----------AMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAI 109
           G +++           ++      ++  +         GF+L V   + +  GL SSA++
Sbjct: 74  GIIEVDLNQLTFDQADLWANYPKGVLSFLQKAGHLIDTGFELYVFGNIPNGSGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
            +        L        D I     A    +   S  +D  A   G            
Sbjct: 134 ELLTGIVAQELFGLDVERLDLIKIGQQAENHFIGVNSGIMDQFAIGMGADKQALYLDTNT 193

Query: 160 -----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-------------I 201
                +   +  + I  ++      L  S Y    A+  K +  +               
Sbjct: 194 LSYEAVPLDLGDHVIVIMNTNKRRELADSKYNERRAECEKALEELNALLDIKALGELDAQ 253

Query: 202 EYPEINEINQ--------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGV 252
            + E + + +        +   L  + +  + QAL    L+   + MN     LE    V
Sbjct: 254 RFDEYSYLIKDGKRLKRARHAVLENQRTLQARQALEAGALEQFGRLMNASHVSLEHDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +L  +V    EQ  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 314 TGPELDTLVHTAWEQEGVLGARMTGAGFGGCGIAIVAKDKVDSFIETVGKAYTE 367


>gi|29375647|ref|NP_814801.1| galactokinase [Enterococcus faecalis V583]
 gi|227552851|ref|ZP_03982900.1| galactokinase [Enterococcus faecalis HH22]
 gi|293382601|ref|ZP_06628532.1| galactokinase [Enterococcus faecalis R712]
 gi|293387491|ref|ZP_06632041.1| galactokinase [Enterococcus faecalis S613]
 gi|294780768|ref|ZP_06746127.1| galactokinase [Enterococcus faecalis PC1.1]
 gi|307269378|ref|ZP_07550725.1| galactokinase [Enterococcus faecalis TX4248]
 gi|307281671|ref|ZP_07561890.1| galactokinase [Enterococcus faecalis TX0860]
 gi|312899272|ref|ZP_07758608.1| galactokinase [Enterococcus faecalis TX0470]
 gi|312908080|ref|ZP_07767060.1| galactokinase [Enterococcus faecalis DAPTO 512]
 gi|312979027|ref|ZP_07790747.1| galactokinase [Enterococcus faecalis DAPTO 516]
 gi|38604757|sp|Q836P0|GAL1_ENTFA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|29343108|gb|AAO80871.1| galactokinase [Enterococcus faecalis V583]
 gi|227178029|gb|EEI59001.1| galactokinase [Enterococcus faecalis HH22]
 gi|291080001|gb|EFE17365.1| galactokinase [Enterococcus faecalis R712]
 gi|291083075|gb|EFE20038.1| galactokinase [Enterococcus faecalis S613]
 gi|294452158|gb|EFG20601.1| galactokinase [Enterococcus faecalis PC1.1]
 gi|306503902|gb|EFM73121.1| galactokinase [Enterococcus faecalis TX0860]
 gi|306514315|gb|EFM82883.1| galactokinase [Enterococcus faecalis TX4248]
 gi|310625891|gb|EFQ09174.1| galactokinase [Enterococcus faecalis DAPTO 512]
 gi|311288206|gb|EFQ66762.1| galactokinase [Enterococcus faecalis DAPTO 516]
 gi|311293557|gb|EFQ72113.1| galactokinase [Enterococcus faecalis TX0470]
 gi|315026908|gb|EFT38840.1| galactokinase [Enterococcus faecalis TX2137]
 gi|315033159|gb|EFT45091.1| galactokinase [Enterococcus faecalis TX0017]
 gi|315034129|gb|EFT46061.1| galactokinase [Enterococcus faecalis TX0027]
 gi|315171743|gb|EFU15760.1| galactokinase [Enterococcus faecalis TX1342]
 gi|315575440|gb|EFU87631.1| galactokinase [Enterococcus faecalis TX0309B]
 gi|315581002|gb|EFU93193.1| galactokinase [Enterococcus faecalis TX0309A]
 gi|323480310|gb|ADX79749.1| galactokinase [Enterococcus faecalis 62]
          Length = 387

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPALIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|299821932|ref|ZP_07053820.1| galactokinase [Listeria grayi DSM 20601]
 gi|299817597|gb|EFI84833.1| galactokinase [Listeria grayi DSM 20601]
          Length = 390

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 63/349 (18%), Positives = 117/349 (33%), Gaps = 50/349 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-------Y 60
           I   APG + L+GEH   +G      AI+       +LR+D  +   S            
Sbjct: 19  ILFFAPGRINLIGEHTDYNGGHVFPCAISLGTYGVASLREDDQVRFYSENFPDKGIISCT 78

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITA 115
              LD        ++    I ++K S      G D+     L +  GL SSA+I   +T 
Sbjct: 79  VNELDYRKKDDWANYPKGVIRYLKDSGYAINQGMDILFYGNLPNGAGLSSSASIE-MLTG 137

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------- 159
            ++   +  E S  E++     +     G++SGI    ++  G                 
Sbjct: 138 VIVKDLFQLEVSRLELIKLGQKVENAFIGVNSGIMDQFAVGMGKKDHAILLDCQTLDYEL 197

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE------------------- 200
           +  ++  + I  ++      L  S Y     +  + +  +                    
Sbjct: 198 VPLELQAHKIVIMNTNKRRELADSKYNERRQECEEAVKILNQALSIQALGELTNEEFTSH 257

Query: 201 -IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
             + P +     K        +  +  AL+   L    + MN     L     V+  +L 
Sbjct: 258 AEQLPPLMRKRAKHAVSENIRTLEAAAALKQGKLAAFGKLMNESHESLRDDYEVTGVELD 317

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V    + P ++ ++++G+G G C IA+ +        Q V      K
Sbjct: 318 ILVETAWQLPGVVGARMTGAGFGGCAIAIVEDAHIDTFIQQVGQRYQEK 366


>gi|307288206|ref|ZP_07568206.1| galactokinase [Enterococcus faecalis TX0109]
 gi|306500804|gb|EFM70123.1| galactokinase [Enterococcus faecalis TX0109]
 gi|315165368|gb|EFU09385.1| galactokinase [Enterococcus faecalis TX1302]
          Length = 387

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFTLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKKNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|255976251|ref|ZP_05426837.1| galactokinase [Enterococcus faecalis T2]
 gi|256958565|ref|ZP_05562736.1| galactokinase [Enterococcus faecalis DS5]
 gi|256962340|ref|ZP_05566511.1| galactokinase [Enterococcus faecalis Merz96]
 gi|257078127|ref|ZP_05572488.1| galactokinase [Enterococcus faecalis JH1]
 gi|257086424|ref|ZP_05580785.1| galactokinase [Enterococcus faecalis D6]
 gi|257418902|ref|ZP_05595896.1| galactokinase [Enterococcus faecalis T11]
 gi|255969123|gb|EET99745.1| galactokinase [Enterococcus faecalis T2]
 gi|256949061|gb|EEU65693.1| galactokinase [Enterococcus faecalis DS5]
 gi|256952836|gb|EEU69468.1| galactokinase [Enterococcus faecalis Merz96]
 gi|256986157|gb|EEU73459.1| galactokinase [Enterococcus faecalis JH1]
 gi|256994454|gb|EEU81756.1| galactokinase [Enterococcus faecalis D6]
 gi|257160730|gb|EEU90690.1| galactokinase [Enterococcus faecalis T11]
          Length = 388

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPALIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|257085669|ref|ZP_05580030.1| galactokinase [Enterococcus faecalis Fly1]
 gi|256993699|gb|EEU81001.1| galactokinase [Enterococcus faecalis Fly1]
          Length = 387

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 23  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 82

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 83  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 143 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 202

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 203 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFDQYQALIG 262

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 263 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 323 CAQEQPGVLGARMTGAGFGGCSIALVPKRNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 382

Query: 320 TS 321
             
Sbjct: 383 AR 384


>gi|118404092|ref|NP_001072199.1| galactokinase 1 [Xenopus (Silurana) tropicalis]
 gi|110645593|gb|AAI18745.1| hypothetical protein MGC145327 [Xenopus (Silurana) tropicalis]
          Length = 388

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 114/361 (31%), Gaps = 47/361 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS----LGQYCGS 63
           I V APG + L+GEH   +G   L  A+    ++  + R D  I+I ++       +   
Sbjct: 26  ISVFAPGRVNLIGEHTDYNGGFVLPMALPLVTVIVGSPRDDGQISIVTTAEGADEPHMVD 85

Query: 64  LDLAMFHPSF--------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
            +                +++   I H    P  GF+  + S +    GL SSA++ VA 
Sbjct: 86  FEAPKQGKPLVPGAPKWSNYVKGVIEHYRGGPVPGFNALIASSVPLGGGLSSSASLEVAT 145

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH---GGLICYQMPKYSIE 170
              L  L      +  + L    A           +D   S+    G  +        + 
Sbjct: 146 YTFLQQLCSDDGDTVQKALACQKAEHTFAGVPCGIMDQFISVMGREGHALLIDCRSLDVT 205

Query: 171 KIDFIFPIHLIYSG------------YKTPTAQVLKKISYIEIE------YPEINEINQK 212
            +    P   +               Y     Q  +    ++ E        E+  + + 
Sbjct: 206 PLPLADPGLAVLITNSNVRHELTGSEYPERRRQCEEAARALKKESLRDSSMEELEAMKES 265

Query: 213 IYALMGKLSQISC----------QALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     K ++              AL+  + K   + M      L     VS  +L E+V
Sbjct: 266 LTKTCYKRARHVISEIARTTDAADALQRGDYKAFGKLMVESHNSLRDDYEVSCPELDELV 325

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTS 321
               E P +  S+++G G G C + L +        Q +               PS  + 
Sbjct: 326 AIALEVPGVYGSRMTGGGFGGCTVTLLEASAAEGAKQQIKAKYRGS-PTFYITKPSAGSG 384

Query: 322 L 322
           +
Sbjct: 385 I 385


>gi|325571102|ref|ZP_08146674.1| galactokinase [Enterococcus casseliflavus ATCC 12755]
 gi|325156187|gb|EGC68373.1| galactokinase [Enterococcus casseliflavus ATCC 12755]
          Length = 385

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 63/364 (17%), Positives = 122/364 (33%), Gaps = 56/364 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      AI          R+D+LI + S      G +       
Sbjct: 22  APGRINLIGEHTDYNGGYVFPAAITLGTYAVARKREDQLIQLYSENFPEKGVISFQLDEL 81

Query: 66  ----LAMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  I         GFD+     + +  GL SSA+I + +T   L 
Sbjct: 82  DYRKEDDWTNYPKGVVRFIKEAGQGIDRGFDIAFYGNIPNGAGLSSSASIEL-LTGVCLK 140

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +       +++     +  +  G++SGI    +I  G                 +   
Sbjct: 141 DLFDLTLKTLDLVKIGKKVENEFIGVNSGIMDQFAIGMGQKDHALLLDTNTLNYEVVPAA 200

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
              Y +  ++      L  S Y    A+  + ++ ++                       
Sbjct: 201 FGDYVVAIMNTNKRRELADSKYNERRAECEEALARLQKSLAVDSLGALDEATFFANTALI 260

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
             P + +  +       + +  +  AL   +L+   Q +N     L     V+  +L  +
Sbjct: 261 DDPRLIKRAKHAVTE-NQRTLKAKAALTAGDLEEFGQLLNASHASLRDDYEVTGRELDTL 319

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC-HMHAKGI--DIVPITPS 317
           V   +  P ++ ++++G+G G C IAL K    +    SV   ++   G   DI   +  
Sbjct: 320 VAAAQAHPAVLGARMTGAGFGGCGIALVKASEWADFEASVKATYLAEIGYATDIYQASID 379

Query: 318 HSTS 321
               
Sbjct: 380 DGAR 383


>gi|326798763|ref|YP_004316582.1| galactokinase [Sphingobacterium sp. 21]
 gi|326549527|gb|ADZ77912.1| Galactokinase [Sphingobacterium sp. 21]
          Length = 394

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/356 (21%), Positives = 128/356 (35%), Gaps = 49/356 (13%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID----SSLGQ 59
             + + V +PG + L+GEH   +    L  AINK V L +       + +     S   +
Sbjct: 16  SQNPLIVRSPGRVNLIGEHTDYNEGLVLPAAINKNVYLAIAKNNTDKVRLYAIDLSDSFE 75

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
                          +I+  I  ++      + GFD+     +    GL SSAA+  A  
Sbjct: 76  TTVDAIKKTDKLWPDYILGVIEQLQLNNYAINEGFDIAFSGDIPQGAGLSSSAALECATA 135

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------- 158
            AL TL +    S  +I   + A   +  G++ G +D  AS+ G                
Sbjct: 136 FALSTL-FELHISKLDIALLSQAAENQFVGVNCGLMDQFASVFGKEQHLVKLDCADYSYE 194

Query: 159 LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMG 218
            I ++     I  +D      L  S Y     Q  + +  I   +P +  +      ++ 
Sbjct: 195 YIPFKTSDIKILLLDTQVKHSLASSAYNERREQCEEGVRLISRHHPSVTSLRHATEEMLL 254

Query: 219 KLS---------------------QISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
           K                       Q++C+ L+  + K   Q M      LE    VS  +
Sbjct: 255 KYVKPVDEIVYRRCSYVVAEIARLQLACEDLKKDDFKAFGQRMFETHEGLEKQYEVSCKE 314

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
           L  +V  ++   +++ +++ G G G C I L K D      Q V      + GI+I
Sbjct: 315 LDLLVQLVKGNQYVLGARMMGGGFGGCTINLVKADKAEEVAQQVAAAYKEQTGIEI 370


>gi|257082967|ref|ZP_05577328.1| galactokinase [Enterococcus faecalis E1Sol]
 gi|257415684|ref|ZP_05592678.1| galactokinase [Enterococcus faecalis AR01/DG]
 gi|256990997|gb|EEU78299.1| galactokinase [Enterococcus faecalis E1Sol]
 gi|257157512|gb|EEU87472.1| galactokinase [Enterococcus faecalis ARO1/DG]
          Length = 388

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 64/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPTLIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          +++      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKQNIDAFIEAIGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|220932898|ref|YP_002509806.1| galactokinase [Halothermothrix orenii H 168]
 gi|219994208|gb|ACL70811.1| galactokinase [Halothermothrix orenii H 168]
          Length = 404

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 70/363 (19%), Positives = 129/363 (35%), Gaps = 51/363 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC-----GSLD 65
           SAPG + L+GEH   +    L  AI K V +   LR DR I + S             L+
Sbjct: 26  SAPGRVNLIGEHTDYNDGFVLPMAIEKNVTMLGQLRHDRKIKVYSLDYDTELCFNLDKLE 85

Query: 66  LAMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
               H   ++++   + I+       G +L     +    GL SSAA+ V     +  L 
Sbjct: 86  KDEEHTWVNYVMGVADEIEKKGHKLKGMNLVFTGNVPQGSGLSSSAALEVVTAMTMADLN 145

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
              +  P E+     A      G++ G +D   S  G                 I ++  
Sbjct: 146 -ELDIDPVEMALLCQAAENNFVGVACGIMDQYISRLGHRDHALLIDCRTNEYELIPFKDK 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPE----------------INEI 209
           +Y I   +      L+ S Y T  ++  + +++   +                     E+
Sbjct: 205 RYRIVICNSKARRGLVDSEYNTRRSECNQAVAFFNEKLGRNITALRDVKLNEVGQYRGEL 264

Query: 210 NQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
           +  +Y     +   +       +AL+N + +   Q M      L     VS  +L  +V 
Sbjct: 265 SDSVYRRAHHVVSENERVLASVEALKNNDFEKFGQLMIESHQSLRDDYEVSCRELDCLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
              +Q  ++ ++++G+G G C + L   +   +  + +      + GI+   I  S    
Sbjct: 325 VALKQEGVLGARMTGAGFGGCTVNLVDINYVEVFIKGIKEGYKRETGIEP-EIYVSRPAE 383

Query: 322 LYR 324
             R
Sbjct: 384 GAR 386


>gi|91774304|ref|YP_566996.1| mevalonate kinase [Methanococcoides burtonii DSM 6242]
 gi|91713319|gb|ABE53246.1| mevalonate kinase [Methanococcoides burtonii DSM 6242]
          Length = 303

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/294 (27%), Positives = 144/294 (48%), Gaps = 13/294 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            I  SAPG + L GEH V++G  A+  A++ R  + ++      I I SSLG      ++
Sbjct: 1   MITCSAPGKVYLFGEHAVVYGEPAICCAVDIRTRVTVSPAD--TITISSSLGTTGIDFEV 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              HP  S ++     I    G DL++ S +    GLGSSAA+TVA   A+ TL      
Sbjct: 59  ---HPYVSAVLERFQDISSFDGVDLRISSDIPVGSGLGSSAAVTVATIKAMDTLLDLGLE 115

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             D+I    H +   +QG +S  D      GG++     +  +E I     I +  +   
Sbjct: 116 L-DDIAKMGHEVEQNIQGTASPTDTYVCTMGGVVLI-PQRKKLELI--DCGILIGNTNIF 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           + T +++  ++ +   +P   ++   + + +GKLS I    + +++   + + MN  QGL
Sbjct: 172 SSTKELVGNVADLNERFP---DVVGPVLSSIGKLSVIGEGLVNDRDYVSVGELMNIDQGL 228

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           L+ +GVS ++LS +++  RE      SKI+G+G G C++A+   +      +++
Sbjct: 229 LDAIGVSCAELSSLIYAARES-GAYGSKITGAGGGGCMVAISPRENVDSVAEAI 281


>gi|161527823|ref|YP_001581649.1| mevalonate kinase [Nitrosopumilus maritimus SCM1]
 gi|160339124|gb|ABX12211.1| mevalonate kinase [Nitrosopumilus maritimus SCM1]
          Length = 313

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/313 (22%), Positives = 129/313 (41%), Gaps = 12/313 (3%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL--DL 66
             SAPG ++L GEH V++G  A++ AINKR+ +      +R I+I S++G         +
Sbjct: 4   KASAPGKVILFGEHFVVYGVKAILCAINKRIAVTAEKIDERKISIKSNIGHLELEPNKPI 63

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
           +  +          N I     F +K+  + +  LG+G  ++    +  A       +  
Sbjct: 64  SEINSPLKPFYYLANKIIQDKNFGIKIDVESEIPLGVGLGSSSACCVAGAAAISNLFENN 123

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK-YSIEKIDFIFPIHLIYSGY 185
           S +EIL  A      +   +SG D      GGL+ Y     +S  + +  F + +  S  
Sbjct: 124 SKEEILKLAIEAEKTIFQNTSGADCTVCTFGGLMEYDKENGFSKIESEPNFHLVIANSNV 183

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
           +  T  V+  +   +           K+      L +   + L+  N++ L + + + Q 
Sbjct: 184 EHSTESVVAGVRKFKKNNE---AEFSKLCKDESHLIENVLELLKENNIRELGERVIKNQE 240

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH 305
            LE +G+S++KL E++     Q     +KI+G+G G C+ AL          ++      
Sbjct: 241 YLERIGISNAKLREMIQT--GQNSSFGAKITGAGGGGCIFALTDESN----LENTIKEFK 294

Query: 306 AKGIDIVPITPSH 318
            K  +   +    
Sbjct: 295 EKNHECFSVKIDF 307


>gi|256762080|ref|ZP_05502660.1| galactokinase [Enterococcus faecalis T3]
 gi|256683331|gb|EEU23026.1| galactokinase [Enterococcus faecalis T3]
          Length = 388

 Score =  176 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 65/362 (17%), Positives = 123/362 (33%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      AI          R D+ I + S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPAAITLGTFGVARKRDDQKIRMFSDNFKEVGLIEFSLEDL 83

Query: 65  ---DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              D   +      ++  +  +      G D+     + +  GL SSA+I + +      
Sbjct: 84  TYSDSDDWANYPKGVLNYLIESGHNIDSGLDVLFYGTIPNGAGLSSSASIELLMGTICND 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------GLICYQMPK--- 166
           L     P  + +          +   S  +D  A   G            + Y+M     
Sbjct: 144 LYALHCPMLELVQIGKKVENEFIGVNSGIMDQFAVGMGEKDQAILLDTNNMHYEMVPAKL 203

Query: 167 --YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM----- 217
             Y+I  ++      L  S Y    A+  + +  ++ E     + E++ + +        
Sbjct: 204 GEYTIVIMNTNKRRELADSKYNERRAECEEAVRLLQKELSIEFLGELDSETFEQYQALIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVW 262
                          + + ++ QAL   +L+     +N     L E   V+  +L  +V 
Sbjct: 264 DPALIKRARHAVTENERTLLAKQALTEGDLEEFGLLLNASHRSLKEDYEVTGIELDTLVA 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
             +EQP ++ ++++G+G G C IAL          ++V      K G   D  P +    
Sbjct: 324 CAQEQPGVLGARMTGAGFGGCSIALVPKRNIDAFIEAVGQSYQDKIGYAADFYPASIDDG 383

Query: 320 TS 321
             
Sbjct: 384 AR 385


>gi|251790468|ref|YP_003005189.1| galactokinase [Dickeya zeae Ech1591]
 gi|247539089|gb|ACT07710.1| galactokinase [Dickeya zeae Ech1591]
          Length = 383

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 63/347 (18%), Positives = 113/347 (32%), Gaps = 45/347 (12%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYC 61
              + V APG + L+GEH   +    L  AIN    +    R DR I    +D    Q  
Sbjct: 18  PAALTVQAPGRVNLIGEHTDYNDGFVLPCAINYSTTISAAPRDDRQIRVIAVDYDSQQDQ 77

Query: 62  GSLDLAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAI 113
            SLD  + H       +++   I H+K       G DL +   +    GL SSA++ VA+
Sbjct: 78  FSLDAPIEHHSQWQWANYVRGVIKHLKNRSDAFGGADLVISGDVPQGAGLSSSASLEVAV 137

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS- 168
             A+  L Y        +         +  G + GI           G  +         
Sbjct: 138 GKAIQAL-YQLPLDNVALALNGQEAENQFVGCNCGIMDQMISAQGQRGHALLIDCRSLET 196

Query: 169 ----------IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------- 202
                     +  I+      L+ S Y T   Q      + +++                
Sbjct: 197 RAVSMPDNVAVMIINSNVKRGLVDSEYNTRRQQCEAAARHFQVKALRDVSEADFAAKVAG 256

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             E+     +        +  +  AL   +L+ + + M      +     ++   +  +V
Sbjct: 257 LDEVVARRARHIITENARTLAAADALTRGDLRQMGELMAASHVSMRDDFEITVPPIDTLV 316

Query: 262 WKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             ++         +++G G G C++AL      +    +V     AK
Sbjct: 317 EIVKAVIGDEGGVRMTGGGFGGCIVALIPQQHVTAVQNAVMREYPAK 363


>gi|320037853|gb|EFW19790.1| mevalonate kinase [Coccidioides posadasii str. Silveira]
          Length = 571

 Score =  176 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 83/383 (21%), Positives = 140/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY------- 60
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T        +  +           
Sbjct: 126 FMVSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWD 185

Query: 61  CGSLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLK----------- 92
             SL   +FH S                    I   I+++ P    +++           
Sbjct: 186 IDSLPWDVFHHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFL 245

Query: 93  -----------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S +    GLGSSA++ V ++AALL     L       P   
Sbjct: 246 YLYLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDE 305

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    L + G  SG+D   S  G  + ++   YS   +          P
Sbjct: 306 SEVQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPMVIPILDFPELP 365

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ 
Sbjct: 366 LLLVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKHSSET 425

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L           GLL +LGVS  +L   + +L +   I  +K++G+G G C I L + D 
Sbjct: 426 LNYFGTLFRINHGLLVSLGVSHPRLER-IRELVDHTGIGWTKLTGAGGGGCAITLIRPDR 484

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            S   + +   +  +G +    T
Sbjct: 485 ESTALKPLERQLDEEGYERYETT 507


>gi|257867695|ref|ZP_05647348.1| galactokinase [Enterococcus casseliflavus EC30]
 gi|257874022|ref|ZP_05653675.1| galactokinase [Enterococcus casseliflavus EC10]
 gi|257801778|gb|EEV30681.1| galactokinase [Enterococcus casseliflavus EC30]
 gi|257808186|gb|EEV37008.1| galactokinase [Enterococcus casseliflavus EC10]
          Length = 388

 Score =  176 bits (445), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 62/364 (17%), Positives = 121/364 (33%), Gaps = 56/364 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      AI          R+D+LI + S      G +       
Sbjct: 25  APGRINLIGEHTDYNGGYVFPAAITLGTYAVARKREDQLIQLYSENFPEKGVISFSLDEL 84

Query: 66  ----LAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD+     + +  GL SSA+I + +T   L 
Sbjct: 85  DYRKEDDWTNYPKGVVRFLKEAGQVIDRGFDIAFYGNIPNGAGLSSSASIEL-LTGVCLK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +    +  +++     +  +  G++SGI    +I  G                 +   
Sbjct: 144 DLFDLTLTTLDLVKIGKKVENEFIGVNSGIMDQFAIGMGQKDHALLLDTNTLNYEVVPAA 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
              Y +  ++      L  S Y    A+  + ++ ++                       
Sbjct: 204 FGDYVVAIMNTNKRRELADSKYNERRAECEEALARLQKSLAIDSLGALDEATFFANTALI 263

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
             P + +  +       + +  +  AL   +L+   Q +N     L     V+  +L  +
Sbjct: 264 DDPRLIKRAKHAVTE-NQRTLKAKAALTAGDLEEFGQLLNASHASLRDDYEVTGHELDTL 322

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH-AKGI--DIVPITPS 317
           V   +  P ++ ++++G+G G C IAL K    +    SV        G   DI   +  
Sbjct: 323 VAAAQAHPAVLGARMTGAGFGGCGIALVKASEWADFEASVKAAYLVEIGYATDIYQASID 382

Query: 318 HSTS 321
               
Sbjct: 383 DGAR 386


>gi|328676770|gb|AEB27640.1| Galactokinase [Francisella cf. novicida Fx1]
          Length = 382

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN    +   G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSRDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   +  + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCEDIARFHSIKSLRELDSQKLEDTKSNFSEEDYK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYTSYLEKNYFEKFNIKPSF 370


>gi|328958465|ref|YP_004375851.1| galactokinase [Carnobacterium sp. 17-4]
 gi|328674789|gb|AEB30835.1| galactokinase [Carnobacterium sp. 17-4]
          Length = 392

 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 68/349 (19%), Positives = 133/349 (38%), Gaps = 52/349 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI        + R+D++IN  S      G       SL
Sbjct: 24  SPGRINLIGEHTDYNGGNVFPCAITLGTYGLASKREDQIINFYSENFSELGVISIDLDSL 83

Query: 65  DLAMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        ++    I  +K S      G D+     + +  GL SSA+I + +T  ++ 
Sbjct: 84  EYNQADKWTNYPKGMIKFLKESGYAINQGLDILYYGNIPNGAGLSSSASIEL-LTGFIVQ 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    E++ T   +  +  G++SGI    ++  G                 I   
Sbjct: 143 TLFDLDIDRLELIKTGQRVENEFIGVNSGIMDQFAVGKGEKDTAILLDCNTLEYELIPVV 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM---- 217
           + K+SI  ++      L  S Y    ++  + ++ ++       +  ++++ +A      
Sbjct: 203 LEKHSIVIMNTKKRRELADSKYNERRSECDQALAELQKVLTVSSLGALDEQTFAEHQSIL 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  NL+   Q MN     L     V+  +L  IV
Sbjct: 263 SNETILKRARHAVTENQRTLKAAVALKAGNLEEFGQLMNESHISLRDDYEVTGPELDAIV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGI 309
               +QP I+ ++++G+G G C IA+ + D        V   ++   G 
Sbjct: 323 QAAWDQPGILGARMTGAGFGGCAIAIVENDKIDDFIDQVGKQYLSQIGY 371


>gi|110803879|ref|YP_698665.1| galactokinase [Clostridium perfringens SM101]
 gi|123047390|sp|Q0ST92|GAL1_CLOPS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|110684380|gb|ABG87750.1| galactokinase [Clostridium perfringens SM101]
          Length = 387

 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 64/370 (17%), Positives = 115/370 (31%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+  + +  S PG + L+GEH   +G       I        TLR DR+    S   +  
Sbjct: 15  GKEPNSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAATLRDDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+   +      ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNNHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|208779073|ref|ZP_03246419.1| galactokinase [Francisella novicida FTG]
 gi|208744873|gb|EDZ91171.1| galactokinase [Francisella novicida FTG]
          Length = 381

 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 25  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 84

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 85  EISNTWQNYIKGVINIINQNFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 143

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 144 YQLNISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 203

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 204 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDYK 263

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 264 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 323

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 324 GIYGARMTGGGFGGSTIHLLPT----KLLKEYTSYLEKNYFEKFNIKPSF 369


>gi|187251019|ref|YP_001875501.1| galactokinase [Elusimicrobium minutum Pei191]
 gi|186971179|gb|ACC98164.1| Galactokinase [Elusimicrobium minutum Pei191]
          Length = 387

 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 59/346 (17%), Positives = 116/346 (33%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      A++         R D  I   S   +  G ++      
Sbjct: 23  APGRVNLIGEHIDYNGGYVFPCALSLGTYAAAAKRNDSKIRFFSKNFEDLGVIEVDINNI 82

Query: 66  ----LAMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +    IK   GFD+ +I  + +  GL SSA++ V     L  
Sbjct: 83  AYKKEDNWTNYPKGVIDVMKRKGIKLDTGFDVAIIGNIPNGAGLSSSASLEVCTGVLLND 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
             +  + S  +I         +  G++SG +D  AS +G                 +  +
Sbjct: 143 F-FDLKLSSTDIALIGQKTENEFIGLNSGIMDQFASANGKRDHAILLNTNTLQYKHVPLE 201

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY---------PEINEINQKIY 214
           +   SI   +      L  S Y    A+    ++ +  +          P+  +  + + 
Sbjct: 202 LEDASIVICNTNKRRELAGSKYNERRAECEAALAMLTKKLKIETLCDLTPDQFDRYKDLI 261

Query: 215 A------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  +   L   ++    + M      L     V+  +L  +V
Sbjct: 262 TDPIALKRAKHAVRENYRTLAAVGLLELGDINSFGKLMFDSHYSLRDDYEVTVFELDTMV 321

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +QP  + ++++G+G G C + + K D      ++V       
Sbjct: 322 DLAAQQPGAIGARMTGAGFGGCCVCIVKNDGVDSFIKNVGTGYEKA 367


>gi|303314949|ref|XP_003067483.1| mevalonate kinase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240107151|gb|EER25338.1| mevalonate kinase, putative [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 571

 Score =  175 bits (444), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 83/383 (21%), Positives = 140/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY------- 60
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T        +  +           
Sbjct: 126 FMVSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWD 185

Query: 61  CGSLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLK----------- 92
             SL   +FH S                    I   I+++ P    +++           
Sbjct: 186 IDSLPWDVFHHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFL 245

Query: 93  -----------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S +    GLGSSA++ V ++AALL     L       P   
Sbjct: 246 YLYLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDE 305

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    L + G  SG+D   S  G  + ++   YS   +          P
Sbjct: 306 SEVQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPMVIPILDFPELP 365

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ 
Sbjct: 366 LLLVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKHSSET 425

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L           GLL +LGVS  +L   + +L +   I  +K++G+G G C I L + D 
Sbjct: 426 LNYFGTLFRINHGLLVSLGVSHPRLER-IRELVDHTGIGWTKLTGAGGGGCAITLIRTDR 484

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            S   + +   +  +G +    T
Sbjct: 485 ESTALKPLERQLDEEGYERYETT 507


>gi|254372654|ref|ZP_04988143.1| galactokinase [Francisella tularensis subsp. novicida GA99-3549]
 gi|151570381|gb|EDN36035.1| galactokinase [Francisella novicida GA99-3549]
          Length = 382

 Score =  175 bits (443), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN    +   G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSRDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQGCEDIARFHSIKSLRELDSQKLEDTKLNFSEEDYK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVLEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++         I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYTSYLEKNYFQKFNIKPSF 370


>gi|323705073|ref|ZP_08116649.1| galactokinase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535499|gb|EGB25274.1| galactokinase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 385

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 54/348 (15%), Positives = 122/348 (35%), Gaps = 49/348 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      A++    + + +R D  + + S        +D+     
Sbjct: 24  SPGRVNLIGEHTDYNGGYVFPCALDFGTFMAIRMRDDGKVRLSSLNFDLKVEVDIDELIY 83

Query: 69  -----FHPSFSFIIMAIN-HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                +      ++  +        GFD      + +  GL SSA+I +    A+  +  
Sbjct: 84  DKKDDWANYPKGVLKVLQDEGYKLRGFDALYEGNIPNGAGLSSSASIELVTGVAMNEIL- 142

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY----------------QMPK 166
           +       ++           G++ GI    ++  G   Y                ++  
Sbjct: 143 NLGIDRVVLVKMCQKAENNFVGVNCGIMDQFAVGMGKADYAIFLKCDTIDYKYVPLKLDG 202

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------EINEINQ-------- 211
           Y I   +      L  S Y    +Q    +SY++ +          + E ++        
Sbjct: 203 YRIVISNTNKRRGLQDSKYNERRSQCEAALSYLKKKLDVDNLGQVTLEEFDRYKYLIPDD 262

Query: 212 ------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
                 +      +    + +AL+N ++K   Q M +    L     V+  +L  +V + 
Sbjct: 263 VLVKRARHVVTEDERVLDAVEALKNNDIKRFGQLMVQSHNSLRDDYEVTGKELDALVDEA 322

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
            +  +++ S+++G+G G C +++ K +      + V      + G + 
Sbjct: 323 LKLDYVLGSRMTGAGFGGCTVSIVKEEFIEDFIKEVTKGYKERIGYEP 370


>gi|118497281|ref|YP_898331.1| galactokinase [Francisella tularensis subsp. novicida U112]
 gi|194323583|ref|ZP_03057360.1| galactokinase [Francisella tularensis subsp. novicida FTE]
 gi|118423187|gb|ABK89577.1| galactokinase [Francisella novicida U112]
 gi|194322438|gb|EDX19919.1| galactokinase [Francisella tularensis subsp. novicida FTE]
          Length = 382

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 119/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQNFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDYK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++         I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYTSYLEKNYFQKFNIKPSF 370


>gi|89256690|ref|YP_514052.1| galactokinase [Francisella tularensis subsp. holarctica LVS]
 gi|115315098|ref|YP_763821.1| galactokinase [Francisella tularensis subsp. holarctica OSU18]
 gi|167010488|ref|ZP_02275419.1| galactokinase [Francisella tularensis subsp. holarctica FSC200]
 gi|169656666|ref|YP_001428915.2| galactokinase [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|254367998|ref|ZP_04984018.1| galactokinase [Francisella tularensis subsp. holarctica 257]
 gi|89144521|emb|CAJ79836.1| Galactokinase [Francisella tularensis subsp. holarctica LVS]
 gi|115129997|gb|ABI83184.1| galactokinase [Francisella tularensis subsp. holarctica OSU18]
 gi|134253808|gb|EBA52902.1| galactokinase [Francisella tularensis subsp. holarctica 257]
 gi|164551734|gb|ABU61960.2| galactokinase [Francisella tularensis subsp. holarctica FTNF002-00]
          Length = 382

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSSDIKGVDIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRKLDSQKLEDTKLNFSEEDHK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYASYLEKNYFEKFNIKPSF 370


>gi|322833816|ref|YP_004213843.1| galactokinase [Rahnella sp. Y9602]
 gi|321169017|gb|ADW74716.1| galactokinase [Rahnella sp. Y9602]
          Length = 382

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/347 (18%), Positives = 120/347 (34%), Gaps = 45/347 (12%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYC 61
              I + APG + L+GEH   +    L  AI+   ++    R DR I +   D    +  
Sbjct: 18  PATITIKAPGRVNLIGEHTDYNDGFVLPCAIDYETVIACAQRNDRTIRVIAADFDNDEDS 77

Query: 62  GSLDLAMF----HPSFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
            SLD  +     HP  +++   + H+    K   G D+ +   +    GL SSA++ VA+
Sbjct: 78  FSLDEPILHSDAHPWANYVRGVVKHLMLRNKDFSGADMVISGNVPQGAGLSSSASLEVAV 137

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG-------------- 158
             AL +L Y        +         +  G + G +D   S  G               
Sbjct: 138 GQALKSL-YDLPLDGVALALNGQEAENQFVGCNCGIMDQLISALGKENHSLLIDCRSLET 196

Query: 159 LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIE 202
                    ++  I+      L+ S Y     Q                       I+ E
Sbjct: 197 RAVSMPKNAAVVIINSNVKRGLVDSEYNARREQCEVAARFFGVKALRDVDPALFFSIQDE 256

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              +     +        +  +  AL + +LK + + M      +     ++  ++ ++V
Sbjct: 257 LDPVVARRARHVITENDRTLAAADALASGDLKRMGELMAESHASMRDDFEITVPQIDKLV 316

Query: 262 WKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             ++E        +++G G G C++AL   D+      +V    HA 
Sbjct: 317 EIVKEVIGDKGGVRMTGGGFGGCIVALVPEDMVEKVRHAVEQQYHAH 363


>gi|254374115|ref|ZP_04989597.1| hypothetical protein FTDG_00277 [Francisella novicida GA99-3548]
 gi|151571835|gb|EDN37489.1| hypothetical protein FTDG_00277 [Francisella novicida GA99-3548]
          Length = 382

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +    + FAINK   + +  R D ++ + S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVKVYSENLDDSSSFDITKIKQ 85

Query: 72  SF-----SFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                  ++I  AIN I         G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGAINIINQDFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   +  + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKSNFSEEDYK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYTSYLEKNYFEKFNIKPSF 370


>gi|325103381|ref|YP_004273035.1| galactokinase [Pedobacter saltans DSM 12145]
 gi|324972229|gb|ADY51213.1| galactokinase [Pedobacter saltans DSM 12145]
          Length = 384

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/365 (18%), Positives = 136/365 (37%), Gaps = 52/365 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---------DSSLG 58
           I V +PG + L+GEH   +    L  AINK + + +  R D ++++          ++L 
Sbjct: 21  IVVCSPGRVNLIGEHTDYNMGFVLPAAINKGIYIAIKKRDDDVVSLIAADLNKKHQTTLK 80

Query: 59  QYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
            Y  S D    +     +   +   K   GF+  +   +    G+ SSAA+  A+  +L 
Sbjct: 81  DYKYS-DDNWPNFILGVVDQLLKAGKHLSGFNAVISGDVPLGAGMSSSAALECAVAFSLN 139

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICY 162
            + +        ++  A     +  G+  G +D  AS+ G                 + +
Sbjct: 140 HI-FDLGLDKLSLVQKAQKAENEFVGLQCGIMDQFASVFGKKKHVIKLDCRSLEYEYVPF 198

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
            +    I   D +    L  S Y    +Q  + +S I+  YP++  +      ++    +
Sbjct: 199 DIEGIKIVLFDSMVKHSLASSEYNVRRSQCEEGVSIIQQTYPQVKTLRDATLEMVETCLK 258

Query: 223 IS---------------------CQALRNKNLKVLAQAMNRQQGLLETLG-VSDSKLSEI 260
            +                     C+ L++ +++   Q M      L  L  VS  +L  I
Sbjct: 259 HTSADIYNRCKYVVEENDRLLKACEDLKHGDIESFGQKMYDTHEGLSKLYEVSCPELDFI 318

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC-HMHA--KGIDIVPITPS 317
               +++  I+ +++ G G G CVIAL K        + +   +     KG+++      
Sbjct: 319 AANAKKESAILGARMMGGGFGGCVIALVKEAEVDEVVKRMKDLYFQKMNKGMNVYITQIE 378

Query: 318 HSTSL 322
             T +
Sbjct: 379 DGTRI 383


>gi|253574887|ref|ZP_04852227.1| galactokinase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845933|gb|EES73941.1| galactokinase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 392

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/373 (18%), Positives = 128/373 (34%), Gaps = 52/373 (13%)

Query: 2   GQCLHKICVS-APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+    I V  APG + L+GEH   +G      A+     L +  R D  +   SS   Y
Sbjct: 16  GESAEPIRVFNAPGRVNLIGEHIDYNGGYVFPAALEFGTTLAIRKRADGKVAFASSNLPY 75

Query: 61  CGSLDLAMF-----HPSFSF---IIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAIT 110
              L L             +   + + +  +  S   G+DL    ++ +  GL SSA+I 
Sbjct: 76  TAELALEELGTSKTGEWIDYPIGVYVELKKLGISLTSGYDLLFHGEIPNGAGLSSSASIE 135

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------- 159
           V    A ++++  KE    EI   +     +  G++SGI    ++  G            
Sbjct: 136 VVTALAFVSMEG-KELDKVEIARLSQRAENQYVGVNSGIMDQFAVANGAKDHAILLMCDT 194

Query: 160 -----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------- 204
                + ++   Y +   +      L+ S Y    ++    +  ++   P          
Sbjct: 195 LEYKLVPFRTGAYKLVIGNTKKRRGLVDSKYNERRSECDAALEILQKREPGLEFLAHLKP 254

Query: 205 ------------EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG- 251
                       E+     K           S  AL   +LK   + MN     L  L  
Sbjct: 255 EQLEQWRGDFTNEVLYKRAKHVVEENARVLKSVDALSANDLKAFGELMNASHDSLRDLYE 314

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID 310
           VS  +L  +V + R+    + ++++G+G G C ++L   D        V      + G++
Sbjct: 315 VSCLELDVMVEEARKIEGTLGARMTGAGFGGCTVSLVHEDSVERFVSEVGRSYKERTGLE 374

Query: 311 IVPITPSHSTSLY 323
                      ++
Sbjct: 375 GEFYVCGVGDGVH 387


>gi|289619064|emb|CBI54332.1| unnamed protein product [Sordaria macrospora]
          Length = 529

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/389 (19%), Positives = 138/389 (35%), Gaps = 76/389 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQ 59
              +    VSAPG +++ GEH V+HG AA+  AI+ R  L +    +  R + +     +
Sbjct: 75  SPMMPTFMVSAPGKVIVFGEHAVVHGKAAIAAAISLRSYLLVNTLSKSKRTVTLKFPDIE 134

Query: 60  YCGSLDLAMF----------------------HPSFSFIIMAINHIKPSCGFDLK----- 92
           +  S ++                               +   +  +      D++     
Sbjct: 135 FDHSWNIDELPWKIFQQPGKKKYYYSLVTEIDQELVDAVQPFLADVSIDKPADIRKVHQN 194

Query: 93  -----------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKE 125
                                  + S +    GLGSSA I V ++AALL    TL     
Sbjct: 195 SAGSFLYMFLSLGSQSFPGCQYTLRSTIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHP 254

Query: 126 PSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             P          I   A    + + G  SG+D   S  G  + +Q   Y+         
Sbjct: 255 DQPPEEARLQIERINRWAFVYEMFIHGNPSGVDNTVSTQGKAVVFQRTDYNQPPSVRPLW 314

Query: 178 IHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQ 226
                    + +     TA  + K++ ++ ++P++       I+Q  ++    + +    
Sbjct: 315 DFPKLPLLLVDTRTAKSTAHEVAKVATLKKKHPQLVGTILTAIDQVTHSSAQLIEEQGFN 374

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
               ++L  + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I 
Sbjct: 375 TEDEESLSKVGEMMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCSIT 433

Query: 287 LGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           L + ++       +   +  +G      T
Sbjct: 434 LLRPNVPREKLDKLEKQLDEEGYSKFETT 462


>gi|271499778|ref|YP_003332803.1| galactokinase [Dickeya dadantii Ech586]
 gi|270343333|gb|ACZ76098.1| galactokinase [Dickeya dadantii Ech586]
          Length = 383

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/347 (18%), Positives = 114/347 (32%), Gaps = 45/347 (12%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYC 61
              + V APG + L+GEH   +    L  AIN   I+    R DR I    +D    Q  
Sbjct: 18  PATLTVQAPGRVNLIGEHTDYNDGFVLPCAINYSTIISAAPRDDRQIRVIAVDYDNQQDS 77

Query: 62  GSLDLAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAI 113
            SLD  + H       +++   I H+K       G DL +   +    GL SSA++ VA+
Sbjct: 78  FSLDAPIDHHPQWQWANYVRGVIKHLKTRSDAFGGADLVISGNVPQGAGLSSSASLEVAV 137

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL-------------- 159
             A+  L Y        +         +  G + GI        G               
Sbjct: 138 GKAIQAL-YQLPLDNVALALNGQEAENQFVGCNCGIMDQMISAQGQRNHALLIDCRSLET 196

Query: 160 -ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------- 202
                    ++  I+      L+ S Y T   Q      Y +++                
Sbjct: 197 RAVSMPDNVAVMIINSNVKRGLVDSEYNTRRQQCEAAARYFQVKALRDVSEADFAAKAAG 256

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             E+     +        +  +  AL   +L+ + + M      +     ++   +  +V
Sbjct: 257 LDEVVARRARHIITENARTLAAADALTRGDLRQMGELMAASHASMRDDFEITVPPIDTLV 316

Query: 262 WKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             ++         +++G G G C++AL      +    +V     AK
Sbjct: 317 EIVKAVIGDEGGVRMTGGGFGGCIVALIPQQQVTAVQNAVMREYPAK 363


>gi|302876883|ref|YP_003845516.1| galactokinase [Clostridium cellulovorans 743B]
 gi|307687568|ref|ZP_07630014.1| galactokinase [Clostridium cellulovorans 743B]
 gi|302579740|gb|ADL53752.1| galactokinase [Clostridium cellulovorans 743B]
          Length = 388

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 61/363 (16%), Positives = 122/363 (33%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           APG + L+GEH   +G      A+          R D  + + S   +  G ++ ++   
Sbjct: 24  APGRVNLIGEHTDYNGGNVFPCALTIGTYAIARKRDDNKVRLYSDNFEQLGIIEFSVNEL 83

Query: 69  -------FHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I A   N  K   GF++     + +  GL SSA+I +A +  L  
Sbjct: 84  TNLKEHDWANYPKGVIWAFGQNGFKIEQGFEVLFYGNIPNGAGLSSSASIELATSIVLKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L          +  +  A    +   S  +D  A   G                    ++
Sbjct: 144 LFNVDVDMISMVKMSKLAENEFIGVNSGIMDQFAIGMGKENCAVLLDTNTLKYTYAPVEL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
              SI   +      L  S Y    ++    ++ ++ +     + E+ ++I+        
Sbjct: 204 GDASIIIANTNKRRGLADSKYNERRSECEAALAKLQEKLDINALGELTEEIFEENKNLIG 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + +AL N +L    Q MN     L     V+  +L  +V 
Sbjct: 264 DEIKIKRAKHAVYENQRTLKAVEALNNGDLATFGQLMNASHISLRDDYEVTGIELDTLVE 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
              +Q  ++ S+++G+G G C +++ K        ++V      K G        +    
Sbjct: 324 LAWKQEGVIGSRMTGAGFGGCTVSIVKNSEIDNFIKNVGDQYKEKIGYTADFYVVNVGDG 383

Query: 322 LYR 324
             +
Sbjct: 384 ARK 386


>gi|153814405|ref|ZP_01967073.1| hypothetical protein RUMTOR_00615 [Ruminococcus torques ATCC 27756]
 gi|317500113|ref|ZP_07958348.1| galactokinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331087660|ref|ZP_08336587.1| galactokinase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848801|gb|EDK25719.1| hypothetical protein RUMTOR_00615 [Ruminococcus torques ATCC 27756]
 gi|316898598|gb|EFV20634.1| galactokinase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330410352|gb|EGG89785.1| galactokinase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 390

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/364 (17%), Positives = 118/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      A+          R+DRL++  S      G ++ +    
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTLGTYGVARKREDRLMHFYSCNLDEIGVVETSLDDL 83

Query: 68  ------MFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++        K   GFD+ +   + +  GL SSA++ V     L  
Sbjct: 84  TNKDCYDWANYPLGVVWTFSEKGYKLDTGFDMVIWGNIPNGAGLSSSASLEVLTGVILTD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L    + SP ++            G + G +D      G                     
Sbjct: 144 LYGITDLSPIDLALFGQYSENNFNGCNCGIMDQFTVAVGKKDNAIFLDTNTLQYEYAPIL 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY---------PEINEINQKIY 214
           +    I   +      L+ S Y     +    +S ++ E          PE  E  + + 
Sbjct: 204 LEDSKIIITNSKVKHSLVTSEYNVRRQECADALSDLQKELSISSLGELTPEEFEEAKHLI 263

Query: 215 A------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL+  ++    + MN+    L     VS  ++  +V
Sbjct: 264 RDEVRVKRAKHAVYENQRTIAAVKALKEGDITKFGELMNQSHVSLRDDYEVSCKEIDLLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                 P ++ S+I+G G G C +++ K +      ++V      K G +          
Sbjct: 324 DLSWNTPGVIGSRITGGGFGGCTVSIVKNEAVDNFIKNVGEAYKEKFGYEAEFYVVDIGV 383

Query: 321 SLYR 324
              R
Sbjct: 384 GASR 387


>gi|294496197|ref|YP_003542690.1| mevalonate kinase [Methanohalophilus mahii DSM 5219]
 gi|292667196|gb|ADE37045.1| mevalonate kinase [Methanohalophilus mahii DSM 5219]
          Length = 305

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 86/316 (27%), Positives = 148/316 (46%), Gaps = 16/316 (5%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            I  SAP  + L GEH V++  +A+  AI+ R  + +   ++  I I+SSLG      ++
Sbjct: 1   MITCSAPAKVYLFGEHAVVYNESAICCAISIRTRVNIEYSEN--IVINSSLGTTGIDYEI 58

Query: 67  AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEP 126
              HP  S ++  I    P  G  + + S +    GLGSSAA+ VA   A   L      
Sbjct: 59  ---HPYVSAVVEKIRKKSPYRGVSISIESDIPVGSGLGSSAAVVVATICAFNNLL-KLGM 114

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYK 186
             + I +  H+I  ++QG +S  D   S  GG I   M ++          + +  +   
Sbjct: 115 DKESIASLGHSIEKEIQGSASAADTYVSTMGGTISIPMRQHLKNP---RCNLVIGNTNVF 171

Query: 187 TPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
           + T Q++ K++ ++  YP   E+   I + +GK S      L N++ + L + M+  QGL
Sbjct: 172 SSTGQLVAKVASLKTIYP---EVITPILSTIGKASLRGESLLENEDYRALGELMDVNQGL 228

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           LE +GVS ++LS ++   R     + +KI+G+G G C++AL   +      +++     A
Sbjct: 229 LEAIGVSCNELSRLIHSSRA-AGALGAKITGAGGGGCMVALVGNENIDAISRAIKN---A 284

Query: 307 KGIDIVPITPSHSTSL 322
            G+ IV         +
Sbjct: 285 GGVPIVTGVTDSGVRV 300


>gi|257053113|ref|YP_003130946.1| mevalonate kinase [Halorhabdus utahensis DSM 12940]
 gi|256691876|gb|ACV12213.1| mevalonate kinase [Halorhabdus utahensis DSM 12940]
          Length = 330

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/334 (22%), Positives = 129/334 (38%), Gaps = 32/334 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS----------- 55
            +  SAPG + L GEH V++G  A+  AI +R  +  T R D  + +D+           
Sbjct: 1   MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRASVTATRRDDEALRVDAGDLTLDGFTVE 60

Query: 56  ----SLGQYCGSLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSS 106
               + G+    ++  +   +  ++  A+        +P  GFD+ + S +    GLGSS
Sbjct: 61  YSGGTDGRPDVDVEQPLLEAAMGYVNEAVEQARDATGRPEAGFDVHIDSAIPLGAGLGSS 120

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           AA+ VA   A          S +              G +S  D   S  GG +  +   
Sbjct: 121 AAVVVAAIDAATRELGVTLDSEEIADRAYQVEHAVQDGEASRADTFCSAMGGAVRVEGDD 180

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
               +     P  + Y G    T  ++  +  +  EY    +  + I    G + +    
Sbjct: 181 CRRLEAVPNLPFVIGYDGGSGDTGALVSGVRGLRAEYDFAADTVEAI----GDVVRRGED 236

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           AL   +L  L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++A
Sbjct: 237 ALAAADLDELGRLMDFNHGLLSALGVSSRSLDAMVWAARDADARG-AKLTGAGGGGCIVA 295

Query: 287 LGKGDLNSLPY-------QSVNCHMHAKGIDIVP 313
           L   D              +    +  +G+ +  
Sbjct: 296 LDDTDGTETALRYTPGCEDAFRAELDTEGVRVEE 329


>gi|225867848|ref|YP_002743796.1| galactokinase [Streptococcus equi subsp. zooepidemicus]
 gi|225701124|emb|CAW97986.1| galactokinase [Streptococcus equi subsp. zooepidemicus]
          Length = 390

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/354 (17%), Positives = 121/354 (34%), Gaps = 50/354 (14%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G      AI+         R+D+ +   S+  +  
Sbjct: 15  GKEPDAVFFS-PGRINLIGEHTDYNGGHVFPAAISLGTYGLARKREDQQLRFFSANFEEA 73

Query: 62  GSLDLAMFHPSF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAI 109
           G +++ +   +F            ++  +         GF+L V   + +  GL SSA++
Sbjct: 74  GIIEVDLNQLAFDKADLWANYPKGVLSFLQKAGHPIDTGFELYVFGNIPNGSGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
            +        L        D I     A    +   S  +D  A   G            
Sbjct: 134 ELLTGIVAQELFGLDVERLDLIKIGQQAENHFIGVNSGIMDQFAIGMGADKQALYLDTNT 193

Query: 160 -----ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-------------- 200
                +   +  + I  ++      L  S Y    A+  K +  +               
Sbjct: 194 LSYEAVPLDLGDHVIVIMNTNKRRELADSKYNERRAECEKALEELNALLDIKALGELDAQ 253

Query: 201 --IEYPEINEINQKIYALMG-----KLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGV 252
              EY  + + ++++          + +  + QAL    L+   + MN     LE    V
Sbjct: 254 RFDEYSYLIKDSKRLKRARHAVLENQRTLQARQALEAGALEQFGRLMNASHVSLEHDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +L  +V    EQ  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 314 TGLELDTLVHTAWEQEGVLGARMTGAGFGGCGIAIVAKDKVDSFIETVEKTYTE 367


>gi|116206428|ref|XP_001229023.1| hypothetical protein CHGG_02507 [Chaetomium globosum CBS 148.51]
 gi|88183104|gb|EAQ90572.1| hypothetical protein CHGG_02507 [Chaetomium globosum CBS 148.51]
          Length = 532

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 82/389 (21%), Positives = 141/389 (36%), Gaps = 76/389 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-------------- 47
              +    VSAPG +++ GEH V+HG AA+  AI+ R  L +T                 
Sbjct: 80  SPMMPAFMVSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLLVTTLSKSKRTVTLKFPDID 139

Query: 48  -DRLINIDS---------SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLK----- 92
            D   NID          S  +Y  SL   +     + I   + ++ P     ++     
Sbjct: 140 FDHCWNIDELPWATFQQPSKKKYYYSLVTELDPELVAAIQPFLANVSPDKPAGIRKVHQN 199

Query: 93  -----------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKE 125
                                  + S +    GLGSSA I V ++AALL    TL     
Sbjct: 200 SAGSFLYMFLSLGSQSFPGCQYTLRSTIPIGAGLGSSATIAVCMSAALLLQLRTLAGPHP 259

Query: 126 PSP--------DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             P        + I   A+   + + G  SG+D   +  G  + +Q   Y          
Sbjct: 260 DQPADEARMQIERINRWAYVYEMFIHGNPSGVDNTVATQGKAVVFQRTDYGKPPSVRPLW 319

Query: 178 IHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQ 226
                    + +     TA  + K+  ++  +P +     + +++   A    L++    
Sbjct: 320 DFPELPLLLVDTRVPKSTAHEVAKVGKLKNTHPVLVGSILDAMDKVADASAEVLTEEGFD 379

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
                +L  + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I 
Sbjct: 380 TQSEASLARVGELMTVNHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCCIT 438

Query: 287 LGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           L K  +     + +   +  +G +    T
Sbjct: 439 LLKPGVERKKLRKLQAQLDEEGFEKFETT 467


>gi|89097010|ref|ZP_01169901.1| galactokinase [Bacillus sp. NRRL B-14911]
 gi|89088390|gb|EAR67500.1| galactokinase [Bacillus sp. NRRL B-14911]
          Length = 396

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/349 (18%), Positives = 125/349 (35%), Gaps = 52/349 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC-------GSL 64
           +PG + L+GEH   +G      AI       +  R DR++ + S             G L
Sbjct: 27  SPGRINLIGEHTDYNGGHVFPCAITLGTYGAVKKRNDRIVRVYSKNFPDAGIVEFSLGEL 86

Query: 65  DLAMFHPSFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +    H   +F    I +I+ +      G DL V   + +  GL SSA++ + I   +  
Sbjct: 87  EYKKEHGWANFPKGMIAYIEEAGWKLPVGIDLYVYGNIPNGAGLSSSASLEMLIGVTVNE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI----HGGLICYQMP---------- 165
           L         E++     +  +  G++SGI    +I     G  I               
Sbjct: 147 LFGF-NIGRIELVKLGKKVENEFIGVNSGIMDQFAIGMGQAGSAILLDCNTLKYEYAPIN 205

Query: 166 --KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-------------------- 203
              Y I  ++      L  S Y    ++    ++ ++ +                     
Sbjct: 206 LEDYQIMVMNTNKRRELADSKYNERRSECEAALAKLQSKLSISSLGELSEDEFEQHKQLI 265

Query: 204 -PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             ++ E   K      + +  + +AL+   L+   + MN     L+    V+  +L  +V
Sbjct: 266 GDKVLEKRAKHAVCENQRTLKAFKALQEGRLEDFGKLMNESHQSLKNDYEVTGKELDALV 325

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGI 309
               +Q   + ++++G+G G C IA+ + D  +   + V   +M   G 
Sbjct: 326 EAAWQQEGTLGARMTGAGFGGCAIAIVEKDKAASFIKEVGKKYMKRIGY 374


>gi|304316175|ref|YP_003851320.1| galactokinase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777677|gb|ADL68236.1| galactokinase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 387

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 53/348 (15%), Positives = 124/348 (35%), Gaps = 49/348 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      A++    + + +R D  + + S        +++     
Sbjct: 24  SPGRVNLIGEHTDYNGGYVFPCALDFGTFMAIRMRDDGKVRLSSLNFDLKVEVNINDLVY 83

Query: 67  ---AMFHPSFSFIIMAIN-HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                +      ++  +        GF+      + +  GL SSA+I +    A+  +  
Sbjct: 84  DRKDDWANYPKGVLKVLQDEGYKLKGFEALYEGNIPNGAGLSSSASIELVTGVAMNEIL- 142

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQMPK 166
           +      E++           G++ GI    ++  G                 + +++  
Sbjct: 143 NLGIERVELVKLCQKAENNFVGVNCGIMDQFAVGMGKADYAIFLKCDTIDYKYVPFKLDG 202

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------EINEINQ-------- 211
           Y I   +      L  S Y    +Q    +SY++ E          + E ++        
Sbjct: 203 YKIVISNTNKRRGLQDSKYNERRSQCEMALSYLKKELDVDNLGQVTLEEFDKYKYLIPDD 262

Query: 212 ------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
                 +      + +  + +AL++ ++K   Q M      L     V+  +L  +V + 
Sbjct: 263 VLLKRARHVVTEDERALDAVEALKDNDIKRFGQLMVESHNSLRDDYEVTGKELDTLVDEA 322

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
            +  +++ S+++G+G G C +++ K +      + V      K G + 
Sbjct: 323 LKLDYVLGSRMTGAGFGGCTVSIVKEEFVEDFIKEVTNGYKEKIGYEP 370


>gi|328675818|gb|AEB28493.1| Galactokinase [Francisella cf. novicida 3523]
          Length = 382

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/350 (18%), Positives = 124/350 (35%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S ++     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFISIASRDDNIVNVYSENLDDSASFNIDEIKQ 85

Query: 72  SF-----SFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                  ++I   IN IK        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  ELSNLWQNYIKGTINTIKQDFCSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNEI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y  + S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLKISKIDLAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDYK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
           +        +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 SALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KFLKDYTSYLEKNYFEKFNIKPSF 370


>gi|81428378|ref|YP_395378.1| galactokinase [Lactobacillus sakei subsp. sakei 23K]
 gi|78610020|emb|CAI55068.1| Galactokinase [Lactobacillus sakei subsp. sakei 23K]
          Length = 388

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 59/346 (17%), Positives = 133/346 (38%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI       +  R+D+ IN+ S   +  G +       
Sbjct: 24  APGRINLIGEHTDYNGGHVFPTAITLGTYAVVAKREDQTINLLSGNFEDAGVISFDLSDL 83

Query: 68  ---MFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I +++        G D+ +   + +  GL SSA+I + +   +L 
Sbjct: 84  SYQKAHNWANYPKGMIVYLQEQGYTIDHGLDIYLKGNIPNGAGLSSSASIEL-LMGVILE 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
            Q++ +    +++ T   +  K  G++SGI    ++                    +   
Sbjct: 143 DQFNLDIDRVDLVKTGMMVENKFIGVNSGIMDQFAVGMSKANHAILLDTNTLDYDLVPID 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKL- 220
           +    I  ++      L  S Y    ++  K ++ ++ +     + +++ + + L   + 
Sbjct: 203 LQDNVIIIMNTNKRRELADSKYNERRSECEKALAILQTKNDINSLGDLDNETFDLQTYML 262

Query: 221 ------------------SQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  + +AL+N +L+   + +N     L+    V+  +L  +V
Sbjct: 263 QDENLLKRARHAVSENQRTMKAREALKNNDLERFGKLVNASHVSLQFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ ++++G+G G C IA+   D      ++V      K
Sbjct: 323 QSAWQQSGVLGARMTGAGFGGCAIAIVAKDQVENFEENVAKAYTDK 368


>gi|182626472|ref|ZP_02954223.1| galactokinase [Clostridium perfringens D str. JGS1721]
 gi|177908212|gb|EDT70773.1| galactokinase [Clostridium perfringens D str. JGS1721]
          Length = 387

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/370 (17%), Positives = 113/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G       I        +LR DR+    S   +  
Sbjct: 15  GKEPTSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFATASLRDDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|325092272|gb|EGC45582.1| mevalonate kinase [Ajellomyces capsulatus H88]
          Length = 581

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/362 (20%), Positives = 133/362 (36%), Gaps = 56/362 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQY----- 60
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I ++    +      
Sbjct: 106 FMVSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD 165

Query: 61  CGSLDLAMFHPS-----------------FSFIIMAINHIKPSCGFDLKVISQL------ 97
             SL   +FH                      I   I  I      +L   S        
Sbjct: 166 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDELPTDSCRSVHTTI 225

Query: 98  --DSQLGLGSSAAITVAITAA------------LLTLQYHKEPSPDEILTTAHAIVLKVQ 143
                 GLGSSA+I V ++AA               L    E   + I   A    + + 
Sbjct: 226 NHPHCAGLGSSASIAVCLSAALLLQIRILAGPHQDQLPEEAETQIERINKWAFVGEMCIH 285

Query: 144 GISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------PIHLIYSGYKTPTAQVLKKIS 197
           G  SG+D   S  G  + ++   YS              P+ L+ S     T+  + K++
Sbjct: 286 GNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELPLLLVNSRQPRSTSVEVAKVA 345

Query: 198 YIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGV 252
                +P ++E     I+Q   +    +         ++ +    +      GLL +LGV
Sbjct: 346 NFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSEAIDHFGELFRINHGLLVSLGV 405

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIV 312
           S  +L   + +L +      +K++G+G G C I L + +++    + +   +  +G +  
Sbjct: 406 SHPRLER-IRELVDHTGSGWTKLTGAGGGGCAITLLRTNIDPAALKRLEKTLDDEGFERY 464

Query: 313 PI 314
             
Sbjct: 465 ET 466


>gi|148657918|ref|YP_001278123.1| galactokinase [Roseiflexus sp. RS-1]
 gi|229889780|sp|A5UZX0|GAL1_ROSS1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|148570028|gb|ABQ92173.1| galactokinase [Roseiflexus sp. RS-1]
          Length = 391

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 51/344 (14%), Positives = 107/344 (31%), Gaps = 44/344 (12%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + V APG + L+GEH   +       AI++   +    R DR++ + ++         + 
Sbjct: 21  VIVRAPGRVNLIGEHTDYNDGFVFPVAIDRATCVAARPRTDRIVRVMAADLHDEDLFSID 80

Query: 68  M-------FHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                   +H     +++A+     +  G D+ + S +    GL SSAA+ VA+      
Sbjct: 81  QIERSNRAWHNYIRGVVLALRTAGHTLSGADMLIASDVPRGAGLSSSAALEVAVAYTFQV 140

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIF 176
           L        +  L    A    V      +D   ++ G     +       +   +    
Sbjct: 141 LNRLNILGEELALLAQGAENTFVGVQCGIMDQLIAVFGRADHALLIDCRDLTYRAVPLPP 200

Query: 177 PIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ-------------- 211
            + ++              Y     +    +  ++  YP I  +                
Sbjct: 201 SVAVVVCDSHIARTLAASAYNQRRQECDAAVRALQQWYPGIRALRDVSEDQLAAHQHELP 260

Query: 212 -------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                  +      + +     AL   ++    + MN     L     VS   +  +V  
Sbjct: 261 EPLRARARHVVSENRRALQGAAALEAGDIATFGRLMNESHASLRDDYQVSLPDIDFLVTT 320

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +       S+++G+G G C ++L +          +    H  
Sbjct: 321 AQSLAGCYGSRLTGAGFGGCTVSLVERSSVETFRHDLAQAYHDA 364


>gi|18310327|ref|NP_562261.1| galactokinase [Clostridium perfringens str. 13]
 gi|24211717|sp|Q8XKP9|GAL1_CLOPE RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|18145007|dbj|BAB81051.1| galactokinase [Clostridium perfringens str. 13]
          Length = 387

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/370 (17%), Positives = 114/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+  + +  S PG + L+GEH   +G       I        +LR DR+    S   +  
Sbjct: 15  GKEPNSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAASLRDDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|260588617|ref|ZP_05854530.1| galactokinase [Blautia hansenii DSM 20583]
 gi|260541092|gb|EEX21661.1| galactokinase [Blautia hansenii DSM 20583]
          Length = 389

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/364 (17%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           +PG + L+GEH   +G      A+          R+DR I   S      G         
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTIGTYGVARKREDRKIRFYSENFSRLGVFETSLDDL 83

Query: 65  ---DLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              + A +      +I            GFD+ +   + +  GL SSA++ + +   L+ 
Sbjct: 84  VYREEANWTNYPKGVIWTFKEKGYVADTGFDMVMYGNIPNGSGLSSSASVELLMGVILVD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L   +  S  ++         K  G++ G +D  A   G                    Q
Sbjct: 144 LFGFEGLSMIDLALYGQYAENKFNGMNCGIMDQFAIAMGKENHAIFLDTGNLHYEYAPIQ 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY---------PEINEINQKIY 214
           M    I          L  S Y    A+  + ++ I+             E  E  +   
Sbjct: 204 MDGAKIVIAASNKKRKLTDSKYNERRAECEEALADIQKHENIQALGELTEEKFEEVKAFI 263

Query: 215 ALM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           A               + +  + +AL+  +L+   + MN+    L     V+  +L  +V
Sbjct: 264 ANPICRKRAKHAVYENQRTIQAVKALKENDLETFGKLMNQSHISLRDDYEVTGKELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ S+++G+G G C +++ K D      Q+V      + G            
Sbjct: 324 EAAWKQDGVIGSRMTGAGFGGCTVSIVKEDKIDSFIQNVGEIYEKEIGYAADFYVVEIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GSRR 387


>gi|134301681|ref|YP_001121649.1| galactokinase [Francisella tularensis subsp. tularensis WY96-3418]
 gi|134049458|gb|ABO46529.1| galactokinase [Francisella tularensis subsp. tularensis WY96-3418]
          Length = 382

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYASYLEKNYFEKFNIKPSF 370


>gi|257869586|ref|ZP_05649239.1| galactokinase [Enterococcus gallinarum EG2]
 gi|257803750|gb|EEV32572.1| galactokinase [Enterococcus gallinarum EG2]
          Length = 385

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 114/362 (31%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      +I          R D+ I + S      G +       
Sbjct: 22  APGRINLIGEHTDYNGGYVFPASITIGTYGVARKRADKQIRLYSENFPEKGIITFSLDDL 81

Query: 65  ---DLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +         G ++     + +  GL SSA+I +     L  
Sbjct: 82  EYRKEDDWTNYPKGVIRYLKAAGHAIDSGIEIAFYGNIPNGAGLSSSASIELLTGVILDD 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L        + ILT        +   S  +D  A   G                 +  + 
Sbjct: 142 LFGLAIERLELILTGKKVENEFIGVNSGIMDQFAIGMGKKDHALLLDTNTLAYDLVPAEF 201

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y +  ++      L  S Y     +  + +  ++ +     + E+++  +        
Sbjct: 202 GDYVVAIMNTNKRRELADSKYNERRGECEEALKRLQTKLKIQSLGELDEATFFAHTSLIE 261

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +  AL   +L+     ++     L     V+  +L  +V 
Sbjct: 262 DPTLIKRAKHAVTENQRTLKAKAALEAGDLESFGHLLDASHASLRDDYEVTGIELDTLVA 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID--IVPITPSHS 319
             +EQP ++ ++++G+G G C IAL K         +V      K G +  I   +    
Sbjct: 322 AAQEQPAVLGARMTGAGFGGCAIALVKKSEWEAFATAVKESYREKIGYETDIYQASIDDG 381

Query: 320 TS 321
             
Sbjct: 382 AR 383


>gi|331082031|ref|ZP_08331159.1| galactokinase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330405626|gb|EGG85156.1| galactokinase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 389

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/364 (17%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           +PG + L+GEH   +G      A+          R+DR I   S      G         
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTIGTYGVARKREDRKIRFYSENFSRLGVFETSLDDL 83

Query: 65  ---DLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
              + A +      ++            GFD+ +   + +  GL SSA++ + +   L+ 
Sbjct: 84  VYREEANWTNYPKGVVWTFKEKGYVADTGFDMVMYGNIPNGSGLSSSASVELLMGVILVD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L   +  S  ++         K  G++ G +D  A   G                    Q
Sbjct: 144 LFGFEGLSMIDLALYGQYAENKFNGMNCGIMDQFAIAMGKENHAIFLDTGNLHYEYAPIQ 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY---------PEINEINQKIY 214
           M    I          L  S Y    A+  K ++ I+             E  E  +   
Sbjct: 204 MDGAKIVIAASNKKRKLTDSKYNERRAECEKALADIQKHENIQALGELTEEKFEEVKAFI 263

Query: 215 ALM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           A               + +  + +AL+  +L+   + MN+    L     V+  +L  +V
Sbjct: 264 ANPICRKRAKHAVYENQRTIQAVKALKENDLETFGKLMNQSHISLRDDYEVTGKELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ S+++G+G G C +++ K D      Q+V      + G            
Sbjct: 324 EAAWKQDGVIGSRMTGAGFGGCTVSIVKEDKIDSFIQNVGEIYEKEIGYAADFYVVEIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GSRR 387


>gi|56708516|ref|YP_170412.1| galactokinase [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110670987|ref|YP_667544.1| galactokinase [Francisella tularensis subsp. tularensis FSC198]
 gi|224457681|ref|ZP_03666154.1| galactokinase [Francisella tularensis subsp. tularensis MA00-2987]
 gi|254371143|ref|ZP_04987145.1| galactokinase [Francisella tularensis subsp. tularensis FSC033]
 gi|254875365|ref|ZP_05248075.1| galK, galactokinase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56605008|emb|CAG46109.1| Galactokinase [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110321320|emb|CAL09492.1| Galactokinase [Francisella tularensis subsp. tularensis FSC198]
 gi|151569383|gb|EDN35037.1| galactokinase [Francisella tularensis subsp. tularensis FSC033]
 gi|254841364|gb|EET19800.1| galK, galactokinase [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159729|gb|ADA79120.1| Galactokinase [Francisella tularensis subsp. tularensis NE061598]
          Length = 382

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      II  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGIINIINQDFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYASYLEKNYFEKFNIKPSF 370


>gi|171693619|ref|XP_001911734.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946758|emb|CAP73562.1| unnamed protein product [Podospora anserina S mat+]
          Length = 528

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 83/389 (21%), Positives = 140/389 (35%), Gaps = 76/389 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-------------- 47
              +    VSAPG +++ GEH V+HG AA+  +I  R  L +T                 
Sbjct: 71  SPMMPSFMVSAPGKVIVFGEHAVVHGKAAIAASIALRSYLLVTSLSKSRKTVTLKFPDID 130

Query: 48  -DRLINIDS---------SLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLK----- 92
            D    ID          S  +Y  SL   +     + I   +  + P    D++     
Sbjct: 131 FDHSWRIDELPWAIFQQPSKKKYYYSLVTEIDQELVAAIQPYLADVSPDKPADVRKVHQN 190

Query: 93  -----------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKE 125
                                  + S +    GLGSSA I V ++AALL    TL     
Sbjct: 191 SAGSFLYMFLSLGSQSFPACQYTLRSTIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHP 250

Query: 126 PSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             P          I   A+   + + G  SG+D   S  G  + +Q   YS         
Sbjct: 251 DQPPEEARMQIERINRWAYVYEMFIHGNPSGVDNTVSTQGKAVMFQRTDYSKAPDVKPLW 310

Query: 178 IHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQ 226
                    + +     TA  + K+  ++  +P++     + I++        +++    
Sbjct: 311 DFPELPLLLVDTRTPKSTAHEVAKVGRLKDTHPKLVGSILDAIDKVTQTSAELIAEDDFS 370

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
             +  +L+ + + MN   GLL +LGVS  +L   V +L +   I  +K++G+G G C I 
Sbjct: 371 TEKEDSLRRVGELMNINHGLLVSLGVSHPRLER-VRELVDHQGIGWTKLTGAGGGGCSIT 429

Query: 287 LGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           L K  +       +   +  +G      T
Sbjct: 430 LLKPGVPREKLARLEEQLDEEGYQRFETT 458


>gi|167463395|ref|ZP_02328484.1| galactokinase [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322381225|ref|ZP_08055228.1| galactokinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154801|gb|EFX47072.1| galactokinase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 393

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/372 (17%), Positives = 126/372 (33%), Gaps = 52/372 (13%)

Query: 2   GQCLHKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+    I V  APG + L+GEH   +G      A+     L +  R+DR I + ++  + 
Sbjct: 16  GESHKGITVFHAPGRVNLIGEHTDYNGGYVFPAALTFGTHLLIRRREDRQIGLATTNFEL 75

Query: 61  CGSLD--------LAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAIT 110
              L            +      II+ ++        G+D+    ++ +  GL SSA+I 
Sbjct: 76  KKLLSMDDLSYRKEDDWMNYPKGIIVQLDQTGRTIQHGYDMLFHGEIPNGSGLSSSASIE 135

Query: 111 VAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------------ 158
           V    ALL ++        +I   A     +  G+  GI    ++  G            
Sbjct: 136 VVTAYALLLMEG-LAIDLTDISLLAQKSENEYNGVQCGIMDQFAVANGKKEHAILLMCDT 194

Query: 159 ----LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEIN------- 207
                + ++   Y +   +      L+ S Y     Q  + +  ++ ++P++        
Sbjct: 195 LEYKHVPFRSKTYKLVIGNTCKRRGLVDSAYNERRNQCEQAVQELKRQFPDLTLLGQLSL 254

Query: 208 ---------------EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LG 251
                              +           S + L   NL+   + M      L     
Sbjct: 255 GQYREYEHLIQDETARRRARHVMEEIDRVLQSMEVLEQDNLEAFGKLMTESHESLRDQYE 314

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGID 310
           V+  +L  +V +  E   ++ S+++G+G G C ++L   D      + V  H     GI+
Sbjct: 315 VTGKELDIMVSRALEVSGVLGSRMTGAGFGGCTVSLVHEDGVERFKEYVGSHYRQETGIE 374

Query: 311 IVPITPSHSTSL 322
                      +
Sbjct: 375 PEFYVCEIGDGV 386


>gi|297582744|ref|YP_003698524.1| galactokinase [Bacillus selenitireducens MLS10]
 gi|297141201|gb|ADH97958.1| galactokinase [Bacillus selenitireducens MLS10]
          Length = 388

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 56/360 (15%), Positives = 116/360 (32%), Gaps = 50/360 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           APG + L+GEH   +G      A++    L +  R DR +   S      G ++  +   
Sbjct: 24  APGRVNLIGEHIDYNGGYVFPTALDVGTYLAVRKRSDRKLRFYSENFPQMGIVEGDLDDL 83

Query: 70  -----HPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    S+    +            GFD+ V   + +  GL SSA+I +A       
Sbjct: 84  AYSQADDWVSYAKGVLYMFMEEGMTGDKGFDVYVFGNIPNGAGLSSSASIELAFAVMWDA 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           +          +     A    +      +D  A   G                    ++
Sbjct: 144 VNGFSMDRVTMVKLCQRAENEYIGVNCGIMDQFAIGFGKKEHAVLLDCDTLDYEYARLKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALMGK--- 219
             Y I   +      L  S Y     +    +S ++ +     + E+++  +        
Sbjct: 204 DGYKILIANTNKRRGLADSKYNERRQECETALSELQEKEVVSHLCELDEAAFNEASHLIK 263

Query: 220 ----------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                            ++ + +AL + +L    Q MN     L     V+  +L  +V 
Sbjct: 264 GADRLKRARHAVTENERTKKAFRALEDGDLPAFGQLMNDSHVSLRDDYEVTGKELDAMVE 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
              ++  ++ ++++G+G G C + + K D      + ++     + GI+      +    
Sbjct: 324 AAWQEETVIGARMTGAGFGGCTVNIVKEDGLDETVKRISQRYTDQTGIEPKFYVVTTGDG 383


>gi|312142516|ref|YP_003993962.1| galactokinase [Halanaerobium sp. 'sapolanicus']
 gi|311903167|gb|ADQ13608.1| galactokinase [Halanaerobium sp. 'sapolanicus']
          Length = 389

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 60/360 (16%), Positives = 120/360 (33%), Gaps = 50/360 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           APG + L+GEH   +    +  AI K + + + LR D+ +   S         ++     
Sbjct: 26  APGRVNLIGEHTDYNDGFVMPMAIEKNIRMVMQLRNDKKVKAYSLDYDKLIEFNIDNLLY 85

Query: 70  ---HPSFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              +   ++I   I+ ++       GF+L     +    GL SSAA+ V    A+  L  
Sbjct: 86  DKENIWVNYIKGIIDELQKLGNKLQGFNLLFSGNIPQGSGLSSSAALEVVTAMAITDLHN 145

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQMPKY 167
            K  + +  L    A    V      +D   S  G                 + +    Y
Sbjct: 146 IKLEAVELALLAQRAENNFVNVQCGIMDQYISRLGKKDNALLIDCRSNQYQLVPFANEDY 205

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPE----------------INEINQ 211
            I   +      L+ S Y     +  + + +   +  +                  E++ 
Sbjct: 206 QIVICNSKVERGLVDSEYNKRRKECNQAVDFFAKKLDKNITALRDLDLDTLHEYKEELSD 265

Query: 212 KIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
            +Y     +   +       +AL   ++    +        L     VS  +L  +V   
Sbjct: 266 TVYKRAHHVISENQRVLAAKKALEKNDMNKFGKLFYESHQSLSDDYEVSCQELDLLVKLA 325

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC-HMHAKGI--DIVPITPSHSTS 321
            E+  +  ++++G+G G C + L K +      +++   +    GI  D+    P+    
Sbjct: 326 SEEKGVKGARMTGAGFGGCTVNLVKKEFVDTFVENIKQAYYENTGIDTDVYITNPAAGAR 385


>gi|168212080|ref|ZP_02637705.1| galactokinase [Clostridium perfringens B str. ATCC 3626]
 gi|170710005|gb|EDT22187.1| galactokinase [Clostridium perfringens B str. ATCC 3626]
          Length = 387

 Score =  173 bits (439), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 63/370 (17%), Positives = 113/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G       I        +LR DR+    S   +  
Sbjct: 15  GKEPTSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAASLRDDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|309792143|ref|ZP_07686615.1| galactokinase [Oscillochloris trichoides DG6]
 gi|308225684|gb|EFO79440.1| galactokinase [Oscillochloris trichoides DG6]
          Length = 385

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 64/363 (17%), Positives = 113/363 (31%), Gaps = 48/363 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG--QYCGSL 64
           +I V APG + L+GEH   +    L  AI++   +    R D+   + S+    +    L
Sbjct: 20  RILVRAPGRVNLIGEHTDYNEGFVLPMAIDRATFVAARSRPDQTFRVYSAQFAQEDEFHL 79

Query: 65  DLAMFHP---SFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                HP     +++   I  +     P  G DL + S +    GL SSAA+ VA+  A+
Sbjct: 80  QRIERHPDAAWPNYVRGVIKGLLARDLPLTGADLLITSDVPIGSGLSSSAALEVAVGYAV 139

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDF 174
             L        +  L    A    V      +D   +  G     +       S   I  
Sbjct: 140 QVLNNSNLLGEELALLAQGAENSFVGVQCGIMDQFVAALGRKHHALLIDCRDLSYRPIPI 199

Query: 175 IFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ------------ 211
              + +I              Y    A     +  ++   P +  +              
Sbjct: 200 PPDVRVIICDSGVHHDLATSAYNERRAACHTAVRLLKTRLPRLTALRDLRVSDLEVHGDL 259

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +      + +  +  AL   +L    Q MN+    +     +S  ++  + 
Sbjct: 260 LPPDVYIRVRHVVTENQRTLDAAAALEAADLVAFGQLMNQSHQSMRDDYAISTPEIDLLC 319

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSH 318
              R  P    ++++G G G   + L          Q V      + G    I+   PS 
Sbjct: 320 DLARSVPGCYGARLTGGGFGGSTVNLVTLSAVEAFTQQVAAGYQTQTGRVPQILVCRPSE 379

Query: 319 STS 321
              
Sbjct: 380 GVG 382


>gi|322370448|ref|ZP_08045006.1| galactokinase [Haladaptatus paucihalophilus DX253]
 gi|320549865|gb|EFW91521.1| galactokinase [Haladaptatus paucihalophilus DX253]
          Length = 394

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 61/364 (16%), Positives = 108/364 (29%), Gaps = 49/364 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA- 67
             SAPG + L+G H   +    L  AI++R  +    R DR + + S+      +  L  
Sbjct: 26  VASAPGRVNLIGGHTDYNDGFVLPVAIDRRTAVAARPRTDRTVRVFSTNVGETRTFSLDA 85

Query: 68  ---MFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                     ++      +      P  G DL V   +    GL SSA++ +A   AL  
Sbjct: 86  PATEESSWVGYVEGVARSLADEAPSPVSGLDLAVRGNVPMGGGLSSSASLELAAATALNE 145

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIF 176
                    +            V      +D      G     +         E+     
Sbjct: 146 TWTLGHDRTELADRCWRVEREFVGVECGIMDQFVVALGESDRALFLDCRTREYERYPLDG 205

Query: 177 P-----------IHLIYSGYKTPTAQV----------------------LKKISYIEIEY 203
                         L+ S Y    AQ                       + +        
Sbjct: 206 DVRVVVTNTNVEHELVDSAYNERVAQCREGVELLAESLSHDVNALRDVSVAEFEERAETL 265

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
           P       +      +  + +  AL   +++ +   M      L     VS  +L  +V 
Sbjct: 266 PGTVRDRCEHVVRENERVKTAANALETGDMERVGALMGESHRSLRDSYEVSCEELDFVVE 325

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID--IVPITPSHS 319
                   + S+++G+G G CV++L + D      ++V     A+ GI+  I P      
Sbjct: 326 TAESVDAELGSRMTGAGFGGCVVSLVRSDSVESFTETVRAAYAAETGIEPDIFPCAVGDG 385

Query: 320 TSLY 323
             + 
Sbjct: 386 ARVE 389


>gi|194397014|ref|YP_002038442.1| galactokinase [Streptococcus pneumoniae G54]
 gi|194356681|gb|ACF55129.1| galactokinase [Streptococcus pneumoniae G54]
          Length = 392

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+      +  R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAVRKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQKAGHVIDKGFDFYVYGNIPNGSGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|168214898|ref|ZP_02640523.1| galactokinase [Clostridium perfringens CPE str. F4969]
 gi|170713661|gb|EDT25843.1| galactokinase [Clostridium perfringens CPE str. F4969]
          Length = 387

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 63/370 (17%), Positives = 114/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G       I        +LR+DR+    S   +  
Sbjct: 15  GKEPTSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAASLREDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLETLG-V 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDYYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|110801332|ref|YP_695995.1| galactokinase [Clostridium perfringens ATCC 13124]
 gi|168207594|ref|ZP_02633599.1| galactokinase [Clostridium perfringens E str. JGS1987]
 gi|168217776|ref|ZP_02643401.1| galactokinase [Clostridium perfringens NCTC 8239]
 gi|123049833|sp|Q0TQU5|GAL1_CLOP1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|110675979|gb|ABG84966.1| galactokinase [Clostridium perfringens ATCC 13124]
 gi|170661053|gb|EDT13736.1| galactokinase [Clostridium perfringens E str. JGS1987]
 gi|182380143|gb|EDT77622.1| galactokinase [Clostridium perfringens NCTC 8239]
          Length = 387

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 63/370 (17%), Positives = 114/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G       I        +LR+DR+    S   +  
Sbjct: 15  GKEPTSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAASLREDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHAISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ ++++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGARMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|85102580|ref|XP_961360.1| hypothetical protein NCU03633 [Neurospora crassa OR74A]
 gi|12718384|emb|CAC28692.1| related to MEVALONATE KINASE [Neurospora crassa]
 gi|28922904|gb|EAA32124.1| hypothetical protein NCU03633 [Neurospora crassa OR74A]
 gi|206597121|dbj|BAG71665.1| mevalonate kinase [Neurospora crassa]
          Length = 528

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 74/389 (19%), Positives = 135/389 (34%), Gaps = 76/389 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQ 59
              +    VSAPG +++ GEH V+HG AA+  AI+ R  L +    +  R + +      
Sbjct: 74  SPMMPTFMVSAPGKVIVFGEHAVVHGKAAIAAAISLRSYLLVNTLSKSKRTVTLKFPDID 133

Query: 60  YCGSLDLAMF----------------------HPSFSFIIMAINHIKPSCGFDLK----- 92
           +  S ++                               +   +  +      D++     
Sbjct: 134 FNHSWNIDELPWKIFQQPGKKKYYYSLVTEIDQELVDAVQPFLADVSIDKPADIRKVHQN 193

Query: 93  -----------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKE 125
                                  + S +    GLGSSA I V ++AALL    TL     
Sbjct: 194 SAGSFLYMFLSLGSQSFPGCQYTLRSTIPIGAGLGSSATIAVCLSAALLLQLRTLSGPHP 253

Query: 126 PSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             P          I   A    + + G  SG+D   S  G  + +Q   Y+         
Sbjct: 254 DQPPEEARLQIERINRWAFVYEMFIHGNPSGVDNTVSTQGKAVVFQRTDYNQPPSVRPLW 313

Query: 178 IHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQ 226
                    + +     TA  + K++ ++ ++P++       I+Q   +    + +    
Sbjct: 314 DFPKLPLLLVDTRTAKSTAHEVAKVATLKKKHPQLVGTILTAIDQVTQSSAQLIEEQGFN 373

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
               ++L  + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I 
Sbjct: 374 TEDEESLSKVGEMMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCSIT 432

Query: 287 LGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           L +  +       +   +  +G      T
Sbjct: 433 LLRPGVPREKLDKLEQRLDEEGYSKFETT 461


>gi|219847125|ref|YP_002461558.1| galactokinase [Chloroflexus aggregans DSM 9485]
 gi|254790359|sp|B8GCS2|GAL1_CHLAD RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|219541384|gb|ACL23122.1| galactokinase [Chloroflexus aggregans DSM 9485]
          Length = 390

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 58/367 (15%), Positives = 113/367 (30%), Gaps = 47/367 (12%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+   +I   APG + L+GEH   +       A+++   +    R DR++ + S   +  
Sbjct: 16  GKPPTRI-ARAPGRVNLIGEHTDYNDGFVFPMALDRATYVAARPRDDRIVRVFSVKFRDE 74

Query: 62  GSLDLA--------MFHPSFSFI-IMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
              DL          +      +    +    P  G DL + S + S  GL SSAA+ VA
Sbjct: 75  DQFDLDHIVRDTQRQWVNYIRGVAKGLLARDLPLRGADLLIDSDVPSGSGLSSSAALEVA 134

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSI 169
           +      L        +  L    A    V      +D   +  G     +       S 
Sbjct: 135 VGYTFQLLNQINLLGEELALLAQGAEHSFVGVKCGIMDQLIAALGEAGHALLIDCRDLSY 194

Query: 170 EKIDFIFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ------- 211
             I     + ++              Y    A   + +  +     +I  +         
Sbjct: 195 RPIPIPTGVRVVVCDSGVRHRLAGSEYNQRRAGCEEAVRILRPALGKIQALRDVRSTDLA 254

Query: 212 --------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
                         +      + +  +  AL   ++  + Q M      L     VS ++
Sbjct: 255 EYGHLLPPELLPLVRHVVSENERTLAAADALAAGDVVKMGQLMVESHQSLRDDYCVSIAE 314

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH-AKGIDIVPIT 315
           L  +V      P    S+++G G G   ++L + +       ++        G  + P+ 
Sbjct: 315 LDTLVDLALAAPGCYGSRMTGGGFGGSTVSLVEAEKVDEFVAAMIAGYAIRTGRTLQPLV 374

Query: 316 PSHSTSL 322
            +    +
Sbjct: 375 CTAGAGV 381


>gi|269123104|ref|YP_003305681.1| galactokinase [Streptobacillus moniliformis DSM 12112]
 gi|268314430|gb|ACZ00804.1| galactokinase [Streptobacillus moniliformis DSM 12112]
          Length = 386

 Score =  173 bits (438), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/364 (17%), Positives = 130/364 (35%), Gaps = 54/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           APG + L+GEH   +G      AI++  I  ++ R+DR     S   +  G ++  +   
Sbjct: 23  APGRVNLIGEHTDYNGGNVFPCAIDRGTIALVSKREDRKCRFYSENFKEKGVIEFDIDKL 82

Query: 69  ----FHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++               + GFD+ +   + +  GL SSA++ + I   +L 
Sbjct: 83  VNEAEHSWVNYPKGMFKAFIDKGYDINHGFDVLIYGDIPNGAGLSSSASVEMVI-GIMLK 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
            ++  +    +I+        +  G++SG +D  A   G                 +   
Sbjct: 142 NEFKFDIETIDIVKLGKLTENEFIGVNSGIMDQFAVAMGKKDKAILLDCNTLIYEYVPVM 201

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    I   +      L  S Y    A+  K +  ++ +                     
Sbjct: 202 LENEYIIIANTNKRRGLADSKYNERRAECEKALEELQTKLNIKALGELSIDEFEANKDLI 261

Query: 205 --EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             EI +   K      + + ++ +AL   +LK   + MN     L     V+  +L  +V
Sbjct: 262 KCEIRQKRAKHAVYENQRTLMAKEALTKGDLKTFGRLMNESHISLRDDYEVTGIELDSLV 321

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGI--DIVPITPSH 318
               E+  I+ S+++G+G G C +++ K        ++V   +    G+  D      S 
Sbjct: 322 EVAWEEEGIVGSRMTGAGFGGCTVSIVKKVNVDKFIENVGRKYFEKTGLKADFYIANVSE 381

Query: 319 STSL 322
              +
Sbjct: 382 GARI 385


>gi|323339923|ref|ZP_08080191.1| galactokinase [Lactobacillus ruminis ATCC 25644]
 gi|323092643|gb|EFZ35247.1| galactokinase [Lactobacillus ruminis ATCC 25644]
          Length = 388

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 58/356 (16%), Positives = 128/356 (35%), Gaps = 52/356 (14%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G    K   S PG + L+GEH   +G      AI        + R D  +N  S+  +  
Sbjct: 15  GAKPEKTFFS-PGRINLIGEHTDYNGGHVFPCAITLGTYGAASKRDDSKLNFYSANFEDK 73

Query: 62  GSLDLAMFHPSF-------SFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAI 109
           G +++ + +  +       ++    I  +K        G D+ +   + +  GL SS+++
Sbjct: 74  GIIEVDLNNLVYDEKDNWTNYAKGMIKFLKEDGYDIDAGMDIFIEGNIPNGSGLSSSSSL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI----HGGLICYQMP 165
            + I      L +  +    +++        K  G++SGI    +I     G  +     
Sbjct: 134 ELLIGIICQEL-FGLDTERLDLVKLGQKTENKFIGVNSGIMDQFAIGMGQAGKALLLDTN 192

Query: 166 KYSIEKIDFIFPIHLI------------YSGYKTPTAQVLKKISYIEIEYP--EINEINQ 211
                 +      ++I             S Y    A+  K ++ ++ +     + E+++
Sbjct: 193 TLEYTPVPLDLKNNVIVIMNTNKRRELADSKYNERRAECEKALAELQTKLDVKSLGELDE 252

Query: 212 KIYALMGK-------------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLG 251
            ++                         +  + +AL   +L+   + +N     LE    
Sbjct: 253 SMFDEYCYLIEDEARLKRARHAVLENQRTLKAEKALEAGDLERFGRLVNASHVSLEHDYE 312

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V+  +L  +  +  +Q  ++ ++++G+G G C IA+   D      ++V      K
Sbjct: 313 VTGVELDTLAHEAWKQKGVLGARMTGAGFGGCGIAIVDKDCVEDFKENVGKVYEEK 368


>gi|120436492|ref|YP_862178.1| galactokinase [Gramella forsetii KT0803]
 gi|117578642|emb|CAL67111.1| galactokinase [Gramella forsetii KT0803]
          Length = 406

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/368 (19%), Positives = 129/368 (35%), Gaps = 51/368 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLR-KDRLINIDSSLGQYCGSLD 65
           ++ V +PG + L+GEH   +    L  AI+K++IL       +    I S          
Sbjct: 39  EVVVESPGRINLIGEHTDYNEGFVLPTAIDKKIILKFQKNHTENFCRIYSETFNTGFEFQ 98

Query: 66  LAM-------FHPSFSFIIMAIN-HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           L         +      ++  +  H     GFD  + S+L    G+ SSAA+   I + L
Sbjct: 99  LDKAFEKGSDWENYILGVVKELQYHSSKLEGFDCLIESRLPVGAGISSSAALECGIASGL 158

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKID 173
             L +       +I+  +     +  G + GI    S        +I         E I 
Sbjct: 159 NEL-FDLGLDKLDIVKLSQKAENEFVGSNCGIMDQYSSVMSKEDHIILLDCRSLKSEFIP 217

Query: 174 FIFPIHLI------------YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS 221
             F    +             S Y +   +    ++ I+ E PEI  +    + ++ +  
Sbjct: 218 ADFKDCKLLLLNTNVSHNLADSDYNSRREECEAAVAIIQKEMPEIKSVRDLSFEILNRFK 277

Query: 222 QI---------------------SCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSE 259
                                  + + L++ +LK     M      L+    VS  +L  
Sbjct: 278 DQLTGKMYERCLYVLKENERVLSAVKTLKSGSLKSFGDLMYSSHEGLQHNYEVSCPELDF 337

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGI--DIVPITP 316
           +V   R++  I  S++ G G G C I L + D      + V + + +   I  D + + P
Sbjct: 338 LVDYSRDKEFIYGSRMMGGGFGGCTINLIEKDKIDDYIEEVSSAYFNKFNIKLDAISVHP 397

Query: 317 SHSTSLYR 324
              T +++
Sbjct: 398 DEGTKIFK 405


>gi|315613698|ref|ZP_07888605.1| galactokinase [Streptococcus sanguinis ATCC 49296]
 gi|315314389|gb|EFU62434.1| galactokinase [Streptococcus sanguinis ATCC 49296]
          Length = 392

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 55/345 (15%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++ +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  ++       + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQAAMDIQTLGELDEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL   D      ++V  +   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVPKDTVEAFKEAVGKYYEE 371


>gi|270291581|ref|ZP_06197802.1| galactokinase [Pediococcus acidilactici 7_4]
 gi|270280078|gb|EFA25915.1| galactokinase [Pediococcus acidilactici 7_4]
          Length = 387

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 129/352 (36%), Gaps = 52/352 (14%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--- 62
            ++  S PG + L+GEH   +G      AI+         R D  + + S      G   
Sbjct: 19  EEVYFS-PGRINLIGEHTDYNGGHVFPCAISLGTYGAYRGRDDTQVRMYSGNLPDTGIIE 77

Query: 63  ----SLDLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAI 113
                L+    +   +++   +  I+        GF+L +   L    GL SSA+I   +
Sbjct: 78  FDVNDLEYDAKYKWSNYLRGMMLEIRELSHDYDHGFELYLEGDLPDGAGLSSSASIE-ML 136

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------- 158
              +L  Q++   +P E++     +      ++SGI    ++  G               
Sbjct: 137 MGTILNDQFNLRITPIELVKAGQRVENNYIKVNSGIMDQFAVEMGRRNEATFLDTNTMEY 196

Query: 159 -LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYA 215
                 +    I  ++   P  L+ S Y T  A+  + +  ++ +     + E+ +  + 
Sbjct: 197 DYAPLDLNNNVILIMNTNKPHELVNSEYNTRRAECEEALRRLQTKLNINALGELTKDAFD 256

Query: 216 LM-------------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDS 255
                                 + +  + +AL+  +LK+  + ++     L+    VS  
Sbjct: 257 QYAYLINDETLIKRARHAVFENQRTIEAREALKQGDLKLFGRLVSASHVSLQFDYEVSAP 316

Query: 256 KLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +L  +V +  + P ++ +++ G G G C IAL + D      ++V      +
Sbjct: 317 ELDMLVDEAWQSPGVLGARMIGGGFGGCAIALIEKDQVDELVKTVGQKYQDR 368


>gi|225572299|ref|ZP_03781163.1| hypothetical protein RUMHYD_00593 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040181|gb|EEG50427.1| hypothetical protein RUMHYD_00593 [Blautia hydrogenotrophica DSM
           10507]
          Length = 390

 Score =  172 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 62/364 (17%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G       +          R DRL++  S      G ++ ++   
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCTLTLGTYGVARRRNDRLMHFYSCNLYNIGIVEASLDDL 83

Query: 69  -------FHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A      K   GFDL V   +    GL SSA++ V     L+ 
Sbjct: 84  TNKDSYHWANYPLGVVWAFAQKGYKLKQGFDLVVWGNIPKGAGLSSSASLEVLTGVVLVD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L   +  SP ++              S G +D  A   G                    Q
Sbjct: 144 LFDIQTLSPVDLALLGQYSENNFNDCSCGIMDQFAVAMGKKDHAIFLDTSSLNYEYAPIQ 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    I   +      L+ S Y     +  + ++ ++ + P                   
Sbjct: 204 LKDAKIIITNSKVKHSLVSSAYNDRYRECAEALADLKTKLPISSLGDLTPEEFEKNKDCI 263

Query: 205 --EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             +++    K      + +  +   L+  ++    Q MN+    L     VS  ++  + 
Sbjct: 264 RDDLHRKRAKHAVYENQRTITAAAVLKKGDITQFGQLMNQSHVSLRDDYEVSCEEIDILT 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSHST 320
               + P ++ S+I+G G G C ++L K +  S   +++        G +    T     
Sbjct: 324 DLAWKTPGVIGSRITGGGFGGCTVSLVKNEAVSAFIETIKDAYREKTGYEAEFYTVDIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GASR 387


>gi|149279414|ref|ZP_01885545.1| putative galactokinase [Pedobacter sp. BAL39]
 gi|149229940|gb|EDM35328.1| putative galactokinase [Pedobacter sp. BAL39]
          Length = 382

 Score =  172 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 68/344 (19%), Positives = 137/344 (39%), Gaps = 47/344 (13%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V +PG + ++GEH   +G   L  AINK + + ++ R+D  +++ +   +   ++ L+  
Sbjct: 21  VRSPGRINIIGEHTDYNGGFVLPAAINKAIYIGISKREDEEVHLYAEDFKEKHTVALSAL 80

Query: 70  HP----SFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
            P      ++I+      +       GF+L +   +    GL SSAA+  A   AL  L 
Sbjct: 81  APSEKSWPNYILGVADQLLKSGYKIGGFNLYIDGDVPLGAGLSSSAAVECATGYALDQL- 139

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQMP 165
           ++ + + + I   A        G+  G +D  AS+ G                 +  ++ 
Sbjct: 140 FNLKLTQETIALVAQKAEHTFAGVMCGIMDQFASVFGKQDHVIKLDCRSLDYEYVPLKLD 199

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQIS- 224
            Y +  ++      L  S Y T  +Q  + +++I   +PE+  +     +++ K  +   
Sbjct: 200 GYKLVLLNTNVKHALSSSAYNTRRSQCEQGVAWITAHHPEVTSLRDATVSMLDKYVKEKD 259

Query: 225 --------------------CQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVWK 263
                               C  L+  +L  L Q M      L E   VS  +L  +V +
Sbjct: 260 EEVYIKCRFVIDEIERLLVACDHLKKGDLAALGQKMYETHEGLSEAYEVSCKELDFLVAE 319

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +R  P ++ +++ G G G C I + K +      + ++     +
Sbjct: 320 VRNYPQVLGARMMGGGFGGCTINIVKDEFIDELIEKISVSYEQE 363


>gi|307709707|ref|ZP_07646159.1| galactokinase [Streptococcus mitis SK564]
 gi|307619605|gb|EFN98729.1| galactokinase [Streptococcus mitis SK564]
          Length = 392

 Score =  172 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLTNL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+N+  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELNEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLDTFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVDAFKEAVGKHYEE 371


>gi|313900643|ref|ZP_07834136.1| galactokinase [Clostridium sp. HGF2]
 gi|312954705|gb|EFR36380.1| galactokinase [Clostridium sp. HGF2]
          Length = 389

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 60/364 (16%), Positives = 123/364 (33%), Gaps = 52/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI       ++ R D  + + S+  +  G +D+     
Sbjct: 23  SPGRVNLIGEHTDYNGGMVFPCAITFGTYAVVSKRTDSCMRLFSNNFKEKGIIDVALQTL 82

Query: 67  -----AMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +     +  CG ++ +   + +  GL SSA++   +T  +L 
Sbjct: 83  HYDKKDDWANYVKGVLYFLQQEGFEIPCGLNILIEGNIPNGAGLSSSASLE-VLTGTILK 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
             +    S  +I+  +     +  G++ GI     I  G                    Q
Sbjct: 142 ETFQLPISKLDIIKLSQKAENQFVGMNCGIMDQFIIGMGKKDHAIALDTGTLEYTYAPVQ 201

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-----IEYPEINEI--------- 209
           + + SI  ++      L  S Y    A+    +S ++         ++ E          
Sbjct: 202 LKQASIVIMNTNKQRGLTDSKYNERRAECEHALSQLQTVVKIKNLCDLKETEFEKVQHII 261

Query: 210 -------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L     + +  AL   +++     MN     L     V+  +L  +V
Sbjct: 262 TSPVERKRARHAVLENIRVKKAIAALEKNDIEEFGALMNASHISLRDDYEVTGIELDTLV 321

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSHST 320
                Q   + ++++G+G G C IA+ + D       +V      A G +      S   
Sbjct: 322 ESAWNQSGTIGARMTGAGFGGCAIAIVRNDDIEDFTAAVRREYTQAIGYEPDFYIASIGD 381

Query: 321 SLYR 324
              +
Sbjct: 382 GAGK 385


>gi|270292238|ref|ZP_06198452.1| galactokinase [Streptococcus sp. M143]
 gi|270279284|gb|EFA25127.1| galactokinase [Streptococcus sp. M143]
          Length = 392

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGSGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  ++       + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQAALDIQTLGELDEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWDQEGVLGARMTGAGFGGCAIALVQKDAVEAFKEAVGKHYEE 371


>gi|169342507|ref|ZP_02863564.1| galactokinase [Clostridium perfringens C str. JGS1495]
 gi|169299405|gb|EDS81471.1| galactokinase [Clostridium perfringens C str. JGS1495]
          Length = 387

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/370 (17%), Positives = 114/370 (30%), Gaps = 51/370 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  S PG + L+GEH   +G       I        +LR+DR+    S   +  
Sbjct: 15  GKEPTSLFFS-PGRINLIGEHIDYNGGFVFPCPITLGTFAAASLREDRICRAYSLNFESL 73

Query: 62  GSLD----------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
           G ++             +      ++  +     K   G DL +   L +  GL SSA++
Sbjct: 74  GVIEFSLDDLSYKKEDNWTNYLKGVLKVLIEKGYKIDKGIDLVINGNLPNGAGLSSSASL 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            + I   L T         D  L         +   S  +D  A   G     I      
Sbjct: 134 EMLIVKILDTFFSLNISKVDAALIGKEVENTYIGVNSGIMDQFAISLGEKDKAILLDCNS 193

Query: 167 YSIEKIDFI-FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL----- 220
              E +        +I             K +    E  +  +  +K   +         
Sbjct: 194 LYYEYVPLNLGDNSIIIMNTNKRRELADSKYNERRKECDDSLDTLKKYTNISSLCELTSL 253

Query: 221 ---------------------------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGV 252
                                       + + +AL+  NL++  Q MN+    L     V
Sbjct: 254 EFETYKDKIEDSNKLRRCVHTISENERVKDAVKALKENNLELFGQLMNQSHISLRDDYEV 313

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           +  +L  +     +QP ++ S+++G+G G C IA+          ++V      A G + 
Sbjct: 314 TGKELDTLAENAWKQPGVLGSRMTGAGFGGCAIAIVNNAHVDEFIKNVGQAYKDAIGYEA 373

Query: 312 VPITPSHSTS 321
                S    
Sbjct: 374 SFYVASIGNG 383


>gi|293365993|ref|ZP_06612695.1| galactokinase [Streptococcus oralis ATCC 35037]
 gi|307702391|ref|ZP_07639348.1| galactokinase [Streptococcus oralis ATCC 35037]
 gi|291315536|gb|EFE55987.1| galactokinase [Streptococcus oralis ATCC 35037]
 gi|307624068|gb|EFO03048.1| galactokinase [Streptococcus oralis ATCC 35037]
          Length = 392

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++ +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDNGIIEVPLTDL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGSGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNSLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVRKDAVEAFKEAVGKHYEE 371


>gi|332074205|gb|EGI84683.1| galactokinase [Streptococcus pneumoniae GA41301]
          Length = 392

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|225861647|ref|YP_002743156.1| galactokinase [Streptococcus pneumoniae Taiwan19F-14]
 gi|225728093|gb|ACO23944.1| galactokinase [Streptococcus pneumoniae Taiwan19F-14]
 gi|327390016|gb|EGE88361.1| galactokinase [Streptococcus pneumoniae GA04375]
          Length = 392

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|319893231|ref|YP_004150106.1| Galactokinase [Staphylococcus pseudintermedius HKU10-03]
 gi|317162927|gb|ADV06470.1| Galactokinase [Staphylococcus pseudintermedius HKU10-03]
          Length = 388

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 58/365 (15%), Positives = 120/365 (32%), Gaps = 50/365 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----- 62
           +   APG + L+GEH   +G      AI         LR DR I + S   +  G     
Sbjct: 18  LSAFAPGRINLIGEHTDYNGGFVFPAAIELGTYGVGRLRDDRKIQLYSVNFESAGVMAFD 77

Query: 63  --SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
              LD    H   ++    I ++     + + GFD+ V   + +   L SSA+I +    
Sbjct: 78  LDHLDYNAEHQWANYPKGMIRYLVEQFPEINRGFDIVVEGNIPNGASLSSSASIELLTGH 137

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLI 160
            + TL   +    + +          +   S  +D      G                 +
Sbjct: 138 LVTTLFGIEMERLELVKMGQRVENEFIGVNSGIMDQFIVGFGKKDHAILLDTNTLEYHYV 197

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMG 218
             +   Y I  ++      L  S Y    ++  + ++ ++       + EI+  ++   G
Sbjct: 198 PTEFGDYKISIMNTNKRRELAESKYNERRSECERALAQLQNYLDVQSLGEISVALFEKYG 257

Query: 219 K-------------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
                                ++ + + L+  + +   Q +N     L+    V+  +L 
Sbjct: 258 DKIDDDVLRRRAKHAISENERTKKAYEVLQAHDFEAFGQLLNASHASLKDDYEVTGLELD 317

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPS 317
            +    ++   ++ ++++G+G   C IAL   D  +     V        G         
Sbjct: 318 TLAEAAQQVDGVLGARMTGAGFAGCAIALVHKDKIADLEAKVTKAYTETVGYAPSFYHVD 377

Query: 318 HSTSL 322
            +  +
Sbjct: 378 IANGV 382


>gi|306830002|ref|ZP_07463189.1| galactokinase [Streptococcus mitis ATCC 6249]
 gi|304428013|gb|EFM31106.1| galactokinase [Streptococcus mitis ATCC 6249]
          Length = 392

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVFGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    ++  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRSECEKAVEELQVSLDIQTLGELDEWTFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWDQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|313125993|ref|YP_004036263.1| mevalonate kinase [Halogeometricum borinquense DSM 11551]
 gi|312292358|gb|ADQ66818.1| mevalonate kinase [Halogeometricum borinquense DSM 11551]
          Length = 345

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 74/343 (21%), Positives = 129/343 (37%), Gaps = 34/343 (9%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG 62
           +  +    SAPG + L GEH V++G  A+  AI +R  + +  R+D  + + +      G
Sbjct: 4   ESSNMTVSSAPGKVYLFGEHAVVYGEPAVPCAIERRATVSVETREDSRVRVSAPDLSLDG 63

Query: 63  ---------------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLG 102
                          ++   +      +I +A+   +     P+ GFD+ V S +    G
Sbjct: 64  FTVEYGGNGDERPDVNVSEGLVEAGIEYIDVAVEQARDAANAPNAGFDVTVESDIPLGAG 123

Query: 103 LGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY 162
           LGSSAA+ VA   A      H     +       A      G +S  D      GG +  
Sbjct: 124 LGSSAAVVVASIDAATRELGHPLDPEELAARAYRAEYEVQDGQASRADTFCCAVGGAVRV 183

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQ 222
           +             P  + + G    T +++  +  +  EY    +  + I  L+ +   
Sbjct: 184 EGDDCQHID-APSLPFVVGFDGGAGDTGKLVAGVRSLRDEYDFAADTVESIGDLVRRGES 242

Query: 223 ISCQALRNKN-----LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISG 277
           +  +A    +     L  L + M+   GLLE LGVS   L  +VW  RE      +K++G
Sbjct: 243 VLAEADPTDHPPEDVLAELGRLMDFDHGLLEALGVSSRTLDNMVWAARE-AGAHGAKLTG 301

Query: 278 SGLGDCVIALGKGDLNSLPY-------QSVNCHMHAKGIDIVP 313
           +G G C++AL +                     +   G+ +  
Sbjct: 302 AGGGGCIVALDETAETETALRYTAECEDVFRAELARDGVRVED 344


>gi|323463722|gb|ADX75875.1| galactokinase [Staphylococcus pseudintermedius ED99]
          Length = 388

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 56/365 (15%), Positives = 117/365 (32%), Gaps = 50/365 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----- 62
           +   APG + L+GEH   +G      AI         LR DR I + S   +  G     
Sbjct: 18  LSAFAPGRINLIGEHTDYNGGFVFPAAIELGTYGVGRLRDDRKIQLYSVNFESAGVMAFD 77

Query: 63  --SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
              LD    H   ++    I ++     + + GFD+ V   + +   L SSA+I +    
Sbjct: 78  LDHLDYNAEHQWANYPKGMIRYLVEQFPEINRGFDIVVEGNIPNGASLSSSASIELLTGH 137

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLI 160
            + TL   +    + +          +   S  +D      G                 +
Sbjct: 138 LVTTLFGIEMERLELVKMGQRVENEFIGVNSGIMDQFIVGFGKKDHAILLDTNTLEYHYV 197

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE-------------------- 200
             +   Y I  ++      L  S Y    ++  + ++ ++                    
Sbjct: 198 PTEFGDYKISIMNTNKRRELAESKYNERRSECERALAQLQNYLDVQSLGEISVAQFEKYG 257

Query: 201 -IEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
                ++     K      + ++ + + L+  + +   Q +N     L+    V+  +L 
Sbjct: 258 DKIDDDVLRRRAKHAISENERTKKAYEVLQAHDFEAFGQLLNASHASLKDDYEVTGLELD 317

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPS 317
            +    ++   ++ ++++G+G   C IAL   D  +     V        G         
Sbjct: 318 TLAEAAQQVDGVLGARMTGAGFAGCAIALVHKDKIADLEAKVTKAYTETVGYAPSFYHVD 377

Query: 318 HSTSL 322
            +  +
Sbjct: 378 IANGV 382


>gi|237649633|ref|ZP_04523885.1| galactokinase [Streptococcus pneumoniae CCRI 1974]
 gi|237822100|ref|ZP_04597945.1| galactokinase [Streptococcus pneumoniae CCRI 1974M2]
          Length = 392

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQKAGHVIDKGFDFYVYGNIPNGSGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|284037906|ref|YP_003387836.1| galactokinase [Spirosoma linguale DSM 74]
 gi|283817199|gb|ADB39037.1| galactokinase [Spirosoma linguale DSM 74]
          Length = 389

 Score =  172 bits (435), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 73/350 (20%), Positives = 125/350 (35%), Gaps = 45/350 (12%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ-- 59
           GQ    +  S PG + L+GEH   +    L  AI+K + L +  R D  ++  +      
Sbjct: 21  GQQTPLLICS-PGRVNLIGEHTDYNEGFVLPAAIDKAIYLAVGPRSDNELHFIAHDLNKT 79

Query: 60  YCGSL-DLAMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAIT 114
           + GSL DL   H    +++  +   + +     GF+      +    GL SSAA+   + 
Sbjct: 80  FQGSLTDLTPTHTWADYLLGVVAQFRQAGHQFSGFNCVFGGTIPMGSGLSSSAALENGVG 139

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------L 159
            AL  L          +  +  A    V      +D+ AS+ G                 
Sbjct: 140 FALNELFQLGIDRIALVRLSQRAENEFVGAKVGIMDMFASMMGKADHVIKLDCRSLDYTY 199

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGK 219
              QM   SI   D      L+ S Y T  A+    + +++  YPEI  +      ++ +
Sbjct: 200 APLQMNGISIVLCDSKVKHSLVTSEYNTRRAECEAGVRFLQTFYPEIRSLRDVTMPMLDQ 259

Query: 220 LSQIS---------------------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKL 257
             + +                       AL   ++    Q M      L     VS  +L
Sbjct: 260 HLRDTEPLIYRRCAYVVQENQRLLDGVAALEADDIDTFGQLMYGSHEGLSHWYEVSCPEL 319

Query: 258 SEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             +V   REQP ++ +++ G G G C I L + +      + +     A+
Sbjct: 320 DILVDIAREQPGVLGARMMGGGFGGCTINLVREEALEDFTKLITEQYKAQ 369


>gi|119181177|ref|XP_001241830.1| hypothetical protein CIMG_05726 [Coccidioides immitis RS]
          Length = 612

 Score =  172 bits (435), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 86/383 (22%), Positives = 141/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLIN 52
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T                  D   +
Sbjct: 167 FMVSAPGKVIVFGEHAVVHGKKAMAAAISLRSYLLVTTLSKSRRTVTLNFRDTGLDHTWD 226

Query: 53  IDS-------------SLGQYCGSLDLAMFHP-----------------------SFSFI 76
           IDS                    SLD  +                          + +F+
Sbjct: 227 IDSLPWDVFNHSSKKKFYYDRVTSLDPDLLDAIRPHISNVSPDKPPEVRKVHQGSASAFL 286

Query: 77  IMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P S G    + S +    GLGSSA++ V ++AALL     L       P   
Sbjct: 287 YLYLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDE 346

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    L + G  SG+D   S  G  + ++   YS              P
Sbjct: 347 SEVQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPTVIPILDFPELP 406

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+  ++  +P I +     I+Q   +    +S  +     ++ 
Sbjct: 407 LLLVNSRQSRSTATEVAKVGTLKKLHPAITDCLLDGIDQVTTSAHDFISSENFDKNSSET 466

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L           GLL +LGVS  +L   + +L +   I  +K++G+G G C I L + D 
Sbjct: 467 LNYFGTLFRINHGLLVSLGVSHPRLER-IRELVDHTGIGWTKLTGAGGGGCAITLIRTDR 525

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            S   + +   +  +G +    T
Sbjct: 526 ESTALKPLERQLDEEGYERYETT 548


>gi|116491927|ref|YP_803662.1| galactokinase [Pediococcus pentosaceus ATCC 25745]
 gi|116102077|gb|ABJ67220.1| galactokinase [Pediococcus pentosaceus ATCC 25745]
          Length = 390

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 63/346 (18%), Positives = 122/346 (35%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D L+ + S      G L+  + H 
Sbjct: 26  SPGRINLIGEHTDYNGGHVFPCAISLGTYGGYRRRTDGLVRMYSGNFPEVGVLEFDVNHL 85

Query: 72  SF-------SFIIMAINHIKP------SCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
            F       +++   +  I+         GF+L +   L    GL SSA+I + +   L 
Sbjct: 86  DFEPQYQWSNYLRGMMREIRDLAHADYDHGFELYLEGDLPDGAGLSSSASIEMLMGTILS 145

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC---------------YQ 163
           +    K                 +   S  +D  A   G                     
Sbjct: 146 SEFNFKVDPVVMAKAGQRVENNYIGVNSGIMDQFAVKMGKRNEAIFLDANTMEYEYSPLD 205

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM---- 217
           + K+ +  ++   P  L  S Y T  A+  + +  ++ +     + +++   +       
Sbjct: 206 LGKHIVLIMNTNKPHTLANSEYNTRRAECEQALDCLKRKLNISTLGDLSNPAFDQYTYLI 265

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL N +LK+  + +N     L+    VS  +L  +V
Sbjct: 266 RDETLIKRARHAVFENQRTMDAKKALDNGDLKLFGRLINASHISLQYDYEVSVPELDLLV 325

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +  E   ++ +++ G G G C IAL + D  +   + V     A+
Sbjct: 326 SEAWEHDGVLGARMIGGGFGGCAIALVEQDQVADLIEKVGAKYQAQ 371


>gi|256820343|ref|YP_003141622.1| galactokinase [Capnocytophaga ochracea DSM 7271]
 gi|256581926|gb|ACU93061.1| galactokinase [Capnocytophaga ochracea DSM 7271]
          Length = 385

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 67/345 (19%), Positives = 114/345 (33%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG-------QYCGSL 64
           APG + L+GEH   +G      AI+K     +  R DR   + S               L
Sbjct: 22  APGRVNLIGEHTDYNGGNVFPCAIDKGTYGLVKKRNDRKFRMYSENFADLGVMEFTLDEL 81

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I        K   GFD+     + +  GL SSA+I +     L  
Sbjct: 82  TNDKKHDWANYPKGVIKMFLEAGQKIDSGFDILFSGNIPNGAGLSSSASIEMLTAIVLKD 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYS-------- 168
           L +    S +          L +   S  +D  A   G     I                
Sbjct: 142 LFHLSIDSVEMAQLGKKTENLFIGVNSGIMDQFAIAMGKKDHAILLDCNTLKYAYVPVVL 201

Query: 169 ----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------EINEINQKIYA 215
               I   +      L  S Y    A+  + ++ ++ + P         E  E N+ +  
Sbjct: 202 KDEVIVIANTNKRRGLADSKYNERRAECDEALAELQTKLPIKALGELSIEQFEANKDLIK 261

Query: 216 LM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + + L   NL    + MN+    L     V+  +L  +V 
Sbjct: 262 SPVRQKRAKHAVYENQRTLKAQKELSAGNLAEFGKLMNQSHISLRDDYEVTGVELDTLVA 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              EQP ++ S+++G+G G C +++ K D      ++V      K
Sbjct: 322 LAWEQPGVVGSRMTGAGFGGCTVSIVKKDKVDDFIKNVGEAYKNK 366


>gi|307710725|ref|ZP_07647154.1| galactokinase [Streptococcus mitis SK321]
 gi|307617496|gb|EFN96667.1| galactokinase [Streptococcus mitis SK321]
          Length = 392

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQILRFYSANFEEKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LRNNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYQI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQVALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|332073004|gb|EGI83485.1| galactokinase [Streptococcus pneumoniae GA17545]
          Length = 392

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 126/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SSA++   +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGSGLSSSASLE-ILTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|291550082|emb|CBL26344.1| galactokinase [Ruminococcus torques L2-14]
          Length = 389

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 62/364 (17%), Positives = 124/364 (34%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      A+          R+D  I++ S      G        L
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTLGTYGAARKREDNKIHLYSMNLDSFGVVEASLDDL 83

Query: 65  DLAMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                +   ++ +  +   K        GFD+ +   + +  GL SSA++ V     L  
Sbjct: 84  TNKKEYNWANYPLGVVWAFKEKGHTITSGFDMVIWGNIPNGSGLSSSASLEVLTGVILTD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG----------LICYQMPKY- 167
           L   K+ S  ++            G + G +D  A   G            + Y+     
Sbjct: 144 LFEIKDLSMTDLALIGQYSENNFNGCNCGIMDQFAVAMGKKDHAIFLDTSDLSYEYAPCV 203

Query: 168 ----SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY---------PEINEINQKIY 214
                I   +      L+ S Y     +    +  ++ E          PE  E ++ + 
Sbjct: 204 LDGAKIVITNSKVKHSLVDSAYNDRRNECAAALKALQSELDIQALGDLTPEEFEAHKSLI 263

Query: 215 A------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +++   + MN+    L    GVS  ++  +V
Sbjct: 264 KDEIQLQRAKHAVYENQRTIDAVTALKAGDIESFGKLMNQSHISLRDDYGVSCEEIDILV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHST 320
               + P ++ S+I+G G G C +++ K +      +++   ++   G +    T     
Sbjct: 324 DLAWKIPGVLGSRITGGGFGGCTVSIVKDESIDTFIETIGKTYLEKVGHEAEFYTVDIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GASR 387


>gi|149006492|ref|ZP_01830191.1| galactokinase [Streptococcus pneumoniae SP18-BS74]
 gi|147761790|gb|EDK68753.1| galactokinase [Streptococcus pneumoniae SP18-BS74]
          Length = 392

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 62/355 (17%), Positives = 129/355 (36%), Gaps = 52/355 (14%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           GQ   +I  S PG + L+GEH   +G      AI+         R D+++   S+  +  
Sbjct: 19  GQEADQIFFS-PGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDK 77

Query: 62  GSLDL-------AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAI 109
           G +++          H   ++    ++ ++        GFD  V   + +  GL SS+A 
Sbjct: 78  GIIEVPLADLKFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSAS 136

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
              +T  +    +  +    +++           G++SGI    +I  G           
Sbjct: 137 LELLTGVVAEHLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTN 196

Query: 160 ------ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ 211
                 +   +    +  ++      L  S Y    A+  K +  +++      + E+++
Sbjct: 197 TLEYDLVPLDLKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDE 256

Query: 212 -------------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLG 251
                              +   L  + +  +  AL+  +L+   + MN     LE    
Sbjct: 257 WAVDQYSYLIKDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYE 316

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           V+  +L  +V     Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 317 VTGLELDTLVHTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|262037179|ref|ZP_06010666.1| galactokinase [Leptotrichia goodfellowii F0264]
 gi|261748778|gb|EEY36130.1| galactokinase [Leptotrichia goodfellowii F0264]
          Length = 385

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/362 (16%), Positives = 115/362 (31%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI++     +  R D    + S   +  G        L
Sbjct: 22  SPGRVNLIGEHTDYNGGNVFPCAIDRGTYALIKTRNDNRFRMYSENFEKIGIIEFSLDKL 81

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +    H   ++    I        K + GFD+     + +  GL SSA+I +     L  
Sbjct: 82  ENEKAHDWANYPKGVIKMFIDAGYKINKGFDILFYGNIPNGAGLSSSASIEILTAVILKN 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYSIEKID--- 173
           +        + +        L +   S  +D  A   G     +         E +    
Sbjct: 142 IFGLNIDMIEMVKLGQKTENLFIGVNSGIMDQFAVGMGKKDYAVLLDCNTLKYEYVPVIL 201

Query: 174 ---------FIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
                          L  S Y     +    +  ++ +                      
Sbjct: 202 KDEVIVISNTNKRRGLADSKYNERRGECETALKDLQEKLKIKALGELSIEEFEENKGLIK 261

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E+N    K      + +  + + L   NL+   + MN+    L     V+  +L  +V 
Sbjct: 262 NEVNRKRAKHAVYENQRTIKAQKELSAGNLEEFGKLMNQSHESLRDDYEVTGKELDTLVE 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI--VPITPSHS 319
              +Q  ++ S+++G+G G C +++ K D      ++V      K G D     +  S  
Sbjct: 322 LAWKQDGVIGSRMTGAGFGGCTVSIVKKDKVDDFIKNVGKGYKEKIGYDADFYIVEVSEG 381

Query: 320 TS 321
             
Sbjct: 382 PR 383


>gi|322392402|ref|ZP_08065863.1| galactokinase [Streptococcus peroris ATCC 700780]
 gi|321144937|gb|EFX40337.1| galactokinase [Streptococcus peroris ATCC 700780]
          Length = 392

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWANYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKLTENNFIGVNSGIMDQFAIGMGADQRAIYLNTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V      
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDAVESFKEAVGKRYEE 371


>gi|328947876|ref|YP_004365213.1| Galactokinase [Treponema succinifaciens DSM 2489]
 gi|328448200|gb|AEB13916.1| Galactokinase [Treponema succinifaciens DSM 2489]
          Length = 394

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/354 (16%), Positives = 121/354 (34%), Gaps = 52/354 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
             S+P  + ++GEH   +G      AIN+ + + +  R D  +  +          D+  
Sbjct: 27  IFSSPARINIIGEHIDYNGGKVFPAAINRYLYVAIRKRNDTKVVYNDLKFPGKYEFDIND 86

Query: 69  ---------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    +    + I+  +     K  CGF++ ++S + +  G+ SS+A+      A+
Sbjct: 87  DFKYAKENGYANYLNGILSQMKEKGFKFDCGFEILMVSNVPAAGGISSSSALECGFAYAV 146

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LIC 161
               +       EI             ++ GI     I  G                 + 
Sbjct: 147 SE-TFGFGIDRVEIAKLGQMSEHNFMNVNCGIMDQFIISTGKKNTAIVLDCNTLEYEYVP 205

Query: 162 YQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLK----------KISYIEIEYPEINEINQ 211
            ++  Y    ++      L  S Y    +Q  +          KIS +    PE  E  +
Sbjct: 206 LELGDYRFVVMNTNKQRRLADSKYNERRSQCEEALKILQDGGVKISALCELSPEQLENLK 265

Query: 212 KIYA------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
            +                 +  + +  AL+  NL+ L + +N     L+    V+  +L 
Sbjct: 266 ALIKDELLVRRAKHCVYENQRVKDAVSALKAGNLEKLGKLLNESHESLKNDYEVTGIELD 325

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDI 311
            +    ++Q   + ++++G+G G C IAL   D      ++V        G + 
Sbjct: 326 TLAETAQKQDGCIGARMTGAGFGGCGIALVHKDKVEQFVENVQTEYKKVVGYEA 379


>gi|294497456|ref|YP_003561156.1| galactokinase [Bacillus megaterium QM B1551]
 gi|294347393|gb|ADE67722.1| galactokinase [Bacillus megaterium QM B1551]
          Length = 392

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 60/363 (16%), Positives = 118/363 (32%), Gaps = 54/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      +++      +  R DR I + S      G ++      
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCSLSIGTYAVVQKRHDRKIRMYSKNFSEAGVIESSLEQL 83

Query: 66  ----LAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++            GFD+     + +  GL SSA+I +     L  
Sbjct: 84  TYKTEDDWANYPKGVMDTFKKHGYDLPFGFDILFFGNIPNGAGLSSSASIELVTCVLLNK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL-----------ICYQMPKYS 168
           +         +++  A     +  G+S GI    +I  G            + YQ     
Sbjct: 144 IL-ELNIDMMDLVKMAQQAENEFIGVSCGIMDQFAIGMGKENQAVLLNCQTLEYQYSPLQ 202

Query: 169 IE-----KIDFIFPIHLIYSGYKTPTAQVLKKISYI-------------EIEYPEINEIN 210
           +        +      L  S Y     +  + +S +             + ++ +   + 
Sbjct: 203 LTDAVLVISNTNKRRGLADSKYNERRMECERALSDLQTSLSINSLGDLTKEQFEKHKSLI 262

Query: 211 QKIYALM--------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           Q               + ++ +   L+N +LK   Q MN     L     VS  +L  +V
Sbjct: 263 QNEVDCKRAKHAVYENERTKEAVAKLQNGDLKGFGQLMNESHCSLRDDYEVSGKELDALV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG---IDIVPITPSH 318
                Q  ++ S+++G+G G C I++ +        + V    + K     +   +T   
Sbjct: 323 EAAWLQEGVIGSRMTGAGFGGCTISIVQKAQVDRFVEKVRNTYYEKTSLEAEFYVVTVGE 382

Query: 319 STS 321
              
Sbjct: 383 GAR 385


>gi|116622942|ref|YP_825098.1| galactokinase [Candidatus Solibacter usitatus Ellin6076]
 gi|116226104|gb|ABJ84813.1| galactokinase [Candidatus Solibacter usitatus Ellin6076]
          Length = 403

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 64/362 (17%), Positives = 114/362 (31%), Gaps = 49/362 (13%)

Query: 6   HKICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           H+I V  APG + L+GEH   +G   L  A+     +      D  + I S   +     
Sbjct: 37  HEIRVFRAPGRVNLIGEHTDYNGGFVLPVALELATSVATAPSADGKLRIYSEDRKELREF 96

Query: 65  DLA---------MFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           D A          +      +   +     P    +L + S +    GL SSAA+ V+  
Sbjct: 97  DTAAIATLAPTREWTDYPIGVAQQLAAAGFPIAPANLLICSTVPEGSGLSSSAALEVSSA 156

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIE 170
            A L     +E    E+            G+  G +D   SI G     +          
Sbjct: 157 LAFLK---GRELDKLELAKLCQRAERNFVGMPCGIMDQYISIFGRKHSAVEIDCRSLGHR 213

Query: 171 KIDFIFPIHLIYSG-----------YKTPTAQVLKKISYIE----------------IEY 203
            +     I  I              Y+    +  +  + +                  + 
Sbjct: 214 LVQLPDGITFIAVNTMVKHALSGSAYRDRVRECAEAAAAMHVESLRDVSPAQLQSAAAQL 273

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
           PE+     +              A    ++ ++ + M      L+    VS  +L  +V 
Sbjct: 274 PEVVARRARHVVTEDARVNCFVDASARADVSLMGKLMVESHRSLQHDYEVSCEELDFLVD 333

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID--IVPITPSHS 319
                P ++ S+++G G G C + L + D       ++    +++ GI   I P  PS  
Sbjct: 334 TALTLPGVLGSRMTGGGFGGCTVTLLRSDAAPAFRDAIAQSYNSRYGITPAIYPCDPSDG 393

Query: 320 TS 321
             
Sbjct: 394 AG 395


>gi|73661938|ref|YP_300719.1| galactokinase [Staphylococcus saprophyticus subsp. saprophyticus
           ATCC 15305]
 gi|123643199|sp|Q49ZK2|GAL1_STAS1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|72494453|dbj|BAE17774.1| galactokinase [Staphylococcus saprophyticus subsp. saprophyticus
           ATCC 15305]
          Length = 386

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 64/361 (17%), Positives = 133/361 (36%), Gaps = 55/361 (15%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----- 62
           +   APG + L+GEH   +G      AI        + R DR+I + S+  +  G     
Sbjct: 19  VRAFAPGRINLIGEHTDYNGGYVFPAAIELGTYGLASKRTDRIIQLYSNNFEDTGIVSFT 78

Query: 63  --SLDLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITA 115
              L+    H   ++    + ++K      + GF++ V   + +   L SSA+I + +T 
Sbjct: 79  LDELEFNEQHDWANYPKGVVKYLKEEFNDINQGFNILVEGNIPNGASLSSSASIEL-LTG 137

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------L 159
            L+   ++      +++     +  K  G++SGI     I  G                 
Sbjct: 138 WLIKQLFNLHLERLQLIKLGQVVENKFMGVNSGIMDQFIIGMGKAEHAILLDTATLDFDY 197

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEI-------- 209
           +  +   Y I  ++      L  S Y    ++    +S ++ +     + E+        
Sbjct: 198 VPAKFGDYVISIMNTNKRRSLTESKYNERRSECENALSQLQQQLEITSLGELSLAQFEKY 257

Query: 210 -----------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKL 257
                        K      + ++++ +AL + N +   Q +N     L E   V+  +L
Sbjct: 258 QSLITDEVVCRRAKHAISENERTKLAHKALADNNFEQFGQLLNASHKSLKEDYEVTGIEL 317

Query: 258 SEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPS 317
             +    ++   ++ ++++G+G   C IAL   +      Q +   +    ID +   PS
Sbjct: 318 DTLAETAQQVEGVLGARMTGAGFAGCAIALVDKNS----IQKLEDEVSKAYIDKIGYAPS 373

Query: 318 H 318
            
Sbjct: 374 F 374


>gi|126465130|ref|YP_001040239.1| mevalonate kinase [Staphylothermus marinus F1]
 gi|126013953|gb|ABN69331.1| mevalonate kinase [Staphylothermus marinus F1]
          Length = 324

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 79/318 (24%), Positives = 133/318 (41%), Gaps = 15/318 (4%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            IC +AP  ++L GEH V+    A+V A+N      +T  +     + S   +    +D 
Sbjct: 1   MICSAAPAKVILFGEHFVVKDKPAIVTAVNLYAKTCITELESEKHLLISKQLRLETDIDK 60

Query: 67  AMFH---PSFSFIIMAIN-HIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                    F  I   IN     + GF   + S +    G+GSSAA  V+ T +LL    
Sbjct: 61  DRVPEQLAQFKHIYEIINDKYGITRGFKAFIDSDIPVSSGMGSSAATAVSFTYSLLRFLG 120

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP--IHL 180
             E   ++I   A+     V G  SGID   S +GG+I Y+        + +     + +
Sbjct: 121 V-EFELEDINNIAYEAEKLVHGKPSGIDNTVSTYGGIIYYKRGYMEKLNVKWPQNLSLVV 179

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           + SG K  T +V+     +   Y    EI + IY    +L   +   + +     L + +
Sbjct: 180 VDSGIKRNTGKVV---MDVLERYERHKEIMKHIYDAAEQLVNKARNLILSGRFYDLGELI 236

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           +  QGLLE++GVS  +  +I++ + E    + +KISG+G G  V  L   +  +     +
Sbjct: 237 SINQGLLESIGVSIYETDKIIYAMIE-NGALGAKISGAGRGGIVYGLFMENNLNKAIHKL 295

Query: 301 NCHMHAKGIDIVPITPSH 318
                  G   + + P  
Sbjct: 296 KN----IGYKPIIVKPVE 309


>gi|225855287|ref|YP_002736799.1| galactokinase [Streptococcus pneumoniae JJA]
 gi|225722539|gb|ACO18392.1| galactokinase [Streptococcus pneumoniae JJA]
          Length = 392

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D   +  ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEVFKEAVGKHYEE 371


>gi|148984306|ref|ZP_01817601.1| galactokinase [Streptococcus pneumoniae SP3-BS71]
 gi|147923595|gb|EDK74708.1| galactokinase [Streptococcus pneumoniae SP3-BS71]
 gi|301800635|emb|CBW33278.1| galactokinase [Streptococcus pneumoniae OXC141]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYKE 371


>gi|167628084|ref|YP_001678584.1| galactokinase [Francisella philomiragia subsp. philomiragia ATCC
           25017]
 gi|167598085|gb|ABZ88083.1| galactokinase [Francisella philomiragia subsp. philomiragia ATCC
           25017]
          Length = 385

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/351 (19%), Positives = 119/351 (33%), Gaps = 46/351 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           K+  S PG + L+GEH   +    + FAINK   + +T R D ++N+ S       S ++
Sbjct: 22  KVFFS-PGRVNLIGEHTDYNNGYVMPFAINKGTFISITTRSDNIVNVYSENLDDSTSFNI 80

Query: 67  AM--------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                     +      +I  I     K   G D+ + S L    GL SSA++  A+  A
Sbjct: 81  NEIQQEISNTWQNYIKGVINIIKLDFYKDIKGADIYIFSDLPFGAGLSSSASLNTALAYA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------I 160
              + Y    S  E+   A  +  +  G   G +D  A +                   I
Sbjct: 141 YNEI-YELNISKLELAKIAQKVEHEYIGTKCGIMDQMACLFSKQNAATMIDCNDNHCDNI 199

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLK-----KISYIEIEYPEINEINQKIYA 215
            +++   S+   D     +L  S Y               I  +     E  E  +  + 
Sbjct: 200 PFELDNLSVLICDTNIKHNLADSAYNKRRQVCEDIAKFNNIKSLRELNIEKLEHTKANFN 259

Query: 216 LMGK-----------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                              +  A+  K+   L + M +    L+    VS ++L  +V  
Sbjct: 260 EEDYKLALHVYTENQRVVDATSAMTTKDWCNLGKLMYQSHNSLKNDYKVSCNELDYLVEL 319

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI 314
            +    +  ++++G G G   I L    L     + +      K  +I P 
Sbjct: 320 SQSFAGVYGARMTGGGFGGSTIHLLPTKLLKDYTEYLEKKFSKK-FNIKPT 369


>gi|148989646|ref|ZP_01820978.1| galactokinase [Streptococcus pneumoniae SP6-BS73]
 gi|307128049|ref|YP_003880080.1| galactokinase [Streptococcus pneumoniae 670-6B]
 gi|147924963|gb|EDK76045.1| galactokinase [Streptococcus pneumoniae SP6-BS73]
 gi|306485111|gb|ADM91980.1| galactokinase [Streptococcus pneumoniae 670-6B]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|168491831|ref|ZP_02715974.1| galactokinase [Streptococcus pneumoniae CDC0288-04]
 gi|183573847|gb|EDT94375.1| galactokinase [Streptococcus pneumoniae CDC0288-04]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYKVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|224477255|ref|YP_002634861.1| galactokinase [Staphylococcus carnosus subsp. carnosus TM300]
 gi|11132448|sp|Q9RGS1|GAL1_STACT RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|6707009|gb|AAF25548.1|AF109295_3 GalK [Staphylococcus carnosus]
 gi|222421862|emb|CAL28676.1| galactokinase GalK [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 388

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 60/367 (16%), Positives = 125/367 (34%), Gaps = 52/367 (14%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ----YCG 62
           ++   APG + L+GEH   +G      AI        + R D  I + S+  +       
Sbjct: 18  EVAAFAPGRINLIGEHTDYNGGYVFPAAIELGTYGLASKRNDNKICLYSNNFESTGTIEF 77

Query: 63  SLDLAMF---HPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAIT 114
           SLD   F   H   ++    +  +K        GF++ +   + +   L SSA+I + + 
Sbjct: 78  SLDELQFDTTHSWANYPKGMVKFLKESGYQIDSGFNILIEGNIPNGASLSSSASIEI-LM 136

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------- 158
             LL   ++ E    E++     +  +  G++SGI     +  G                
Sbjct: 137 GWLLKALFNLEVERLELIELGRKVENQFIGVNSGIMDQFIVGMGRKDQAILLDTATLEYH 196

Query: 159 LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------- 204
            +  +   Y I  ++      L  S Y     +    ++ ++ E                
Sbjct: 197 YVPTEFGDYVISIMNTNKRRELAESKYNERLKECQSALALLQQELDVDALGHIDVTTFEK 256

Query: 205 -----EINEINQKIYALM--GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
                E + + ++    +      + +  AL  K+     + +N     L+    V+  +
Sbjct: 257 HAYLIEEDVLLRRARHAITENARVKEAHAALNRKDFIEFGRLLNASHASLKNDYEVTGIE 316

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPIT 315
           L  +    ++   ++ ++++G+G   C IAL   D      + V      K G +     
Sbjct: 317 LDTLAETAQQVEGVLGARMTGAGFAGCAIALVHKDRIKDLEEEVTKIYKDKIGYEPSFYH 376

Query: 316 PSHSTSL 322
                 +
Sbjct: 377 VDIGDGV 383


>gi|221232590|ref|YP_002511744.1| galactokinase [Streptococcus pneumoniae ATCC 700669]
 gi|298230326|ref|ZP_06964007.1| galactokinase [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254712|ref|ZP_06978298.1| galactokinase [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298503578|ref|YP_003725518.1| galactokinase [Streptococcus pneumoniae TCH8431/19A]
 gi|220675052|emb|CAR69630.1| galactokinase [Streptococcus pneumoniae ATCC 700669]
 gi|298239173|gb|ADI70304.1| galactokinase [Streptococcus pneumoniae TCH8431/19A]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|300214230|gb|ADJ78646.1| Galactokinase (Galactose kinase) [Lactobacillus salivarius CECT
           5713]
          Length = 387

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 119/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D  +   S+  +  G ++      
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPCAISLGTYGAARKREDNKLRFYSANFEDLGIIETSLDDL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    I  +K        G D+ +   + +  GL SSA++ + I      
Sbjct: 84  KYDKKDNWVNYAKGMIYFLKETGHDVDKGMDIFIEGNIPNGSGLSSSASLEMLIGVIAQE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L ++ +    +++        K  G++SGI    ++  G                     
Sbjct: 144 L-FNLDIDRVDLVKLGMETENKFIGVNSGIMDQFAVGMGKQNQAILLDTNTLEYSYAPVD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           M    I  ++      L  S Y    ++    +  ++ +     + E++ + +       
Sbjct: 203 MGNNVIVIMNTNKRRELADSKYNERRSECETAVGELQAKLDIKTLGELDAQTFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL   +L+   + +N     LE    V+  +L  + 
Sbjct: 263 EDENRLKRARHAVWENQRTMQAQTALEEGDLEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ ++++G+G G C IA+   D      ++V      K
Sbjct: 323 HTAWKQDGVLGARMTGAGFGGCGIAIVDKDKVEAFKENVGKVYTEK 368


>gi|304385944|ref|ZP_07368285.1| galactokinase [Pediococcus acidilactici DSM 20284]
 gi|304327867|gb|EFL95092.1| galactokinase [Pediococcus acidilactici DSM 20284]
          Length = 395

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 129/352 (36%), Gaps = 52/352 (14%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--- 62
            ++  S PG + L+GEH   +G      AI+         R D  + + S      G   
Sbjct: 27  EEVYFS-PGRINLIGEHTDYNGGHVFPCAISLGTYGAYRGRDDTQVKMYSGNLPDTGIIE 85

Query: 63  ----SLDLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAI 113
                L+    +   +++   +  I+        GF+L +   L    GL SSA+I   +
Sbjct: 86  FDVNDLEYDAKYKWSNYLRGMMLEIRELSHDYDHGFELYLEGDLPDGAGLSSSASIE-ML 144

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------- 158
              +L  Q++   +P E++     +      ++SGI    ++  G               
Sbjct: 145 MGTILNDQFNLRITPIELVKAGQRVENNYIKVNSGIMDQFAVEMGRRNEATFLDTNTMEY 204

Query: 159 -LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYA 215
                 +    I  ++   P  L+ S Y T  A+  + +  ++ +     + E+ +  + 
Sbjct: 205 DYAPLDLNNNVILIMNTNKPHELVNSEYNTRRAECEEALRRLQTKLNINALGELTKDAFD 264

Query: 216 LM-------------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDS 255
                                 + +  + +AL+  +LK+  + ++     L+    VS  
Sbjct: 265 QYAYLINDETLIKRARHAVFENQRTIEAREALKQGDLKLFGRLVSASHVSLQFDYEVSAP 324

Query: 256 KLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +L  +V +  + P ++ +++ G G G C IAL + D      ++V      +
Sbjct: 325 ELDMLVDEAWQSPGVLGARMIGGGFGGCAIALIEKDQVDELVKTVGQKYQDR 376


>gi|322388351|ref|ZP_08061955.1| galactokinase [Streptococcus infantis ATCC 700779]
 gi|321141023|gb|EFX36524.1| galactokinase [Streptococcus infantis ATCC 700779]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVFGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKLTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQAGVLGARMTGAGFGGCAIALVQKDAVESFKEAVGKHYEE 371


>gi|315221637|ref|ZP_07863556.1| galactokinase [Streptococcus anginosus F0211]
 gi|315189288|gb|EFU22984.1| galactokinase [Streptococcus anginosus F0211]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           +PG + L+GEH   +G      AI+         R D L+   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDNLLRFYSANFEDKGIIEVPLEDL 87

Query: 68  ------MFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +       + G D+ V   + +  GL SSA++ +        
Sbjct: 88  RFEKAHNWTNYPKGVLHFLQKAGYVINKGMDIYVFGNIPNGSGLSSSASLELLTGIIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLKLERLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYELVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  ++ +     + E+N+          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELKQKLSIATLGELNEWDFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  + 
Sbjct: 267 QDENRLKRARHAVLENQRTLQAQAALQAGDLGKFGRLMNASHVSLEHDYEVTGLELDTLA 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL + D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVRKDAVEAFQKNVGQKYEE 371


>gi|257126250|ref|YP_003164364.1| galactokinase [Leptotrichia buccalis C-1013-b]
 gi|257050189|gb|ACV39373.1| galactokinase [Leptotrichia buccalis C-1013-b]
          Length = 386

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/345 (17%), Positives = 113/345 (32%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      AI++     +  R D+   + S   +  G ++      
Sbjct: 23  APGRVNLIGEHTDYNGGHVFPCAIHRGTYALVKKRDDKKFRMYSENFENLGIIEFLLDNL 82

Query: 66  -LAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    +        K   GFD+     + +  GL SSA+I +  +  L  
Sbjct: 83  VNEKKHKWVNYPKGVVRMFIEAGYKIDSGFDVLFYGNIPNGSGLSSSASIEIVTSIILKD 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYS-------- 168
           L        + +  +  A    +   S  +D  A   G     I                
Sbjct: 143 LYNLDIDMVEMVKLSQKAENQFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKYSYAPVIL 202

Query: 169 ----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
               +   +      L  S Y    A+  + +  ++ E                      
Sbjct: 203 KDEVLVIGNTNKKRGLADSKYNERRAECEEALKDLQKELDIQSLGELSVEEFNKSEKLIK 262

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            EIN    K      + +  + + L   NL+   + MN     L     V+  +L  +V 
Sbjct: 263 NEINRKRAKHAIYENQRTIKAQKELMEGNLEEFGRLMNESHVSLRDDYEVTGIELDTMVE 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               Q  ++ S+++G+G G C I++ K D      ++V      K
Sbjct: 323 ITWNQEGVIGSRMTGAGFGGCTISIVKKDAVDKFIENVGKEYKEK 367


>gi|197304049|ref|ZP_03169078.1| hypothetical protein RUMLAC_02783 [Ruminococcus lactaris ATCC
           29176]
 gi|197296874|gb|EDY31445.1| hypothetical protein RUMLAC_02783 [Ruminococcus lactaris ATCC
           29176]
          Length = 389

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 61/364 (16%), Positives = 116/364 (31%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      A+          R+DR I+  S      G        L
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTLGTYGAARKREDRKIHFYSMNLDSFGVVEASLDDL 83

Query: 65  DLAMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                +   ++ +  +            GFD+ +   + +  GL SSA++ V     L  
Sbjct: 84  TNKKEYNWANYPLGVVWAFAEKGHPISSGFDMVIWGNIPNGSGLSSSASLEVLTGVILSD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L   K+ S  ++            G + G +D  A   G                     
Sbjct: 144 LFDIKDLSMTDLALIGQYSENNFNGCNCGIMDQFAVAMGKKDHAIFLDTATLDYEYAPCV 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-------------------- 203
           +    I   +      L+ S Y     +    +  ++ +                     
Sbjct: 204 LDGAKIVITNSKVKHSLVDSAYNDRRNECAAALKALQTKLDIQSLGDLSIEEFEANKELI 263

Query: 204 -PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             EI     K      + +  + QAL++  ++   + MN+    L     VS  ++  +V
Sbjct: 264 SDEIQRKRAKHAVYENQRTITAVQALKDGKIEEFGKLMNQSHISLRDDYAVSCDEIDILV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                 P ++ S+I+G G G C +++ K +      +++      K G +    T     
Sbjct: 324 DLAWAIPGVLGSRITGGGFGGCTVSIVKDEAVDTFIETIGKAYAEKVGHEAEFYTVDIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GASR 387


>gi|227891755|ref|ZP_04009560.1| galactokinase [Lactobacillus salivarius ATCC 11741]
 gi|227866414|gb|EEJ73835.1| galactokinase [Lactobacillus salivarius ATCC 11741]
          Length = 387

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 119/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D  +   S+  +  G ++      
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPCAISLGTYGAARKREDNKLRFYSANFEDLGIIETSLDDL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    I  +K        G D+ +   + +  GL SSA++ + I      
Sbjct: 84  KYDKKDNWVNYAKGMIYFLKETGHDVDKGMDIFIEGNIPNGSGLSSSASLEMLIGVIAQE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L ++ +    +++        K  G++SGI    ++  G                     
Sbjct: 144 L-FNLDIDRVDLVKLGMETENKFIGVNSGIMDQFAVGMGKQNQAILLDTNTLEYSYAPVD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           M    I  ++      L  S Y    ++    +  ++ +     + E++ + +       
Sbjct: 203 MGNNVIVIMNTNKRRELADSKYNERRSECETAVGELQAKLDINTLGELDAQTFDEYAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL   +L+   + +N     LE    V+  +L  + 
Sbjct: 263 EDENRLKRARHAVWENQRTMQAQAALEEGDLEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ ++++G+G G C IA+   D      ++V      K
Sbjct: 323 HTAWKQEGVLGARMTGAGFGGCGIAIVDKDKVEAFKENVGKVYTEK 368


>gi|239827439|ref|YP_002950063.1| galactokinase [Geobacillus sp. WCH70]
 gi|239807732|gb|ACS24797.1| galactokinase [Geobacillus sp. WCH70]
          Length = 394

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/359 (15%), Positives = 106/359 (29%), Gaps = 50/359 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G   L  A+       +       I   S      G +       
Sbjct: 25  APGRVNLIGEHTDYNGGHVLPCALEIGTYALVRKTAHPFIRFYSKNFPETGIITVSYDDL 84

Query: 65  ---DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
              D   +      +I A     P   G D+     + +  GL SSA+I +     +  L
Sbjct: 85  SYQDKHGWANYPKGVIAAFQSFYPIETGLDILYYGTIPNGAGLSSSASIELVTAVMMNEL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQM 164
            + +     E++  +  +  +  G++ GI    ++  G                 I    
Sbjct: 145 -FEQHIDMLELVKMSQKVENEYVGVNCGIMDQFAVGMGKRNHAILLNCQTLAYRYIPVAF 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALMGK--- 219
              SI   +      L  S Y    +     +  ++       + E+  +          
Sbjct: 204 NHCSIVIANTNKKRGLADSAYNERRSTCEAALLKLKEHLNIESLGELTSEQLEQYDHLLS 263

Query: 220 ---------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                           +  +  AL   +L    + M +    L     V+  +L  +V  
Sbjct: 264 PIEQKRARHAVTENERTIQAADALEKGDLARFGELMKQSHISLRDDYEVTGLELDTLVEA 323

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
                  + ++++G+G G C + + K +      + V      K G +           
Sbjct: 324 AWNHEGTIGARMTGAGFGGCTVNIVKDEFIPSFIEQVGNEYAKKIGYEASFYVVKIGDG 382


>gi|148993311|ref|ZP_01822851.1| galactokinase [Streptococcus pneumoniae SP9-BS68]
 gi|148998717|ref|ZP_01826155.1| galactokinase [Streptococcus pneumoniae SP11-BS70]
 gi|168483385|ref|ZP_02708337.1| galactokinase [Streptococcus pneumoniae CDC1873-00]
 gi|168489869|ref|ZP_02714068.1| galactokinase [Streptococcus pneumoniae SP195]
 gi|168494232|ref|ZP_02718375.1| galactokinase [Streptococcus pneumoniae CDC3059-06]
 gi|168574958|ref|ZP_02720921.1| galactokinase [Streptococcus pneumoniae MLV-016]
 gi|169833665|ref|YP_001695220.1| galactokinase [Streptococcus pneumoniae Hungary19A-6]
 gi|182684797|ref|YP_001836544.1| galactokinase [Streptococcus pneumoniae CGSP14]
 gi|303258799|ref|ZP_07344779.1| galactokinase [Streptococcus pneumoniae SP-BS293]
 gi|303261962|ref|ZP_07347908.1| galactokinase [Streptococcus pneumoniae SP14-BS292]
 gi|303263824|ref|ZP_07349746.1| galactokinase [Streptococcus pneumoniae BS397]
 gi|303265641|ref|ZP_07351540.1| galactokinase [Streptococcus pneumoniae BS457]
 gi|303268750|ref|ZP_07354539.1| galactokinase [Streptococcus pneumoniae BS458]
 gi|307068468|ref|YP_003877434.1| galactokinase [Streptococcus pneumoniae AP200]
 gi|147755411|gb|EDK62460.1| galactokinase [Streptococcus pneumoniae SP11-BS70]
 gi|147928078|gb|EDK79097.1| galactokinase [Streptococcus pneumoniae SP9-BS68]
 gi|168996167|gb|ACA36779.1| galactokinase [Streptococcus pneumoniae Hungary19A-6]
 gi|172043186|gb|EDT51232.1| galactokinase [Streptococcus pneumoniae CDC1873-00]
 gi|182630131|gb|ACB91079.1| galactokinase [Streptococcus pneumoniae CGSP14]
 gi|183571749|gb|EDT92277.1| galactokinase [Streptococcus pneumoniae SP195]
 gi|183575751|gb|EDT96279.1| galactokinase [Streptococcus pneumoniae CDC3059-06]
 gi|183578689|gb|EDT99217.1| galactokinase [Streptococcus pneumoniae MLV-016]
 gi|301802545|emb|CBW35306.1| galactokinase [Streptococcus pneumoniae INV200]
 gi|302637045|gb|EFL67534.1| galactokinase [Streptococcus pneumoniae SP14-BS292]
 gi|302640300|gb|EFL70755.1| galactokinase [Streptococcus pneumoniae SP-BS293]
 gi|302641706|gb|EFL72064.1| galactokinase [Streptococcus pneumoniae BS458]
 gi|302644768|gb|EFL75016.1| galactokinase [Streptococcus pneumoniae BS457]
 gi|302646862|gb|EFL77087.1| galactokinase [Streptococcus pneumoniae BS397]
 gi|306410005|gb|ADM85432.1| Galactokinase [Streptococcus pneumoniae AP200]
 gi|332072676|gb|EGI83159.1| galactokinase [Streptococcus pneumoniae GA17570]
 gi|332200409|gb|EGJ14482.1| galactokinase [Streptococcus pneumoniae GA47368]
          Length = 392

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|90961358|ref|YP_535274.1| galactokinase [Lactobacillus salivarius UCC118]
 gi|301301070|ref|ZP_07207230.1| galactokinase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122449316|sp|Q1WUZ4|GAL1_LACS1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|90820552|gb|ABD99191.1| Galactokinase [Lactobacillus salivarius UCC118]
 gi|300851340|gb|EFK79064.1| galactokinase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 387

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 119/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D  +   S+  +  G ++      
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPCAISLGTYGAARKREDNKLRFYSANFEDLGIIETSLDDL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    I  +K        G D+ +   + +  GL SSA++ + I      
Sbjct: 84  KYDKKDNWVNYAKGMIYFLKETGHDVDKGMDIFIEGNIPNGSGLSSSASLEMLIGVIAQE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L ++ +    +++        K  G++SGI    ++  G                     
Sbjct: 144 L-FNLDIDRVDLVKLGMETENKFIGVNSGIMDQFAVGMGKQNQAILLDTNTLEYSYAPVD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           M    I  ++      L  S Y    ++    +  ++ +     + E++ + +       
Sbjct: 203 MGNNVIVIMNTNKRRELADSKYNERRSECETAVGELQAKLDIKTLGELDAQTFDEYAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL   +L+   + +N     LE    V+  +L  + 
Sbjct: 263 EDENRLKRARHAVWENQRTMQAQAALEEGDLEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ ++++G+G G C IA+   D      ++V      K
Sbjct: 323 HTAWKQEGVLGARMTGAGFGGCGIAIVDKDKVEAFKENVGKVYTEK 368


>gi|332199874|gb|EGJ13949.1| galactokinase [Streptococcus pneumoniae GA41317]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPVAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  +++      + E+++        L 
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVSLDIQTLGELDEWAVDQYSYLI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQVALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|322375766|ref|ZP_08050278.1| galactokinase [Streptococcus sp. C300]
 gi|321279474|gb|EFX56515.1| galactokinase [Streptococcus sp. C300]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/344 (16%), Positives = 118/344 (34%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++ +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SSA++ +        
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGSGLSSSASLELLTGVVAEH 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   K    D +          +   S  +D  A   G                L+   +
Sbjct: 148 LFGLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDL 207

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
               +  ++      L  S Y    A+  K +  ++       + E+++  +        
Sbjct: 208 KDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQAAMDIQTLGELDEWAFDQYSYLIK 267

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +  AL+  +L+   + MN     LE    V+  +L  +V 
Sbjct: 268 DENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLVH 327

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              +Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 328 TAWDQEGVLGARMTGAGFGGCAIALVQKDAVEAFKEAVGKHYEE 371


>gi|295702828|ref|YP_003595903.1| galactokinase [Bacillus megaterium DSM 319]
 gi|294800487|gb|ADF37553.1| galactokinase [Bacillus megaterium DSM 319]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 118/363 (32%), Gaps = 54/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      +++      +  R DR I + S      G ++      
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCSLSIGTYAVVQKRHDRKIRMYSKNFSEAGVIESSLEQL 83

Query: 66  ----LAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++            GFD+     + +  GL SSA+I +     L  
Sbjct: 84  TYKTEDDWANYPKGVMDTFKKHGYDLPFGFDILFFGNIPNGAGLSSSASIELVTCVLLNK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL-----------ICYQMPKYS 168
           +         +++  A     +  G+S GI    +I  G            + YQ     
Sbjct: 144 IL-ELNIDMMDLVKMAQQAENEFIGVSCGIMDQFAIGMGKENQAVLLNCQTLEYQYSPLQ 202

Query: 169 IE-----KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGK-- 219
           +        +      L  S Y     +  + +S ++       + ++ ++ +       
Sbjct: 203 LTDAVLVISNTNKRRGLADSKYNERRMECERALSDLQTSLSINSLGDLTKEQFEKYKFLI 262

Query: 220 -----------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             ++ +   L+N +LK   Q MN     L     VS  +L  +V
Sbjct: 263 QNEVDCKRAKHAVYENERTKEAVAKLQNGDLKGFGQLMNESHCSLRDDYEVSGKELDALV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKG---IDIVPITPSH 318
                Q  ++ S+++G+G G C I++ +        + V    + K     +   +T   
Sbjct: 323 EAAWLQEGVIGSRMTGAGFGGCTISIVQKAQVDRFIEQVRDTYYEKTSLEAEFYVVTVGE 382

Query: 319 STS 321
              
Sbjct: 383 GAR 385


>gi|149024977|ref|ZP_01836357.1| galactokinase [Streptococcus pneumoniae SP23-BS72]
 gi|168487338|ref|ZP_02711846.1| galactokinase [Streptococcus pneumoniae CDC1087-00]
 gi|147929470|gb|EDK80465.1| galactokinase [Streptococcus pneumoniae SP23-BS72]
 gi|183569823|gb|EDT90351.1| galactokinase [Streptococcus pneumoniae CDC1087-00]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 126/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKREDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|320536050|ref|ZP_08036108.1| galactokinase [Treponema phagedenis F0421]
 gi|320147100|gb|EFW38658.1| galactokinase [Treponema phagedenis F0421]
          Length = 427

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/364 (16%), Positives = 130/364 (35%), Gaps = 56/364 (15%)

Query: 2   GQCLHKICVSA-PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G+  + + V A PG + ++GEH   +G      AI++ + + +  R D  I       ++
Sbjct: 54  GESNNSVIVIASPGRINIIGEHIDYNGGKVFPAAIDRFLYVLIRERSDTKII--YDDIRF 111

Query: 61  CGSLDLAMFH-----------PSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSA 107
            G L   +                + +   +    +    GF++ + S+L +  G+ SS+
Sbjct: 112 PGRLVFDIHDTFTYDKKNDYANYLNGMYTILQNKGLNVLSGFEVLLFSKLPAGGGISSSS 171

Query: 108 AITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------- 158
           A+ +    AL  L +  +     +         +   ++ GI    SI  G         
Sbjct: 172 ALEIGFGLALAKL-FDFKIDGIALAKAGQQSEHEFMSVNCGIMDQFSIAMGKKNYAMLLD 230

Query: 159 -------LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------- 204
                   +  ++  Y    ++      L  S Y    ++  + +  ++   P       
Sbjct: 231 TASLEYEYVPLELKSYKFIVMNSNKQRSLADSKYNERRSECEEGLRLLQKALPVNFLCEI 290

Query: 205 ------------EINEINQKIYALM--GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-T 249
                           I +++   +   +    +  AL+ ++LK L + +N+    L+  
Sbjct: 291 TADDFFANQHLISDETIKKRVRHCIFENERVYKAVAALQKEDLKTLGELLNQSHQSLKSD 350

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKG 308
             V+  +L  +     +Q   + ++I+G+G G C IAL   +      +SV   +    G
Sbjct: 351 YEVTGFELDCLQEAAVKQEGCLGARITGAGFGGCAIALVHKNSIDAFIESVSKEYFEKTG 410

Query: 309 IDIV 312
           +   
Sbjct: 411 LRAE 414


>gi|225857441|ref|YP_002738952.1| galactokinase [Streptococcus pneumoniae P1031]
 gi|225726355|gb|ACO22207.1| galactokinase [Streptococcus pneumoniae P1031]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D   +  ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEVFKEAVGKHYEE 371


>gi|15901681|ref|NP_346285.1| galactokinase [Streptococcus pneumoniae TIGR4]
 gi|111658195|ref|ZP_01408890.1| hypothetical protein SpneT_02000629 [Streptococcus pneumoniae
           TIGR4]
 gi|24211721|sp|Q97NZ6|GAL1_STRPN RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|14973355|gb|AAK75925.1| galactokinase [Streptococcus pneumoniae TIGR4]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  +++      + E+++        L 
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVSLDIQTLGELDEWAVDQYSYLI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQVALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|301794817|emb|CBW37273.1| galactokinase [Streptococcus pneumoniae INV104]
 gi|332201263|gb|EGJ15334.1| galactokinase [Streptococcus pneumoniae GA47901]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVFENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|168466358|ref|ZP_02700220.1| galactokinase [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195630966|gb|EDX49552.1| galactokinase [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 382

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNTFGGVDIVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|329115938|ref|ZP_08244655.1| galactokinase [Streptococcus parauberis NCFD 2020]
 gi|326906343|gb|EGE53257.1| galactokinase [Streptococcus parauberis NCFD 2020]
          Length = 387

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI          R+D+ +   S   +  G +++ + + 
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKREDKKLRFYSGNFEEVGMIEVDLDNL 83

Query: 72  SF-------SFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F       ++    I  ++        GFDL V   + +  GL SSA++ + +      
Sbjct: 84  VFEKEDNWTNYAKGVIKFLQEAGHVIDSGFDLYVFGNIPNGSGLSSSASLELLVGIVCEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FDLKLERLDLVKIGKLTENQFIGVNSGIMDQFAIGMGADKRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM---- 217
           +  + I  ++      L  S Y    A+  K +  +  +     + E++   +       
Sbjct: 203 LGNHVIVIMNTNKRRELADSKYNERRAECEKAVEELNDKLNIKTLGELDANTFDQFAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  +V
Sbjct: 263 KDGNRIKRARHAVLENQRTLNARKALEEGRLEDFGRIVNASHVSLEHDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IA+   D      + V  H   
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIAIVAKDKVEAFKEVVGKHYTE 367


>gi|319938994|ref|ZP_08013358.1| galactokinase [Streptococcus anginosus 1_2_62CV]
 gi|319812044|gb|EFW08310.1| galactokinase [Streptococcus anginosus 1_2_62CV]
          Length = 392

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D L+   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDNLLRFYSANFEDKGIIEVPLENL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SS+A    +T  +  
Sbjct: 88  RFEKEHNWTNYPKGVLHFLQKAGHVIDKGMDVYVFGNIPNGSGL-SSSASLELLTGIIAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 147 RLFDLKLERLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  ++ +     + E+N+          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELKQKLSIATLGELNEWDFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  NL+   + MN     LE    V+  +L  + 
Sbjct: 267 QDENRLKRARHAVLENQRTLQAQAALQAGNLEKFGRLMNASHVSLEHDYEVTGLELDTLA 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL + D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVRKDAVEAFQKNVGQKYEE 371


>gi|302911969|ref|XP_003050610.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731547|gb|EEU44897.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 496

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/391 (19%), Positives = 142/391 (36%), Gaps = 77/391 (19%)

Query: 1   MGQCL-HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSL 57
           M   +     VSAPG +++ GEH V+HG AA+  AI+ R  L++T   +  R +++    
Sbjct: 41  MSSPMAPPFMVSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFPD 100

Query: 58  GQYCGSLDLAMF-----------HPSFSFIIMA-----------INHIKPSCGFDLK--- 92
                + ++                 +S +              IN + P    +++   
Sbjct: 101 IDLVHTWNIDELPWQAFQQPSKKKSYYSLVTELDPDLVAALQPHINVVSPDRPEEIRRVH 160

Query: 93  -------------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYH 123
                                    + S +    GLGSSA+I+V ++AALL    TL   
Sbjct: 161 RSSASAFLYLFLSLGWPSFPGCLYTLRSTIPIGAGLGSSASISVCLSAALLLQLRTLSGP 220

Query: 124 KEPSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
               P          I   A    + + G  SG+D   +  G  + +Q   YS       
Sbjct: 221 HPDQPPDEARLQVERINRWAFVSEMCIHGNPSGVDNTVATQGKAVVFQRTDYSKPPSVRP 280

Query: 176 FPIHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQIS 224
                      + +     TA  + K++ ++  +P++     + +++        +  I 
Sbjct: 281 LWDFPELPLLLVDTRQAKSTAHEVGKVAKLKQTHPKLVGTILDAMDRVTNTAADLIEDIH 340

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
                 + L  + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C 
Sbjct: 341 FDNESEECLTKVGELMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCS 399

Query: 285 IALGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           I L + D  +     +   +  +       T
Sbjct: 400 ITLLRPDAPAEKLHKLEEQLEDENYAKFETT 430


>gi|309798814|ref|ZP_07693078.1| galactokinase [Streptococcus infantis SK1302]
 gi|308117631|gb|EFO55043.1| galactokinase [Streptococcus infantis SK1302]
          Length = 392

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++ +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVFGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 YLFDLKLDRLDLVKIGKLTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAILENQRTLKAQAALQAGDLDKFGRLMNASHVSLENDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDAVEAFKEAVGKHYEE 371


>gi|229817051|ref|ZP_04447333.1| hypothetical protein BIFANG_02306 [Bifidobacterium angulatum DSM
           20098]
 gi|229784840|gb|EEP20954.1| hypothetical protein BIFANG_02306 [Bifidobacterium angulatum DSM
           20098]
          Length = 391

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D  +   S+  +  G ++      
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDNKLRFYSANFEEVGIVESRLDEL 83

Query: 67  --AMFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    +  +         G D+ V   + +  GL SSA++ + I      
Sbjct: 84  VYKKEDNWTNYAKGVLKFLGEEGHAITSGMDVFVYGNIPNGSGLSSSASLELLIGIIAQE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FDLKLERVDLVKIGKRTENEFIGVNSGIMDQFAIGMGAENKAIYLDTNTLVYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYI--EIEYPEINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +  ++    + E+++  +       
Sbjct: 203 LGDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNAKLNIKTLGELDEASFDEYAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL + +L    + MN     LE    V+  +L  +V
Sbjct: 263 KDGNRIRRARHAVSENQRTLKARKALESGDLDRFGRLMNASHVSLEQDYEVTGLELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IA+   D  +   ++V      
Sbjct: 323 HTAWEQDGVIGARMTGAGFGGCAIAIVNKDKVNAFTKAVGTKYEE 367


>gi|322377539|ref|ZP_08052030.1| galactokinase [Streptococcus sp. M334]
 gi|321281739|gb|EFX58748.1| galactokinase [Streptococcus sp. M334]
          Length = 392

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLTDL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +     L 
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +LK   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQVALQAGDLKTFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDAVDAFKEAVGKHYEE 371


>gi|307707556|ref|ZP_07644038.1| galactokinase [Streptococcus mitis NCTC 12261]
 gi|307616508|gb|EFN95699.1| galactokinase [Streptococcus mitis NCTC 12261]
          Length = 392

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFFVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +     L 
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQVALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWTQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|313904421|ref|ZP_07837798.1| galactokinase [Eubacterium cellulosolvens 6]
 gi|313470757|gb|EFR66082.1| galactokinase [Eubacterium cellulosolvens 6]
          Length = 393

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/363 (16%), Positives = 111/363 (30%), Gaps = 52/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      A+          R D+ I   S+   + G ++      
Sbjct: 28  APGRVNLIGEHIDYNGGHVFPCALTLGTYGVARKRADKKIRFYSTNLAHTGVIEADLDDL 87

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A   N   P CGFD      + ++ GL SSA++ V     L+ 
Sbjct: 88  VYKKEDDWANYAKGVVWAFMENGFVPECGFDFACTGTIPNKSGLSSSASLEVLTGTVLMG 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKY--------- 167
           L             +  A    V      +D  AS  G     I                
Sbjct: 148 LFGFDTDQVQNARFSQLAENKFVGMNCGIMDQFASAKGQEDKAILLDCATLDYTYTPVVL 207

Query: 168 ---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------- 202
               +  ++   P  L  S Y     +  + +  +  +                      
Sbjct: 208 GDAKLVIVNTNKPHELTNSAYNDRRRECEEALELLRTKKDIQAICQLSPEEFEEIKDVIT 267

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
            P + +  +       +      + L   N+    + M      L     VS  +L  +V
Sbjct: 268 DPVVQKRAKHAVYEENRCVTAVKE-LNAGNIPAFGKLMLGSHESLRDDFEVSCEELDVLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
            +  +    + ++++G G G C + + KGD      ++V     A+ G+       S   
Sbjct: 327 EEAWKCEGTIGARMTGGGFGGCTVNIVKGDAVDSFVKTVGERYQARTGLVADFYVVSIGD 386

Query: 321 SLY 323
             +
Sbjct: 387 GAH 389


>gi|171059923|ref|YP_001792272.1| galactokinase [Leptothrix cholodnii SP-6]
 gi|170777368|gb|ACB35507.1| galactokinase [Leptothrix cholodnii SP-6]
          Length = 387

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 62/346 (17%), Positives = 118/346 (34%), Gaps = 50/346 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
            V APG + L+GEH   +    L  AI+   ++    R DRL+ + ++   Y   LD   
Sbjct: 24  VVHAPGRVNLIGEHTDYNDGFVLPCAIDYHTLVAAQPRDDRLVRVVAA--DYGNKLDEFS 81

Query: 69  FHPSFS---------------FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
                                 + M ++H  P  G +L V   +    GL SSA++ VAI
Sbjct: 82  LDAPIKPLTAGDMGWANYVRGMVKMLLDHGLPLRGAELAVAGNVPQGAGLSSSASLEVAI 141

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAAS----IHGGLICYQMPKYSI 169
             A  TLQ   E S  EI   A     +  GI+ GI           G  +         
Sbjct: 142 GQAFKTLQGFDELSATEIALLAQKAENRFVGINCGIMDQLISARGAAGHALLIDCRSLDA 201

Query: 170 EKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPEINE 208
             +     + ++    +     V  + +    +                       E   
Sbjct: 202 APVHLPDDVAVLIVHSRVKRGLVDSEYNTRRQQCEAAARHYGVPALRDVDEARLLAERGS 261

Query: 209 INQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           ++++++     +   +       +AL   +L+ + + M      +     ++   + ++V
Sbjct: 262 LDERVFRRARHIVTENQRTLDAAEALAANDLRRMGELMAASHASMRDDFEITVPAIDQLV 321

Query: 262 WKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
             L+        ++++G G G CV+AL    +      ++     A
Sbjct: 322 EILQGVIGTAGGARMTGGGFGGCVVALLPEAMVDAARTAIEAQYRA 367


>gi|225859615|ref|YP_002741125.1| galactokinase [Streptococcus pneumoniae 70585]
 gi|225720018|gb|ACO15872.1| galactokinase [Streptococcus pneumoniae 70585]
          Length = 392

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 126/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKREDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKETVGKHYEE 371


>gi|18976817|ref|NP_578174.1| galactokinase [Pyrococcus furiosus DSM 3638]
 gi|24211722|sp|Q9HHB6|GAL1_PYRFU RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|11066092|gb|AAG28454.1|AF195244_1 galactokinase [Pyrococcus furiosus DSM 3638]
 gi|18892415|gb|AAL80569.1| galactokinase [Pyrococcus furiosus DSM 3638]
          Length = 352

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 61/356 (17%), Positives = 107/356 (30%), Gaps = 42/356 (11%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           + KI V +PG + L+GEH        +  AI+   I+         + + S       + 
Sbjct: 1   MSKITVKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITAEKYD--KVQLYSEHFNEEKTF 58

Query: 65  DLAMFHP---SFSFIIMAI----NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
            L           ++   +           G   K+   L    GL SSA+  V I   L
Sbjct: 59  TLDNLTKEGSWIDYVKGVLWVLIQEGYKIGGLKGKITGDLPLGAGLSSSASFEVGILEVL 118

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGGL---ICYQMPKYSIEKID 173
             L Y+    P +    A     +  G+  GI D  A + G     I         E I 
Sbjct: 119 NQL-YNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIP 177

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEI-----------------------EYPEINEIN 210
           F   + ++             + +  +                        + P ++   
Sbjct: 178 FPKDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKF 237

Query: 211 QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVWKLREQPH 269
                           AL+  +++ + + +      L E   VS  +L   V K  E   
Sbjct: 238 FSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAMEL-G 296

Query: 270 IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI---VPITPSHSTSL 322
              ++++G+G G   IAL   D       ++     AK         + PS    +
Sbjct: 297 AYGARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVGV 352


>gi|327265009|ref|XP_003217301.1| PREDICTED: galactokinase-like [Anolis carolinensis]
          Length = 394

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/364 (17%), Positives = 127/364 (34%), Gaps = 49/364 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ------- 59
           +I VSAPG + L+GEH   +    L  A+    ++  + R+D++I+I ++  +       
Sbjct: 30  RIAVSAPGRVNLIGEHTDYNRGFVLPMALQMSTVMVGSPREDKIISIVTTSEEADEPKKV 89

Query: 60  -YCGSLDLAMFHP----SFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVA 112
            +    +    +P      +++   + H K  P  GF+  + S +    GL SSA++ VA
Sbjct: 90  QFPVPEEGVTLNPGKPHWANYVKGVVQHYKADPLPGFNAVISSNVPLGGGLSSSASLEVA 149

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS 168
           +   L  L    +  P                +  G +D   S+ G     +        
Sbjct: 150 MYTFLQQLC-PDDGDPVAKALVCQKAEHTFAMMPCGIMDQFISVMGKEGHALLIDCRSLE 208

Query: 169 IEKIDFIFPIHLIYSG------------YKTPTAQVLKKISYI--------------EIE 202
              +    P  ++               Y T   Q  +    +              + +
Sbjct: 209 TRLVPLADPNVVVLITNSNVRHTLTGSEYPTRRHQCEEAAKVLGKPSLREATLADLEKAK 268

Query: 203 YPEINEINQKIYALMGK--LSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSE 259
                E+ ++   ++G+   +  + + L++ + +   Q M      L     VS  +L E
Sbjct: 269 VHLSEEVYRRAKHVIGEIERTVRAVEVLQSMDYRRFGQLMVESHNSLRDDYEVSCPELDE 328

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHS 319
           +V    E P +  S+++G G G C + L +        + +               PS  
Sbjct: 329 LVSAAMEVPEVYGSRMTGGGFGGCTVTLLESGAAEKVVKHIKEKYSGTPTFYFS-KPSDG 387

Query: 320 TSLY 323
             ++
Sbjct: 388 AKVH 391


>gi|149011285|ref|ZP_01832532.1| galactokinase [Streptococcus pneumoniae SP19-BS75]
 gi|147764275|gb|EDK71206.1| galactokinase [Streptococcus pneumoniae SP19-BS75]
          Length = 392

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 127/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R+D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKREDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D+     ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDIVEAFKEAVGKHYEE 371


>gi|331265832|ref|YP_004325462.1| galactokinase, (Galactose kinase) [Streptococcus oralis Uo5]
 gi|326682504|emb|CBZ00121.1| galactokinase, (Galactose kinase) [Streptococcus oralis Uo5]
          Length = 392

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 57/344 (16%), Positives = 119/344 (34%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++ +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGVARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SSA++ +        
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVFGNIPNGAGLSSSASLELLTGVVAEH 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   K    D +          +   S  +D  A   G                L+   +
Sbjct: 148 LFGLKLDRLDLVKIGKQTENYFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDL 207

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
               +  ++      L  S Y    A+  K +  +++      + E+++ ++        
Sbjct: 208 KDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWVFDQYSYLIK 267

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +  AL+  +L+   + MN     LE    V+  +L  +V 
Sbjct: 268 DENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLVH 327

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 328 AAWVQEGVLGARMTGAGFGGCAIALVQKDAVEAFKEAVGKHYEE 371


>gi|15790225|ref|NP_280049.1| mevalonate kinase [Halobacterium sp. NRC-1]
 gi|169235954|ref|YP_001689154.1| mevalonate kinase [Halobacterium salinarum R1]
 gi|10580685|gb|AAG19529.1| mevalonate kinase [Halobacterium sp. NRC-1]
 gi|167727020|emb|CAP13806.1| mevalonate kinase [Halobacterium salinarum R1]
          Length = 330

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/333 (21%), Positives = 130/333 (39%), Gaps = 35/333 (10%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI-------------DS 55
             SAPG + L GEH V++G  A+  AI +R  + ++ R+D  + +              S
Sbjct: 4   TSSAPGKVYLFGEHAVVYGEPAVPCAIERRAHVTVSEREDSRLRVCSGDLSIDGFTVEYS 63

Query: 56  SLGQYCGSLDLAMFHPSFSFIIMAIN---------HIKPSCGFDLKVISQLDSQLGLGSS 106
                 G+ D+ +  P     +  ++            P+ GFD+ + S++    GLGSS
Sbjct: 64  GDRDAGGTPDVDVPAPIVDAAMGYVDAAVEQARAAADAPTAGFDVTIDSEIPLGAGLGSS 123

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           AA+ VA   A       +  + +              G +S  D   S  GG++      
Sbjct: 124 AAVVVAGIDAATRELGVELDAREVADRAYQVEHTVQDGEASRADTFCSAMGGVVRVSGDD 183

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
            +        P  + Y G    T +++  +  +  E+  + +    I    G L +    
Sbjct: 184 CTTLD-APALPFVIGYDGTSHDTGELVAGVRALREEFGFVADTVTAI----GDLVRRGEA 238

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
           AL + ++  L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G  ++A
Sbjct: 239 ALADGDVATLGRLMDINHGLLSGLGVSGRTLDAMVWAARD-GGADGAKLTGAGGGGSIVA 297

Query: 287 LGKGDLNSLPY-------QSVNCHMHAKGIDIV 312
           L  G               +    +  +G+ + 
Sbjct: 298 LDAGSGAETALSLTPDCEAAFRADLAREGVRVE 330


>gi|311280372|ref|YP_003942603.1| galactokinase [Enterobacter cloacae SCF1]
 gi|308749567|gb|ADO49319.1| galactokinase [Enterobacter cloacae SCF1]
          Length = 382

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 66/360 (18%), Positives = 125/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R+DR + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAPRQDRTVRVIAADYDNQTDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQKRNRSFNGVDMVISGDVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGTRAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALM-- 217
                ++  I+  F   L+ S Y T   Q      + +        +NE N+  + L   
Sbjct: 201 MPKGAAVIIINSNFKRTLVGSEYNTRRQQCETGARFFQQPALRDVTLNEFNKVAHELDPV 260

Query: 218 -----------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                         +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHVSMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL    L  +  ++V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCIVALVPEALVPVVKEAVAAQYEAKTGIKETFYVCKPSQGAG 380


>gi|62179342|ref|YP_215759.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|75505834|sp|Q57RI3|GAL1_SALCH RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|62126975|gb|AAX64678.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713813|gb|EFZ05384.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 382

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVEEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|218290160|ref|ZP_03494319.1| galactokinase [Alicyclobacillus acidocaldarius LAA1]
 gi|218239755|gb|EED06945.1| galactokinase [Alicyclobacillus acidocaldarius LAA1]
          Length = 405

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 58/368 (15%), Positives = 109/368 (29%), Gaps = 56/368 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G   L  A+     L +  R DR     ++       +       
Sbjct: 28  APGRVNLIGEHTDYNGGYVLPAALTMGTWLVVRPRADRRFRFATTFSDRVVEVSADDVRF 87

Query: 68  ----MFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                F      +I  +      + G DL     L    GL SSA++ V    A+  L  
Sbjct: 88  RPEQDFANYPLGVIDVLRRRGVEAPGMDLFFFGNLPVGAGLSSSASVEVVTAFAINDLTG 147

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQMPKY 167
                    +    A    V      +D  +   G                 +      Y
Sbjct: 148 AGLDRESLAVIAQQAENEFVGVNCGVMDQFSVAMGKKDMALSLNCLTLAYELVPVHSEGY 207

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------- 211
            +   +   P  L  S Y    A+    ++ ++  +PE+  + +                
Sbjct: 208 RLVIANSNVPRKLSGSKYNERRAECEAALAVVKRRFPEVQALAEVDPSGWPEIESLLRTE 267

Query: 212 --------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
                         +   +    +Q + + L +  ++   + MN     L     V+   
Sbjct: 268 GARGFDTEVIVRRARHVVMESHRAQEAARLLTDGKIEAFGELMNASHRSLRDDYEVTGEA 327

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH-AKGIDIVPIT 315
           L  +V         + S+++G+G G C ++L + D      + V      A G       
Sbjct: 328 LDALVEAAWSAEGCIGSRMTGAGFGGCTVSLVREDAVEAFTRHVKEVYERATGRRPSFYV 387

Query: 316 PSHSTSLY 323
                 ++
Sbjct: 388 TDIGDGVH 395


>gi|210618009|ref|ZP_03291844.1| hypothetical protein CLONEX_04077 [Clostridium nexile DSM 1787]
 gi|210149002|gb|EEA80011.1| hypothetical protein CLONEX_04077 [Clostridium nexile DSM 1787]
          Length = 389

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 57/361 (15%), Positives = 117/361 (32%), Gaps = 51/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           APG + L+GEH   +G      A+          R+D  + + S+  +  G ++ ++   
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTLGTYAIARKREDDRLRLYSANFESLGVIESSLNDL 83

Query: 69  -------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++        K + G D+ +   + +  GL SSA++ V     L  
Sbjct: 84  VPSEAAGWTNYPKGVMWTFEKRGYKLTNGLDILIYGNIPNGSGLSSSASLEVLTGVLLKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL----------ICYQMPKY- 167
           +    + +  EI            G + G +D  AS  G            + Y+     
Sbjct: 144 MFAFDDLTMVEIAQIGQYSENNFNGCNCGIMDQFASAMGKKDNAIFLDTNTLQYEYAPVV 203

Query: 168 ----SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
                I  ++      L+ S Y     +    +  ++                       
Sbjct: 204 LEDAKIVIVNSKVKHSLVDSAYNDRRNECETALRELQKVLGIQTLGDLTEEEFEAHKDAI 263

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             EI +   K      + +  + +AL+  +++   + MN     L     VS  ++  +V
Sbjct: 264 QSEIRQKRAKHAVYENRRTIKAVEALKADDIETFGKLMNASHVSLRDDYEVSCEEIDILV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                   ++ S+I+G G G C +++ K D      ++V      + G            
Sbjct: 324 DLAWSIEGVIGSRITGGGFGGCTVSIVKNDAVDHFIETVGAQYEERVGHKAEFYVVDIGD 383

Query: 321 S 321
            
Sbjct: 384 G 384


>gi|288936469|ref|YP_003440528.1| galactokinase [Klebsiella variicola At-22]
 gi|288891178|gb|ADC59496.1| galactokinase [Klebsiella variicola At-22]
          Length = 382

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIISHDTQQWSNYVRGVVKHLQQRNNHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCVVALVPEDLVDTVQQAVAKTYEAKTGIKETFYVCKPSQGAG 380


>gi|254369550|ref|ZP_04985561.1| galactokinase [Francisella tularensis subsp. holarctica FSC022]
 gi|157122504|gb|EDO66639.1| galactokinase [Francisella tularensis subsp. holarctica FSC022]
          Length = 382

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 63/350 (18%), Positives = 119/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + F INK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFVINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSSDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNYYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYASYLEKNYFEKFNIKPSF 370


>gi|258651991|ref|YP_003201147.1| galactokinase [Nakamurella multipartita DSM 44233]
 gi|258555216|gb|ACV78158.1| galactokinase [Nakamurella multipartita DSM 44233]
          Length = 385

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/365 (19%), Positives = 119/365 (32%), Gaps = 55/365 (15%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS-----------L 57
             SAPG + L+GEH   +G   L FAI+ R  L         I I S+            
Sbjct: 21  VFSAPGRVNLIGEHTDYNGGLVLPFAIDARAHLAAGRADSGAIRIMSAQKPGEFSQVHLD 80

Query: 58  GQYCGSLDLAMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
               GS  +A +       I ++     P    DL + SQ+ +  GL SSAA+  A   A
Sbjct: 81  DVRPGSPAVAGWPGYLLGAIWSLQQTGRPIESVDLVLDSQIPAGAGLSSSAAVECATVLA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG----IDLAASIHGGLICYQMPKYSIEKI 172
           +  L  +    P  I   A        G+  G       AA   G ++ +     S E I
Sbjct: 141 VSALSGY-SMDPLTIARIAQRAENDFVGVPCGPMDQTASAACAEGSVLLFDTRSGSTENI 199

Query: 173 DFIFPIHLI------------------------------YSGYKTPTAQVLKKISYIEIE 202
            F    H +                                G        +  +     +
Sbjct: 200 SFDPAAHDLTVLVVDTQVAHSLADGEYGKRRTSCELAAEILGVTQLREVTVDDLPAALSK 259

Query: 203 YPEINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSE 259
            P+ +E+ +++  +       + + + LR   +  +   +      L     VS ++L  
Sbjct: 260 LPD-DELRRRLRHVVTENDRVESTVELLRAGRITDIGPLLTASHASLRDDYDVSCAELDA 318

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGID---IVPITP 316
            V         + ++++G G G  VIAL   DL      +V       G     +  ++P
Sbjct: 319 AVDTA-LTAGALGARMTGGGFGGSVIALVPTDLTDHVGAAVVSAFAGHGFRPPVLRRVSP 377

Query: 317 SHSTS 321
           +    
Sbjct: 378 AQGAR 382


>gi|303254637|ref|ZP_07340739.1| galactokinase [Streptococcus pneumoniae BS455]
 gi|302598349|gb|EFL65393.1| galactokinase [Streptococcus pneumoniae BS455]
          Length = 392

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G       I+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPATISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     L     V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLERDYEVTGLELDALV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|271963914|ref|YP_003338110.1| galactokinase [Streptosporangium roseum DSM 43021]
 gi|270507089|gb|ACZ85367.1| galactokinase [Streptosporangium roseum DSM 43021]
          Length = 372

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/355 (18%), Positives = 110/355 (30%), Gaps = 43/355 (12%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL---- 66
            APG + L+GEH   +    L FA+   V   +  R+D ++ + S       +++     
Sbjct: 20  HAPGRVNLIGEHTDYNDGFVLPFAVPWGVTAAVAPREDDVVRLRSLQAGEPQTVETLGRA 79

Query: 67  AMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
             +      +  A+     P  G DL +   +    GL SSAA+ V +  AL  L Y   
Sbjct: 80  EGWARYAVGVFWALREAGHPVRGADLVIDGDVPQGAGLSSSAALEVVVGTALNDL-YGLG 138

Query: 126 PSPDEILTTAHAIVLKVQGISSG-IDLAASIHG--GLICYQ---------------MPKY 167
            +  EI   A        G+  G +D AAS  G  G   +                    
Sbjct: 139 LTKMEIALAAQRAENDFVGMPCGIMDQAASALGEEGKALFMDCRSLGTRTIPFDLAQHGL 198

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYI--------------EIEYPEINEINQKI 213
            +  I+      L    Y            ++                          + 
Sbjct: 199 QLLIINTGVHHELADGQYARRRQDCENAAKHLGVDALRDVTDLAGALGRLSGDERRRTQH 258

Query: 214 YALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVWKLREQPHIMA 272
                   +     LR   ++ +   +N     L     VS ++L   V           
Sbjct: 259 VVTENHRVEALIGLLRAGAVREIGALLNASHLSLRDQYEVSCAELDVAVESAVR-GGARG 317

Query: 273 SKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI---DIVPITPSHSTSLYR 324
           ++++G G G   IAL   D      +SV      +G    +I P TP+      R
Sbjct: 318 ARMTGGGFGGSAIALVADDRVEAVRESVTRAYGERGWAAPEIYPATPAAGARRLR 372


>gi|288931747|ref|YP_003435807.1| mevalonate kinase [Ferroglobus placidus DSM 10642]
 gi|288893995|gb|ADC65532.1| mevalonate kinase [Ferroglobus placidus DSM 10642]
          Length = 295

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 81/310 (26%), Positives = 139/310 (44%), Gaps = 22/310 (7%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +  SAPG +++ GEH V++   AL  AIN R  +    + D  I I S  G+        
Sbjct: 1   MISSAPGKVIIFGEHAVVYKRRALASAINLRCYVKAEKKDD--IEIISEYGKTGLDF--- 55

Query: 68  MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             HP  S  I+    +    G  ++V S++    GLGSSAA+TVA   AL  L +    +
Sbjct: 56  RVHPFISQSIVNFKEVTDFKGVRVEVRSKIPPASGLGSSAAVTVATLTALNEL-FSTSLT 114

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
            DEI   A  + L VQG  SG D   S  GG   +       +K++  F    +Y   K 
Sbjct: 115 KDEIFELARKVELDVQGKGSGTDPFISTFGGAWIF----PERKKVNPKFTRLFVYDTKKR 170

Query: 188 P-TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
             TA+++  ++     +P   E+ ++I+  +  ++           ++ L +     Q L
Sbjct: 171 SITAEMVAGVAERREIFP---EVFERIFDAIDAITLEGADLFEKGEVEKLEKLFFINQKL 227

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L  +GVS  ++  +V +L E+  +  +KI+G+G G C+I+L   +       +    ++ 
Sbjct: 228 LSAIGVSTPEIDSLVAEL-ERRGVF-AKITGAGGGGCLISLKPFEG------AFEVKINE 279

Query: 307 KGIDIVPITP 316
           +G  +     
Sbjct: 280 EGARVEDFED 289


>gi|304406102|ref|ZP_07387759.1| galactokinase [Paenibacillus curdlanolyticus YK9]
 gi|304344686|gb|EFM10523.1| galactokinase [Paenibacillus curdlanolyticus YK9]
          Length = 390

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/367 (18%), Positives = 125/367 (34%), Gaps = 52/367 (14%)

Query: 8   ICV-SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I V  APG + L+GEH   +G      A+     + L  R+D  + + S+  +  G L L
Sbjct: 22  IRVFHAPGRVNLIGEHTDYNGGYVFPAALTFGTTVLLRPRQDGKLALASTNFELRGELSL 81

Query: 67  A-----MFHPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                       ++    +  ++        GF+L    ++ +  GL SSA+I VA   A
Sbjct: 82  DAIAFKQEDDWMNYPKGIVRELQNRGVSLGDGFELLYHGEIPNGAGLSSSASIEVATAYA 141

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------I 160
           LL           EI   +     +  G+  GI    ++  G                 +
Sbjct: 142 LLKAVG-GPTDTVEIAKLSQKSENEFNGVQCGIMDQFAVANGRKDHAILLMCDTLEYDLV 200

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKL 220
            +Q   Y +   +      L+ S Y    +Q  + ++ +   +P +  + Q         
Sbjct: 201 PFQSGSYKLVIGNTNKRRGLVDSAYNERRSQCEQAVADLRAAFPSLQLLGQINLEQFNAN 260

Query: 221 SQ----------------------ISCQALRNKNLKVLAQAMNRQQGLLETLG-VSDSKL 257
           +                        S + L+  +L    + MN     L  L  V+ ++L
Sbjct: 261 AHLIKDETVCRRARHVIEEIDRVLRSIEVLKADDLVSFGKLMNGSHASLRDLYEVTGAEL 320

Query: 258 SEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITP 316
             +V   +    ++ S+++G+G G C ++L   D        V      A G+       
Sbjct: 321 DAMVAAAQGVEGVLGSRMTGAGFGGCTVSLVHEDAIERFKDEVGRQYTEATGLIADFYVC 380

Query: 317 SHSTSLY 323
           S    + 
Sbjct: 381 SIGNGVE 387


>gi|258545075|ref|ZP_05705309.1| mevalonate kinase [Cardiobacterium hominis ATCC 15826]
 gi|258519695|gb|EEV88554.1| mevalonate kinase [Cardiobacterium hominis ATCC 15826]
          Length = 301

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 156/288 (54%), Gaps = 9/288 (3%)

Query: 5   LHK-ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
           + K +  SAPGS+++ GEH V++G  A+V AI +R+ + ++ R DR I+I+S+L  +   
Sbjct: 1   MTKTLTASAPGSIMITGEHAVVYGAPAIVCAIEQRIRIRVSTRADREIHIESALAAHHTD 60

Query: 64  LDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
           L     HP   F+I A+    P+ G D+ + S +D  LGLGSSAA+T AITA L  L+  
Sbjct: 61  LATLADHPQLRFLIAALRQNPPASGLDIAIDSDIDPTLGLGSSAAVTAAITALLYRLRGQ 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI--HLI 181
             P    +   A+  +L VQ   SG DLAAS+ GG+I YQ   +++       P    L 
Sbjct: 121 -NPDLLALHRAAYRTILTVQQRGSGADLAASLAGGIIAYQNRPFTVITPLPAPPSGLSLR 179

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
           Y+GYKTPTA+VL +I+      P   E  + +Y  MG  S  S  A    +       +N
Sbjct: 180 YAGYKTPTAEVLARIAASATVDP---EYYRDLYDRMGASSARSIAAAERGDWADFYHELN 236

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGK 289
           + Q  +  LGV D   +E +   R Q H    KISGSGLGDC++AL  
Sbjct: 237 QYQEHMTALGVCDHTQAEHLAAARPQAHA--VKISGSGLGDCILALAD 282


>gi|206576061|ref|YP_002239627.1| galactokinase [Klebsiella pneumoniae 342]
 gi|206565119|gb|ACI06895.1| galactokinase [Klebsiella pneumoniae 342]
          Length = 383

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 82

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 83  APIISHDTQQWSNYVRGVVKHLQQRNNHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 143 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 201

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 202 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 261

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 262 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 322 ATIGDKGGVRMTGGGFGGCVVALVPEDLVDTVQQAVAKTYEAKTGIKETFYVCKPSQGAG 381


>gi|289167369|ref|YP_003445638.1| galactokinase, (galactose kinase) [Streptococcus mitis B6]
 gi|288906936|emb|CBJ21770.1| galactokinase, (galactose kinase) [Streptococcus mitis B6]
          Length = 392

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLVDL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRSIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGKLS 221
           +    +  ++      L  S Y    A+  K +  ++       + E+++  +     L 
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQAALDIQTLGELDEWAFDQYSYLI 266

Query: 222 QISCQ-------------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +   +                   AL+  +LK   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRSRHAVLENQRTLKAQVALQAGDLKTFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWVQEGVLGARMTGAGFGGCAIALVQKDAVDAFKEAVGKHYEE 371


>gi|168230656|ref|ZP_02655714.1| galactokinase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194471298|ref|ZP_03077282.1| galactokinase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194457662|gb|EDX46501.1| galactokinase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|205334762|gb|EDZ21526.1| galactokinase [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 382

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|322389797|ref|ZP_08063342.1| galactokinase [Streptococcus parasanguinis ATCC 903]
 gi|321143521|gb|EFX38954.1| galactokinase [Streptococcus parasanguinis ATCC 903]
          Length = 421

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R+D+++   S   +  G +++     
Sbjct: 57  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKREDKVLRFFSGNFEDKGIIEVPLENL 116

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SSA++ + I      
Sbjct: 117 HFEKEHNWTNYPKGVLHFLQEAGHVIDSGMDVYVYGNIPNGSGLSSSASLELLIGVIAEK 176

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 177 L-YDLQLDRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 235

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 236 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWAFDAYSYLI 295

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  +V
Sbjct: 296 KDENRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLV 355

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 356 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEAFKEAVGKRYEE 400


>gi|315223408|ref|ZP_07865265.1| galactokinase [Capnocytophaga ochracea F0287]
 gi|314946581|gb|EFS98572.1| galactokinase [Capnocytophaga ochracea F0287]
          Length = 385

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 66/345 (19%), Positives = 113/345 (32%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG-------QYCGSL 64
           APG + L+GEH   +G      AI+K     +  R DR   + S               L
Sbjct: 22  APGRVNLIGEHTDYNGGNVFPCAIDKGTYGLVKKRNDRKFRMYSENFADLGVMEFTLDEL 81

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I        K   GFD+     + +  GL SSA+I +     L  
Sbjct: 82  TNDKKHDWANYPKGVIKMFLEAGQKIDSGFDILFSGNIPNGAGLSSSASIEMLTAIVLKD 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYS-------- 168
           L +    S +          L +   S  +D  A   G     I                
Sbjct: 142 LFHLSIDSVEMAQLGKKTENLFIGVNSGIMDQFAIAMGKKDHAILLDCNTLKYAYVPVVL 201

Query: 169 ----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------EINEINQKIYA 215
               I   +      L  S Y    A+  + ++ ++ + P         E  E N+ +  
Sbjct: 202 KDEVIVIANTNKRRGLADSKYNERRAECDEALAELQTKLPIKALGELSIEQFEANKDLIK 261

Query: 216 LM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + + L   NL    + MN+    L     V+  +L  +  
Sbjct: 262 SPIRQKRAKHAVYENQRTLKAQKELSAGNLAEFGKLMNQSHISLRDDYEVTGVELDTLAA 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              EQP ++ S+++G+G G C +++ K D      ++V      K
Sbjct: 322 LAWEQPGVVGSRMTGAGFGGCTVSIVKKDKVDDFIKNVGEAYKNK 366


>gi|163790003|ref|ZP_02184438.1| galactokinase [Carnobacterium sp. AT7]
 gi|159874703|gb|EDP68772.1| galactokinase [Carnobacterium sp. AT7]
          Length = 392

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 59/346 (17%), Positives = 121/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           +PG + L+GEH   +G      AI        T R D LI + S      G +       
Sbjct: 24  SPGRINLIGEHTDYNGGNVFPCAITLGTYGLATKRDDTLIKLYSENFSELGVITIDLNNL 83

Query: 65  ---DLAMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +         G ++     + +  GL SSA+I + +T  ++ 
Sbjct: 84  EYDPADKWTNYPKGMIKFLKEAGYVIDHGLNILYYGTIPNGAGLSSSASIEL-LTGFIVQ 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
             +  E    +++ T   +  +  G++SGI    +I  G                +I   
Sbjct: 143 DLFELELDRLDLIKTGQRVENEFIGVNSGIMDQFAIGKGKKDTAILLDCNTLEYEMIPVV 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------YPEINEINQKIY 214
           +  +SI  ++      L  S Y    ++  + ++  + E           +  + ++ I 
Sbjct: 203 LKDHSIVIMNTKKRRELADSKYNERRSECDQALAEFQKELNISSLGAMDEKTFDEHKAIL 262

Query: 215 A------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +               + +  +  AL+   L    + MN     L     V+  +L  +V
Sbjct: 263 SNETILKRARHAVTENQRTLKAATALKAGKLAEFGKLMNESHISLRDDYEVTGLELDALV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ ++++G+G G C IA+ + +        V      K
Sbjct: 323 QAAWDQSGVLGARMTGAGFGGCAIAIVENNAIDDFIGQVGKQYQEK 368


>gi|312137118|ref|YP_004004455.1| mevalonate kinase [Methanothermus fervidus DSM 2088]
 gi|311224837|gb|ADP77693.1| mevalonate kinase [Methanothermus fervidus DSM 2088]
          Length = 316

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 78/310 (25%), Positives = 144/310 (46%), Gaps = 15/310 (4%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
           +H +  SAP  ++L GEH V++   A+  AINKR  + +   K     I  +      ++
Sbjct: 1   MHSV-ASAPNKIILFGEHAVVYKKPAIAVAINKRAKVSIKNTKKDSTIIKCNDIGLHANI 59

Query: 65  DLAMFHPSF--------SFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
           +   ++  F        ++I+  +     +    + +  ++   +GLGSSAAITVA+ AA
Sbjct: 60  NPKTYNIEFLEGKKGILNYILEVLKSHHDNSPIKIDISLEVPLGIGLGSSAAITVALIAA 119

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
           L    + K      +   AH I LKVQG +S +D A S +GG+I  +       K +   
Sbjct: 120 LHNY-HEKVIDKSSLSKKAHEIELKVQGAASPLDTAVSTYGGMIYLKDSNIEYIKPNIEG 178

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
              + Y+     T +++  +     +YP    I   I   +G +++ + + ++    + +
Sbjct: 179 SFIVAYTPKPADTKKMVSLVKKKLEKYPN---IVGNIIDTIGNVTKTAYELIKEGKFEKI 235

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
            + MN   GLL+++GVS S+LS++V+  R     + SKI+G+G    +IA    +     
Sbjct: 236 GELMNINHGLLDSIGVSSSELSQMVYSAR-NAGALGSKITGAGGSGSIIAYCINN-EDKV 293

Query: 297 YQSVNCHMHA 306
             ++     A
Sbjct: 294 LNTLKSQWDA 303


>gi|224582587|ref|YP_002636385.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|254790366|sp|C0PWW2|GAL1_SALPC RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|224467114|gb|ACN44944.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 382

 Score =  169 bits (428), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRNDRTVRVIAADYDNQVEEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|197250518|ref|YP_002145730.1| galactokinase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|229889781|sp|B5F052|GAL1_SALA4 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|197214221|gb|ACH51618.1| galactokinase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 382

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|156054466|ref|XP_001593159.1| hypothetical protein SS1G_06081 [Sclerotinia sclerotiorum 1980]
 gi|154703861|gb|EDO03600.1| hypothetical protein SS1G_06081 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 473

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 76/387 (19%), Positives = 141/387 (36%), Gaps = 74/387 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQ 59
              +    VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I++      
Sbjct: 24  SPMMPPFMVSAPGKVIVFGEHAVVHGKPAIAAAISLRSYLLVTALSKSKRTISLRFPDIN 83

Query: 60  YCGSLDLAMF------HPS----------------FSFIIMAINHIKPS----------- 86
              + ++         HPS                 + +   + +I P            
Sbjct: 84  LSHTWNIDDLPWSTFSHPSKKKYYYDQVTSLDPELVAAMKPHLENISPDESPSIRKIHQS 143

Query: 87  -----------------CGFDLKVISQLDSQLGLGSSAAITVAITAA------------L 117
                             G    + S +    GLGSSA+I+V +++A             
Sbjct: 144 SASSFLYIFLSLGSQSFPGCLYTLRSTIPIGAGLGSSASISVCLSSALLLQIRTLSGPHP 203

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEKI--D 173
                      + I   A    + + G  SG+D   S  G  + YQ      +++ +   
Sbjct: 204 DQPSNEASLQLERINRWAFVGEMCIHGNPSGVDNTVSTQGKAVIYQKFPEGPTVKPLRDF 263

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISC-----QAL 228
              P+ L+ +     TA  + K+  ++ ++P I +       ++G+ +          + 
Sbjct: 264 PELPLLLVDTQQAKSTAHEVAKVGLLKEKHPAIVDSILDAIDMVGQSAAAMISDPNYDSE 323

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
             + ++ L + M    GLL +LGVS  +L   + +L +   I  +K++G+G G C I L 
Sbjct: 324 NIECVESLGKLMTINHGLLVSLGVSHPRLER-IRELVDHEGIGWTKLTGAGGGGCSITLL 382

Query: 289 KGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           K D        +   +  +G      T
Sbjct: 383 KPDTTPERMARLEATLENEGYKKFETT 409


>gi|296876268|ref|ZP_06900321.1| galactokinase [Streptococcus parasanguinis ATCC 15912]
 gi|296432773|gb|EFH18567.1| galactokinase [Streptococcus parasanguinis ATCC 15912]
          Length = 392

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R+D+++   S   +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKREDKVLRFFSGNFEDKGIIEVPLENL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SSA++ + I      
Sbjct: 88  HFEKEHNWTNYPKGVLHFLQEAGHVIDSGMDVYVYGNIPNGSGLSSSASLELLIGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y       +++           G++SGI    +I  G                 +   
Sbjct: 148 L-YDLHLDRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWAFDAYSYLI 266

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRIKRARHAVLENQRTFQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEAFKEAVGKRYEE 371


>gi|116492692|ref|YP_804427.1| mevalonate kinase [Pediococcus pentosaceus ATCC 25745]
 gi|116102842|gb|ABJ67985.1| mevalonate kinase [Pediococcus pentosaceus ATCC 25745]
          Length = 306

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 63/313 (20%), Positives = 127/313 (40%), Gaps = 10/313 (3%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGS 63
           + +I  S+   ++L+GEH V++G  A+   I N +  + +       I I S        
Sbjct: 1   MEEIIKSSNSKIILIGEHSVVYGQPAIALPIRNVKTTVKIQPTNGD-IQIKSRYFNGSLK 59

Query: 64  LDLAMFHPSFSFIIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
              +      + I   +N + +P+    + + S + ++ G+GSSA+  VA+  AL    +
Sbjct: 60  DIHSNLLGIKNLIKQTLNELNRPNTNLLITIDSDVPAERGMGSSASTAVALVRALYAY-F 118

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFPIHLI 181
               +   +L T       + G  SG+D A +     I ++         I+    + + 
Sbjct: 119 EHPLTRTTLLKTVDISEKIIHGKPSGLDSATASANNPIWFKKDGTIKPLPINVDAYLIIS 178

Query: 182 YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMN 241
            SG K  T++ ++    I       +  ++ +   +G+L+  +   LR  ++  L + + 
Sbjct: 179 DSGIKGKTSEAVE----IVKNKLRFDSDSRLLIEKLGELTSQTATVLRQNDVSTLGKILT 234

Query: 242 RQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN 301
                L  LGVS   + +++    +    + SK++G GLG CVI+L      +       
Sbjct: 235 EAHTNLRQLGVSHPAVEKLIKIANDS-GALGSKLTGGGLGGCVISLAPNLPAAEKISQQL 293

Query: 302 CHMHAKGIDIVPI 314
               A    I  +
Sbjct: 294 TAGGATATWIEKL 306


>gi|306824679|ref|ZP_07458023.1| galactokinase [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304432890|gb|EFM35862.1| galactokinase [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 392

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVFGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLDRLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +++      + ++++ ++       
Sbjct: 207 LKDNVIVIMNTNKRRELADSKYNERRAECEKAVEELQVALEIQTLGDLDEWVFDQYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      + V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVDAFKEVVGKHYEE 371


>gi|290510474|ref|ZP_06549844.1| galactokinase [Klebsiella sp. 1_1_55]
 gi|289777190|gb|EFD85188.1| galactokinase [Klebsiella sp. 1_1_55]
          Length = 383

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 82

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 83  APIISHDTQQWSNYVRGVVKHLQQRNNHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 143 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 201

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 202 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 261

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 262 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 322 AAIGDKGGVRMTGGGFGGCVVALVPEDLVDTVQQAVAKTYEAKTGIKETFYVCKPSQGAG 381


>gi|187931506|ref|YP_001891490.1| galactokinase [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187712415|gb|ACD30712.1| galactokinase [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 382

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 63/350 (18%), Positives = 120/350 (34%), Gaps = 48/350 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S D+     
Sbjct: 26  SPGRVNLIGEHTDYNNGFVMPFAINKGTFIAIAKRDDNIVNVYSENLDDSSSFDITKIKQ 85

Query: 67  ---AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  IN        G D+ + S L    GL SS+++  A+  A   + 
Sbjct: 86  EISNTWQNYIKGVINIINQDFSSDIKGADIYIFSDLPFGAGLSSSSSLNTALAYAYNDI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  ++   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YQLNISKIDVAKIAQKVEHEYIGTKCGLMDQMACLFSQQNAATMIDCNDNHYDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVL----------------KKISYIEIEYPEINEI 209
             S+   D     +L  S Y                        +K+   ++ + E +  
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCENIARFHSIKSLRELDSQKLEDTKLNFSEEDHK 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                    +    + +A+  K+ + L + M +    L+    VS  +L  +V   +   
Sbjct: 265 LALHVFTENQRVIEATKAMVAKDWQKLGKLMYQSHNSLKNDYKVSCDELDYLVELSQNFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
            I  ++++G G G   I L          +    ++     +   I PS 
Sbjct: 325 GIYGARMTGGGFGGSTIHLLPT----KLLKEYASYLEKNYFEKFNIKPSF 370


>gi|161504075|ref|YP_001571187.1| galactokinase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189045137|sp|A9MJI2|GAL1_SALAR RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|160865422|gb|ABX22045.1| hypothetical protein SARI_02168 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 382

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/360 (16%), Positives = 124/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEI---------EYPEINEINQKIYALMGK----- 219
               + ++          V  + +             + P + +++ + +  +       
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVACELDPV 260

Query: 220 -------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                         +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCIVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|317127765|ref|YP_004094047.1| galactokinase [Bacillus cellulosilyticus DSM 2522]
 gi|315472713|gb|ADU29316.1| galactokinase [Bacillus cellulosilyticus DSM 2522]
          Length = 390

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 63/365 (17%), Positives = 114/365 (31%), Gaps = 54/365 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      A++      +  R D L+ + S      G        L
Sbjct: 25  APGRVNLIGEHTDYNGGLVFPCALSVGTYAVVKERDDDLVRLYSENFPEVGVVTFKLSQL 84

Query: 65  DLAMFHPSFSFIIMAI-----NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +    H   ++    +     +  K S GFD  V   + +  GL SSA+I +        
Sbjct: 85  EKNKEHEWANYCKGVLATMEKHGYKGSNGFDAVVYGNIPNGAGLSSSASIELVTAVLWDA 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----ICYQMPKYSIEKIDFI 175
           LQ        +++  A        G++ GI    +I  G     I         E     
Sbjct: 145 LQ-QFNVDRVKLVQYAQEAENDYIGVNCGIMDQFAISMGKEEHAILLDCNTLDYEYAPAK 203

Query: 176 FPIHLI------------YSGYKTPTAQVLKKISYIEIEY-----------PEINEINQK 212
                +             S Y    AQ  + ++ +               P   E  Q 
Sbjct: 204 LNGVKLVIANTMKQRGLADSKYNERRAQCERAVAELNQSEEVSIDHLCSLTPAQFEAVQH 263

Query: 213 IYALM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSE 259
             A                 ++++ + L   N+    Q MN     L     V+   L  
Sbjct: 264 HIADPVVLKRARHAVYENARTKLAVEKLNEGNVSGFGQLMNESHVSLRDDYEVTGKHLDA 323

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSH 318
           +V    E+  ++ S+++G+G G C ++L K +      + +         +       + 
Sbjct: 324 LVEAAWEEDGVLGSRMTGAGFGGCTVSLIKEENLEEIVKRIEERYKQKTNVTPEFYIVNI 383

Query: 319 STSLY 323
            +   
Sbjct: 384 GSGAA 388


>gi|168263734|ref|ZP_02685707.1| galactokinase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|197264050|ref|ZP_03164124.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197242305|gb|EDY24925.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205347717|gb|EDZ34348.1| galactokinase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 382

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQADEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDRGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|312867457|ref|ZP_07727666.1| galactokinase [Streptococcus parasanguinis F0405]
 gi|311097158|gb|EFQ55393.1| galactokinase [Streptococcus parasanguinis F0405]
          Length = 388

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 60/345 (17%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI          R+D+++   S   +  G +++ + + 
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKREDKVLRFFSGNFEDKGIIEVPLENL 83

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ + I      
Sbjct: 84  HFEKEHNWTNYPKGVLQFLQEAGHVIDSGMDVYVYGNIPNGSGLSSSASLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y       +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDLHLDRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELNLWAFDAYSYLI 262

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             E      +   L  + +  + +AL   NL+   + MN     LE    V+  +L  +V
Sbjct: 263 QDENRIKRARHAVLENQRTLQARKALEAGNLEGFGRLMNASHVSLEHDYEVTGLELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEAFEEAVGKRYEE 367


>gi|168240631|ref|ZP_02665563.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168820093|ref|ZP_02832093.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194451386|ref|YP_002044802.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|229889785|sp|B4TC28|GAL1_SALHS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|194409690|gb|ACF69909.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|205340074|gb|EDZ26838.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205343206|gb|EDZ29970.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320085041|emb|CBY94828.1| Galactokinase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 382

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|8928118|sp|Q9ZB10|GAL1_STRTR RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|4097440|gb|AAD00093.1| galactokinase [Streptococcus thermophilus]
          Length = 388

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 57/344 (16%), Positives = 120/344 (34%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I   +  
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIVEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   K    D +          +   S  +D  A   G                L+   +
Sbjct: 144 LYDIKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQCAIYLDTNTLKYDLVPLDL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEIN------------ 210
               +  ++      L  S Y    A+    +S ++ +     + E++            
Sbjct: 204 KDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDFLTFDAYSYLIK 263

Query: 211 -------QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                   +   L  + +  + +AL   +L+   + MN     LE    V+  +L  +  
Sbjct: 264 DENRIKRARHVVLENQRTLQARKALETGDLEGFGRLMNASHVSLEYDYEVTGLELDTLAH 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 324 TAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|312110506|ref|YP_003988822.1| galactokinase [Geobacillus sp. Y4.1MC1]
 gi|311215607|gb|ADP74211.1| galactokinase [Geobacillus sp. Y4.1MC1]
          Length = 394

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 56/359 (15%), Positives = 112/359 (31%), Gaps = 50/359 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G   L  A+       +    +  I   S      G +       
Sbjct: 25  APGRVNLIGEHTDYNGGHVLPCALEIGTYALVRKTANPFIRFYSKNFPETGIITVSYDDL 84

Query: 65  ---DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
              +   +      II A     P   G D+     + +  GL SSA+I +     L  L
Sbjct: 85  SYQEQHGWANYPKGIIAAFQLFCPIETGLDILYYGTIPNGAGLSSSASIELVTAVMLNEL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQM 164
            + +     E++  +  +  +  G++ GI    ++  G                 +   M
Sbjct: 145 -FAQHIDMLELVKMSQKVENEYVGVNCGIMDQFAVGMGKRNHVMLLNCQTLEYRYLPVSM 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------YPEINEINQKIYA 215
              SI   +      L  S Y    A     ++ ++             E  E  +   +
Sbjct: 204 SNCSIVIANTNKKRGLADSAYNERRATCEAALAKLQKHINIASLGDLTSEQLEEYKHFLS 263

Query: 216 -----------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                         + +  +  AL   +L    + M +    L     V+ ++L  +V  
Sbjct: 264 PLEQQRARHAVTENERTIEAAAALEKGDLARFGELMKQSHISLRDDYEVTGTELDTLVEA 323

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             +    + ++++G+G G C + + K        + V   ++   G +           
Sbjct: 324 AWKHEGTIGARMTGAGFGGCTVNIVKDAYIPDFIERVGKEYVEKIGYEASFYVVKIGDG 382


>gi|16764138|ref|NP_459753.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167994420|ref|ZP_02575511.1| galactokinase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|194446739|ref|YP_002040010.1| galactokinase [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|20141348|sp|P22713|GAL1_SALTY RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889786|sp|B4SZH7|GAL1_SALNS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|16419279|gb|AAL19712.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194405402|gb|ACF65624.1| galactokinase [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|205327714|gb|EDZ14478.1| galactokinase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261246032|emb|CBG23834.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992512|gb|ACY87397.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157360|emb|CBW16849.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312911796|dbj|BAJ35770.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321226348|gb|EFX51399.1| Galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323129081|gb|ADX16511.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332987705|gb|AEF06688.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 382

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDRGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|213964178|ref|ZP_03392415.1| galactokinase [Capnocytophaga sputigena Capno]
 gi|213953174|gb|EEB64519.1| galactokinase [Capnocytophaga sputigena Capno]
          Length = 385

 Score =  169 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 65/345 (18%), Positives = 112/345 (32%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG-------QYCGSL 64
           APG + L+GEH   +G      AI+K     +  R DR   + S               L
Sbjct: 22  APGRVNLIGEHTDYNGGNVFPCAIDKGTYGLVKKRNDRRFRMYSENFADLGVMEFTLDEL 81

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I        K   GFD+     + +  GL SSA+I +     L  
Sbjct: 82  TNDKKHDWANYPKGVIKMFLEAGQKIDSGFDILFSGNIPNGAGLSSSASIEMLTAIVLKD 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYS-------- 168
           L +      +          L +   S  +D  A   G     I                
Sbjct: 142 LFHLSIDPVEMAQLGKKTENLFIGVNSGIMDQFAVAMGKKDHAILLDCNTLKYDYVPVVL 201

Query: 169 ----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------EINEINQKIYA 215
               I   +      L  S Y    A+  + ++ ++ + P         E  E N+ +  
Sbjct: 202 KDEVIVIANTNKRRGLADSKYNERRAECDEALAELQTKLPIKALGELSIEQFEANKDLIK 261

Query: 216 LM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + + L   NL    + MN+    L     V+  +L  +  
Sbjct: 262 SPIRQKRAKHAVYENQRTLKAQKELSAGNLAEFGKLMNQSHISLRDDYEVTGVELDTLAA 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              EQP ++ S+++G+G G C +++ K D      ++V      K
Sbjct: 322 LAWEQPGVVGSRMTGAGFGGCTVSIVKKDKVDDFIKNVGEAYKNK 366


>gi|16759699|ref|NP_455316.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29142528|ref|NP_805870.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|198245835|ref|YP_002214739.1| galactokinase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|200391087|ref|ZP_03217698.1| galactokinase [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204930110|ref|ZP_03221131.1| galactokinase [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|207856212|ref|YP_002242863.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213023145|ref|ZP_03337592.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
 gi|213427697|ref|ZP_03360447.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213613330|ref|ZP_03371156.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|238913334|ref|ZP_04657171.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289827234|ref|ZP_06545947.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|24211718|sp|Q8Z8B0|GAL1_SALTI RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889782|sp|B5FP41|GAL1_SALDC RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889783|sp|B5QX45|GAL1_SALEP RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|25287396|pir||AD0594 galactokinase [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16501992|emb|CAD05222.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138159|gb|AAO69730.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|197940351|gb|ACH77684.1| galactokinase [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199603532|gb|EDZ02078.1| galactokinase [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204321104|gb|EDZ06305.1| galactokinase [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|206708015|emb|CAR32305.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326622494|gb|EGE28839.1| galactokinase [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 382

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|161614993|ref|YP_001588958.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|189045138|sp|A9MTL0|GAL1_SALPB RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|161364357|gb|ABX68125.1| hypothetical protein SPAB_02747 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 382

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMF----HPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTYDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|152969328|ref|YP_001334437.1| galactokinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|150954177|gb|ABR76207.1| galactokinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 383

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 82

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 83  APIISHDTQQWSNYVRGVVKHLQQRNSHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 143 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 201

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 202 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 261

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 262 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 322 AAIGDKGGVRMTGGGFGGCVVALIPEDLVDTVQQAVANEYEAKTGIKETFYVCKPSQGAG 381


>gi|331086275|ref|ZP_08335355.1| galactokinase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406041|gb|EGG85564.1| galactokinase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 389

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 57/360 (15%), Positives = 112/360 (31%), Gaps = 50/360 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           APG + L+GEH   +G      A+          R+D  +   S   +  G ++      
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTLGTYGIARKREDNKLRFYSVNFERLGVIESSLEDL 83

Query: 67  -----AMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A      K   G D+ +   + +  GL SSA++ V     L  
Sbjct: 84  KPYKAAEWTNYPKGVMWAFEERGYKLPNGLDILLYGNIPNGSGLSSSASLEVLTGVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------ICYQMPKY-- 167
           +        D  L    +           +D  AS  G            + Y+      
Sbjct: 144 MFGFDVSMTDIALIGQFSENNFNGCNCGIMDQFASAMGKKDNAIFLDTNTLQYEYAPVVL 203

Query: 168 ---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------Y 203
               I  I+      L+ S Y     +    +  ++                        
Sbjct: 204 EDAKIVIINSKVKHSLVDSAYNDRRNECETALKELQEVVAVQTLGDLTEEAFEKHKDAIK 263

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            EI +   +      + +  + +AL+   ++   + MN     L     VS  ++  +V 
Sbjct: 264 SEIRQKRARHAVYENQRTIRAVEALKENRIEEFGKLMNESHRSLRDDYEVSCKEIDILVD 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
              E   ++ S+I+G G G C +++ K D      +++   ++   G +           
Sbjct: 324 LAWETEGVIGSRITGGGFGGCTVSIVKNDAVDGFIKNIGEQYLAKVGHEAEFYVVDIGDG 383


>gi|52001506|gb|AAU21558.1| GalK [Streptococcus thermophilus]
          Length = 388

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I   +  
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIVEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDIKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGTDQCAIYLDTNTLKYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEIN----------- 210
           +    +  ++      L  S Y    A+    +S ++ +     + E++           
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 211 --------QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHVVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEYDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|322613877|gb|EFY10815.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620376|gb|EFY17243.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622802|gb|EFY19647.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628714|gb|EFY25501.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631652|gb|EFY28408.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637177|gb|EFY33880.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641622|gb|EFY38258.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322648003|gb|EFY44473.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648515|gb|EFY44967.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654252|gb|EFY50575.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658167|gb|EFY54434.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663641|gb|EFY59843.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322670377|gb|EFY66517.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671613|gb|EFY67735.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322676969|gb|EFY73036.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682894|gb|EFY78913.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686573|gb|EFY82555.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323194530|gb|EFZ79723.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323199139|gb|EFZ84235.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202095|gb|EFZ87154.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208880|gb|EFZ93817.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211640|gb|EFZ96476.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215283|gb|EGA00029.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323219252|gb|EGA03746.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226664|gb|EGA10862.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229961|gb|EGA14084.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323233186|gb|EGA17282.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240921|gb|EGA24963.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243238|gb|EGA27258.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323246137|gb|EGA30123.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251564|gb|EGA35433.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323255593|gb|EGA39350.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260728|gb|EGA44333.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267836|gb|EGA51315.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269481|gb|EGA52935.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 382

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDRGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|332361891|gb|EGJ39694.1| galactokinase [Streptococcus sanguinis SK355]
          Length = 392

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++ + + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVPLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +       +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLNLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWFFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDTVDTFKENVGRKYQE 371


>gi|171778821|ref|ZP_02919883.1| hypothetical protein STRINF_00742 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282467|gb|EDT47891.1| hypothetical protein STRINF_00742 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 390

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI          R D+ +   S+     G +D+ +   
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRADKTLRFYSANFDELGIIDVDLDNL 83

Query: 69  -------FHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +     K   GF+L V   + +  GL SSA++ + +      
Sbjct: 84  VYDKKDSWTNYPKGVIKFLKEAGHKIESGFELYVNGNIPNGSGLSSSASLELLVGIVAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L ++ +    +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FNLKLDRLDLVKIGKQTENEFIGVNSGIMDQFAIGMGAEKQAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +        + E++ + +       
Sbjct: 203 LDDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNQVLDINTLGELDLQTFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  + 
Sbjct: 263 KDDNRLKRARHAVWENQRTLQAKEALTAGQLEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 323 HTAWQQEGVLGARMTGAGFGGCGIAIVAKDKVDDFTKAVEQVYTE 367


>gi|116492014|ref|YP_803749.1| galactokinase [Pediococcus pentosaceus ATCC 25745]
 gi|116102164|gb|ABJ67307.1| galactokinase [Pediococcus pentosaceus ATCC 25745]
          Length = 387

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 62/358 (17%), Positives = 127/358 (35%), Gaps = 53/358 (14%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-- 62
             ++  S PG + L+GEH   +G      AI          R D  + + S+     G  
Sbjct: 18  PERVFFS-PGRINLIGEHTDYNGGHVFPCAITIGTYGVYAPRTDNTVRMYSANIPDAGVV 76

Query: 63  -----SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
                +LD        ++    +N +     K   GFDL V   +    GL SSA+I + 
Sbjct: 77  SFDVNALDYDKAADWTNYPKGMMNELVKTGVKFDHGFDLYVHGNMPDGAGLSSSASIEL- 135

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG-------------- 158
           +T A+L   +    S  +++           G++SGI    ++  G              
Sbjct: 136 LTGAVLNAAFDLGVSQLDLVKIGQKCENNYVGVNSGIMDQFAVGMGKKDQAILLDTNTLD 195

Query: 159 --LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE----------YPEI 206
                 ++  + I  ++      L  S Y    ++  + +  ++ +            E 
Sbjct: 196 YSYAPVKLGNHVIVIMNTNKRRELADSKYNERRSECEEALRRLQTKLDIKTLGDLTNDEF 255

Query: 207 NE---------INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSD 254
           +E         + ++        + +  + +AL + +L    + +      L     V+ 
Sbjct: 256 DEAAYLINDETLIKRARHAVFENQRTIKATKALADDDLTTFGELVTASHVSLHFDYEVTG 315

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
            +L  +     +QP ++ ++++G+G G C IA+ + D      ++V        G D 
Sbjct: 316 KELDTLAETAWKQPGVLGARMTGAGFGGCGIAIVEKDQVEAFKENVGKVYRDTIGYDA 373


>gi|319947247|ref|ZP_08021480.1| galactokinase [Streptococcus australis ATCC 700641]
 gi|319746489|gb|EFV98749.1| galactokinase [Streptococcus australis ATCC 700641]
          Length = 405

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 56/344 (16%), Positives = 115/344 (33%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R+D+++   S   +  G +++     
Sbjct: 41  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKREDKVLRFFSGNFEDKGIIEVPLENL 100

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SSA++ +        
Sbjct: 101 QFEEEHNWTNYPKGVLHFLQEAGHTIDVGMDVYVYGNIPNGSGLSSSASLEMLTGVIAER 160

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           +        D +          +   S  +D  A   G                L+   +
Sbjct: 161 IYGLTVDRVDLVKIGKQTENHFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDL 220

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------E 205
               +  ++      LI S Y    A+    +S ++ +                     +
Sbjct: 221 KDNVVVIMNTNKRRELIDSKYNERRAECETAVSELQAKLDIQTLGELDVWDFDTYSYLIK 280

Query: 206 INEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                ++        + +  + +AL   NL+   + MN     LE    V+  +L  +V 
Sbjct: 281 DENRIKRARHAVLENQRTLQARKALEEGNLEAFGRFMNASHVSLEHDYEVTGLELDTLVH 340

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 341 TAWEQEGVLGARMTGAGFGGCAIALVNKDKVQDFEEAVGKRYEE 384


>gi|296807128|ref|XP_002844180.1| mevalonate kinase [Arthroderma otae CBS 113480]
 gi|238843663|gb|EEQ33325.1| mevalonate kinase [Arthroderma otae CBS 113480]
          Length = 518

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 76/383 (19%), Positives = 133/383 (34%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 73  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 132

Query: 66  LAMF-------------------------------------------------HPSFSFI 76
           +                                                    H +  F+
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSMDEPEEVRKIHHHSANQFL 192

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 252

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI------FP 177
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 253 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVIPILDFPEMR 312

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + LI S     TA  + K+  ++  +P I E     I Q        +         +  
Sbjct: 313 LLLINSRQPRSTAVEVAKVGALKKAHPAITESVLDSIGQLTENAHRIIMSDDFDENCHDT 372

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    Q      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L KG+ 
Sbjct: 373 IDHFGQLFRINHGLLVSLGVSHPRLER-IRELVDHADIGWTKLTGAGGGGCTITLLKGNR 431

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           N    + +   +  +G +    +
Sbjct: 432 NEAAIEHMEEQLDDEGFERYETS 454


>gi|257055467|ref|YP_003133299.1| galactokinase [Saccharomonospora viridis DSM 43017]
 gi|256585339|gb|ACU96472.1| galactokinase [Saccharomonospora viridis DSM 43017]
          Length = 389

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 59/361 (16%), Positives = 107/361 (29%), Gaps = 50/361 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG---QYCGSLDLA- 67
           APG + ++GEH   +    L  A+ + V   +    D  + + S           LD   
Sbjct: 31  APGRVNIIGEHTDYNDGFVLPMALPQGVRAAVGRTTDSRVRVVSRQEPGAPVTVGLDAKP 90

Query: 68  ----MFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                +      ++ ++        G D+ V   + +  GL SSAA+  A+  AL  L +
Sbjct: 91  GAVTDWSAYVIGVVWSLREAGYDVGGVDIAVDGDVPAGAGLSSSAALECAVAGALNDL-F 149

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSG----IDLAASIHGGLICYQMPKYSIEKIDFIF-- 176
                P E+   A     +  G+  G    +   +   G L+       + E++ F    
Sbjct: 150 ELRIEPTELARLAQRAENEFVGMPCGVMDQMASVSCTAGHLLFLDTRSMATEQVPFAPAD 209

Query: 177 ------------PIHLIYSGYKTPTAQVLKK-----------------ISYIEIEYPEIN 207
                       P  L+   Y        +                     +     E+ 
Sbjct: 210 RDRTLLVIDTRAPHKLVDGEYARRRRTCEEAASVLGVAALRDVSVDELPVALSRMDDEVQ 269

Query: 208 EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
               +             + LR+ +L  +   +      L     V+  +L   V     
Sbjct: 270 RRRVRHVVTENARVLEVVRRLRDGDLDGIGPLLTASHVSLRDDYEVTVGELDTAVDTALA 329

Query: 267 QPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGID---IVPITPSHSTSLY 323
               + ++++G G G CVIAL   D       +V       G          P+      
Sbjct: 330 T-GALGARMTGGGFGGCVIALVPTDRADAVVDAVRGAFERAGYREPAAFTAVPAQGAHRV 388

Query: 324 R 324
           R
Sbjct: 389 R 389


>gi|55821389|ref|YP_139831.1| galactokinase [Streptococcus thermophilus LMG 18311]
 gi|55823313|ref|YP_141754.1| galactokinase [Streptococcus thermophilus CNRZ1066]
 gi|81676532|sp|Q5LYY7|GAL1_STRT1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|18265746|gb|AAL67296.1|AF389475_2 galactokinase [Streptococcus thermophilus]
 gi|20799638|gb|AAM28582.1|AF503446_5 galactokinase [Streptococcus thermophilus LMG 18311]
 gi|52001500|gb|AAU21553.1| GalK [Streptococcus thermophilus]
 gi|55737374|gb|AAV61016.1| galactokinase [Streptococcus thermophilus LMG 18311]
 gi|55739298|gb|AAV62939.1| galactokinase [Streptococcus thermophilus CNRZ1066]
 gi|312278720|gb|ADQ63377.1| Galactokinase, putative [Streptococcus thermophilus ND03]
          Length = 388

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 57/344 (16%), Positives = 120/344 (34%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I   +  
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIVEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   K    D +          +   S  +D  A   G                L+   +
Sbjct: 144 LYDIKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQCAIYLDTNTLKYDLVPLDL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEIN------------ 210
               +  ++      L  S Y    A+    +S ++ +     + E++            
Sbjct: 204 KDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDFLTFDAYSYLIK 263

Query: 211 -------QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                   +   L  + +  + +AL   +L+   + MN     LE    V+  +L  +  
Sbjct: 264 DENRIKRARHVVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEYDYEVTGLELDTLAH 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 324 TAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|163849235|ref|YP_001637279.1| galactokinase [Chloroflexus aurantiacus J-10-fl]
 gi|222527216|ref|YP_002571687.1| galactokinase [Chloroflexus sp. Y-400-fl]
 gi|229874581|sp|A9WB97|GAL1_CHLAA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|254790360|sp|B9LFE4|GAL1_CHLSY RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|163670524|gb|ABY36890.1| galactokinase [Chloroflexus aurantiacus J-10-fl]
 gi|222451095|gb|ACM55361.1| galactokinase [Chloroflexus sp. Y-400-fl]
          Length = 390

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 59/368 (16%), Positives = 114/368 (30%), Gaps = 49/368 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G    +I   APG + L+GEH   +       A+++   +    R D+++ + S   +  
Sbjct: 16  GHPPTRI-ARAPGRVNLIGEHTDYNDGFVFPMALDRATYVAARPRNDQIVRVFSIKFRDE 74

Query: 62  GSLDL-----AMFHPSFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
              DL            ++I       +    P  G DL + S + +  GL SSAA+ VA
Sbjct: 75  DQFDLQQIVRDERRQWVNYIRGVAKGLLARDLPLRGADLMIDSDVPAGSGLSSSAALEVA 134

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS 168
           +      L  +     +E+   A        G+  GI           G  +       S
Sbjct: 135 V-GYTFQLLNNINLLGEELALVAQGAEHTFVGVKCGIMDQLIAALGEAGHALLIDCRDLS 193

Query: 169 IEKIDFIFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ------ 211
              +       ++              Y    A   + +  ++    +I  +        
Sbjct: 194 YRPVPIPAEARVVVCDSGVRHRLAGSEYNQRRAGCEEAVRLLKPALGKIQALRDVRSSDL 253

Query: 212 ---------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDS 255
                          +      + +  + +AL   +L  + Q M      L     VS  
Sbjct: 254 AMYGHLLPPDLLPLARHVVSENERTLAAAEALAAGDLVKMGQLMVASHVSLRDDYRVSVR 313

Query: 256 KLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH-AKGIDIVPI 314
           +L  +V      P    S+++G G G   ++L   D       ++        G  + P+
Sbjct: 314 ELDTLVDLALAAPGCFGSRMTGGGFGGSTVSLVAADHVDAFVAAMVDGYAIRTGRKLQPL 373

Query: 315 TPSHSTSL 322
             +    +
Sbjct: 374 VCTAGAGV 381


>gi|167550555|ref|ZP_02344312.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205324532|gb|EDZ12371.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 382

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 TTIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|256420511|ref|YP_003121164.1| galactokinase [Chitinophaga pinensis DSM 2588]
 gi|256035419|gb|ACU58963.1| galactokinase [Chitinophaga pinensis DSM 2588]
          Length = 388

 Score =  168 bits (426), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 66/345 (19%), Positives = 118/345 (34%), Gaps = 45/345 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL--GQYCGSLD 65
           I V A G + L+GEH   +    L  AI+K + L +  R D  I + +     +Y G+LD
Sbjct: 19  IMVRAAGRINLIGEHTDYNNGFVLPAAIDKAIYLAIVKRNDNKIVLHALDVNDRYEGTLD 78

Query: 66  LAMFHP--SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
             +  P     +++  +  ++       GF+      +    GL SSAA+  A   AL  
Sbjct: 79  NLVRSPKQWPDYLLGVVQQLQQAGHILGGFECAFCGNVPLGAGLSSSAAVECATIYALNE 138

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        D  L    A    V      +D  AS+ G                 I +  
Sbjct: 139 LFGLGIGRKDMTLLAQAAENHFVGVRCGIMDQFASMFGKKQQLIKLDCASLDYEYIPFNF 198

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLS--- 221
              S+  +D      L  S Y T   +    ++ I+  +P +N +      ++       
Sbjct: 199 DDVSLVLLDTQVKHSLASSEYNTRREECEAGVALIKKHHPHVNSLRDANMDMLDAYVKGH 258

Query: 222 ------------------QISCQALRNKNLKVLAQAMNRQQGLLETLG-VSDSKLSEIVW 262
                             Q +C  L+  +L+   + +      L+ L  VS  +L+ +  
Sbjct: 259 NATVYDRCRYVVEEIQRLQDACADLQRNDLEAFGKKVFATHEGLDKLYNVSCPELNWLAE 318

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               Q  ++ +++ G G G C I + +        +         
Sbjct: 319 FAAGQQGVLGARMMGGGFGGCTINIVRKSAVPALLEKAAAGYEQA 363


>gi|322706489|gb|EFY98069.1| mevalonate kinase [Metarhizium anisopliae ARSEF 23]
          Length = 490

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 141/382 (36%), Gaps = 75/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V++G AA+  AI+ R  L++T   +  R +++  +      + +
Sbjct: 44  FMVSAPGKVIVFGEHSVVYGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFTDIDLVHTWN 103

Query: 66  LAMF------------------------------------------------HPSFSFII 77
           +                                                   + +F+F+ 
Sbjct: 104 IDELPWDTFQQPSKKKSYYSLVTELDPDLVAALEPHVDVSPDSPEDIRRVHRNGAFAFLY 163

Query: 78  MAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD--- 129
           + ++   PS    L  + S +    GLGSSA+I V ++AALL    TL       P    
Sbjct: 164 LFLSLGSPSFPGCLYTLRSTIPIGAGLGSSASIAVCVSAALLIQLRTLSGPHPDQPPEEA 223

Query: 130 -----EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL---- 180
                 I   A    + + G  SG+D   +  G  + +Q   Y+                
Sbjct: 224 RLQIERINRWAFVYEMCIHGNPSGVDNTVATQGKAVVFQRLDYNKPPAVKPLWDFPELPL 283

Query: 181 --IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQALRNKNL 233
             + +     TA  + K+  +   +P++     + +++   +    ++          +L
Sbjct: 284 LLVDTKQPKSTAHEVAKVGKLNKMHPKLVGSILDAMDKVASSASELIADDDFDEEDEGSL 343

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
             + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I L + D+ 
Sbjct: 344 MKVGELMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCSITLLRPDVP 402

Query: 294 SLPYQSVNCHMHAKGIDIVPIT 315
                 +   +  +       T
Sbjct: 403 RAKLDELEERLDKENYAKFEAT 424


>gi|227872277|ref|ZP_03990636.1| galactokinase [Oribacterium sinus F0268]
 gi|227841889|gb|EEJ52160.1| galactokinase [Oribacterium sinus F0268]
          Length = 392

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/345 (18%), Positives = 116/345 (33%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--------- 62
           APG + L+GEH   +G      A++      +  R+D+     S   +  G         
Sbjct: 29  APGRVNLIGEHTDYNGGHVFPCALSMGSYAAVKKREDKNFRFYSLNVEGAGVISAGEHDF 88

Query: 63  -SLDLAMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
             L+   +      +I A+    ++  CG DL +   + +  GL SSA++ V + +    
Sbjct: 89  TPLEDKQWAAYLKGVIWAMEKRGLEIPCGLDLVLYGNIPNGSGLSSSASLEVLMGSICKE 148

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L       P+  L   ++           +D  AS  G                     +
Sbjct: 149 LYGLSVSFPELALIGQYSENNYNGMNCGIMDQFASAMGKKDHAIFLDTATLQFSYAPIVL 208

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI--------------NEIN 210
             + I   +      LI S Y     +  + +  ++   P                 EI+
Sbjct: 209 KDHCIIISNTNKKHKLIGSAYNDRRRESEEALKILQKFRPIKSLGELSDEDFFALEKEIS 268

Query: 211 QKIYALMGKL-------SQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
             I  +  K        +  + +AL   +L    + MN     L     VS  +L  +V 
Sbjct: 269 NPIIRMRAKHAVLENNRTIAAKKALEEGDLHRFGELMNLSHDSLRDDYEVSCEELDTLVD 328

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             R+ P++  S+++G G G C + L + D      + V      K
Sbjct: 329 AARDLPYVYGSRMTGGGFGGCTVTLLEKDKKEEFMRKVAEIYERK 373


>gi|145632178|ref|ZP_01787913.1| galactokinase [Haemophilus influenzae 3655]
 gi|145634769|ref|ZP_01790477.1| galactokinase [Haemophilus influenzae PittAA]
 gi|144987085|gb|EDJ93615.1| galactokinase [Haemophilus influenzae 3655]
 gi|145267935|gb|EDK07931.1| galactokinase [Haemophilus influenzae PittAA]
          Length = 384

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L  +   S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GNLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALVPHDKVDAIRKIIADNYEK 364


>gi|212537675|ref|XP_002148993.1| mevalonate kinase [Penicillium marneffei ATCC 18224]
 gi|210068735|gb|EEA22826.1| mevalonate kinase [Penicillium marneffei ATCC 18224]
          Length = 558

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 79/382 (20%), Positives = 134/382 (35%), Gaps = 75/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLIN 52
             VSAPG +++ GEH V+HG AAL  AI+ R  L +T                  D   +
Sbjct: 110 FMVSAPGKVIVFGEHAVVHGKAALAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDHTWD 169

Query: 53  IDSS-------------LGQYCGSLDLAMFHP-----------------------SFSFI 76
           IDS                     LD  +                          +  F+
Sbjct: 170 IDSLPWNVFKHPSKKKMYYDLVTELDPDLVAAVQPHAAAVSTDKPDDVRKIHQSSAAQFL 229

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+++V ++AALL    TL       P   
Sbjct: 230 YLFLSLGSPESHAAIYTLRSTIPIGAGLGSSASVSVCLSAALLLQIRTLAGPHPDQPPEE 289

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    + + G  SG+D   S  G  + ++   YS               
Sbjct: 290 AEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVLFRRSDYSKPPTVTPLNKFPELP 349

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ----ALRNKNL 233
              + +     TA  + K+  +   +PE+ E        +   +    +        + L
Sbjct: 350 LLLVNTRQSRSTAVEVAKVGRLRETHPEVTEAMLDTIDKVTMSASEMIKESDFEEDEEAL 409

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
           +          GLL +LGVS  +L   + +L +  +I  +K++G+G G C I L + D  
Sbjct: 410 EEFGALFRINHGLLVSLGVSHPRLER-IRELVDYANIGWTKLTGAGGGGCAITLIRPDAT 468

Query: 294 SLPYQSVNCHMHAKGIDIVPIT 315
               + +   + A+  +    T
Sbjct: 469 PETLKDLEAKLAAENFEKFETT 490


>gi|255728383|ref|XP_002549117.1| hypothetical protein CTRG_03414 [Candida tropicalis MYA-3404]
 gi|240133433|gb|EER32989.1| hypothetical protein CTRG_03414 [Candida tropicalis MYA-3404]
          Length = 431

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/381 (19%), Positives = 131/381 (34%), Gaps = 77/381 (20%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDL 66
             VSAPG +++ GEH  ++G  A+  A++ R  L ++   D   I +     +   S ++
Sbjct: 6   FIVSAPGKVIIFGEHSAVYGKPAIAAALSLRCYLLVSPSVDANTITLKFPDIELDHSWNI 65

Query: 67  AM--------------------------------------------FHPSFSFIIMAINH 82
                                                         ++  F F+ + +N 
Sbjct: 66  NDIPWEEIKPFIKYDSNNKPLVPPELVPEIVDKLSGLLTAFDNKMHYYACFCFLYLFVNL 125

Query: 83  I-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE---------------P 126
               + G    V S L    GLGSSA+ +V +++AL  L                    P
Sbjct: 126 CDSKTPGATFVVRSTLPIGAGLGSSASTSVCLSSALALLGGWINKPSISADDKFLSEDIP 185

Query: 127 SPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPIHLIY--- 182
             + +   +        G  SGID A +  GG + +Q      +  I             
Sbjct: 186 DLEFVDKWSLMGEKCFHGNPSGIDNAVATFGGAVMFQRNSAPEQPSIRTNMRNFPAIKLL 245

Query: 183 ---SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL--- 236
              +     TA ++  +  +     E N I   + A M  L+Q + + +           
Sbjct: 246 LTNTKVPKSTAALVAGVGQL---NSEFNSITTSVLAAMEHLAQEAYKVMITPGFGKDETT 302

Query: 237 --AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNS 294
              + +N   GLL  LGVS   L   V  + ++  I A+K++G+G G C I L   ++  
Sbjct: 303 ILRKLVNMNHGLLVALGVSHPALET-VKIIGDKHQIGATKLTGAGGGGCAITLVNDNVEE 361

Query: 295 LPYQSVNCHMHAKGIDIVPIT 315
              Q       ++G D    +
Sbjct: 362 SVIQEAIKEFESEGYDSFETS 382


>gi|238893786|ref|YP_002918520.1| galactokinase [Klebsiella pneumoniae NTUH-K2044]
 gi|59803287|gb|AAX07752.1| galactokinase [Klebsiella pneumoniae]
 gi|238546102|dbj|BAH62453.1| galactokinase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 382

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIISHDTQQWSNYVRGVVKHLQQRNSHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 AAIGDKGGVRMTGGGFGGCVVALIPEDLVDTVQQAVANEYEAKTGIKETFYVCKPSQGAG 380


>gi|330827807|ref|YP_004390759.1| galactokinase [Aeromonas veronii B565]
 gi|328802943|gb|AEB48142.1| Galactokinase [Aeromonas veronii B565]
          Length = 382

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/340 (17%), Positives = 114/340 (33%), Gaps = 43/340 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDL 66
           V APG + L+GEH   +    L  AI+    + + LR DR + +   D    +    LD 
Sbjct: 23  VRAPGRVNLIGEHTDYNDGFVLPCAIDYETCVAIGLRDDRQVQVIAADYDNQRDQFDLDQ 82

Query: 67  AMFHP----SFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
            + H        +I   + +++       G DL V   +    GL SSA++ VAI  A  
Sbjct: 83  PIEHHPNQRWSDYIRGVVKYLQERGYALRGLDLVVSGNVPQGAGLSSSASLEVAIGQAFK 142

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQM 164
                     +  L    A    V      +D   S  G                +    
Sbjct: 143 EALGLDISQAEIALNGQQAENKFVGCNCGIMDQMISASGKTDHALLLDCRSLETRLITMP 202

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINE----------INQKIY 214
              ++  ++      L+ S Y T   Q      +  ++     +          +++  Y
Sbjct: 203 ADLAVLIVNSNVRRGLVDSEYNTRRQQCEAAARHYGVKALRDLDLAGLEAGKAGLDEACY 262

Query: 215 ALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
                +   +        AL + +L  L + M      +     ++   +  +V  ++ +
Sbjct: 263 RRARHIVGENARTLAAADALASHDLTSLGELMAESHAAMRDDFEITVPAIDGLVEIIKAR 322

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                  +++G G G CV+AL + +  +    +V     A
Sbjct: 323 IGTDGGVRMTGGGFGGCVVALLRPEKVAEVIAAVEAEYPA 362


>gi|292656879|ref|YP_003536776.1| mevalonate kinase [Haloferax volcanii DS2]
 gi|291370856|gb|ADE03083.1| mevalonate kinase [Haloferax volcanii DS2]
          Length = 367

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/346 (20%), Positives = 127/346 (36%), Gaps = 36/346 (10%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL----------- 57
             SAPG + L GEH V++G  A+  A+ +R  + ++ R D  + + +             
Sbjct: 3   VSSAPGKVYLFGEHAVVYGEPAVPCAVERRATVTVSARDDDHVRVRAEDLSLNGFTVEYR 62

Query: 58  GQYCGSLDLAMFHPSFSFIIMAI---------NHIKPSCGFDLKVISQLDSQLGLGSSAA 108
           G      D+ +  P     +  I             P  GFD+ V S +    GLGSSAA
Sbjct: 63  GSTRDRPDVDVPAPLVEAAMGYIDAAVDQARDAADAPDAGFDITVESDIPLGAGLGSSAA 122

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS 168
           + VA   A       +    +       A      G +S  D   S  GG +  +     
Sbjct: 123 VVVAGIDAATRELGLELEPRELAERAYQAEHEVQDGQASRADTFCSAMGGAVRVEGDDCR 182

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL 228
                   P  + + G    T  ++  +  +  EY    +    +  ++ +  ++  +A 
Sbjct: 183 TID-APPLPFVIGFDGGAGDTGALVSGVRALREEYDFAADTVSTVGDIVRRGEELLAEAD 241

Query: 229 RN------KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
            +      + L  L + M+   GLLE LGVS   L  +VW  RE      +K++G+G G 
Sbjct: 242 PDADDPPEELLSELGRFMDFNHGLLEALGVSSRSLDSMVWAARE-AGAYGAKLTGAGGGG 300

Query: 283 CVIALGKGDLNSLPY-------QSVNCHMHAKGIDIVPITPSHSTS 321
           C+++L                  +    +  +G+ +  + P     
Sbjct: 301 CIVSLDPTPETQTALRFTPGCEDAFRAELATEGVRV-EVPPDADAD 345


>gi|309790492|ref|ZP_07685052.1| mevalonate kinase [Oscillochloris trichoides DG6]
 gi|308227479|gb|EFO81147.1| mevalonate kinase [Oscillochloris trichoides DG6]
          Length = 317

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/303 (22%), Positives = 116/303 (38%), Gaps = 9/303 (2%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRL-INIDSSLGQYCGSL 64
            I  SAP  ++L GEH V++   A+   + + R     T       +   +       S 
Sbjct: 1   MITTSAPAKIILCGEHAVVYNRPAIALPLGDVRAYAEATPTAPGTGLYFVAPDLGETWSF 60

Query: 65  DLAMFHPSFSFIIMAINHIKPSCG-FDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH 123
                HP        ++H+  +     + + S +    G+GS AAI  A+  A+     H
Sbjct: 61  SSDPQHPLSELAATVLDHLGAAAPDLTITLRSDIPIAGGMGSGAAIGAALVRAVAQALGH 120

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS---IEKIDFIFPIHL 180
               P E+    +A   +  G  SGID     +   I +Q    +   I  I    P+ L
Sbjct: 121 -NLPPAEVSALVYASEGRYHGTPSGIDNTVIAYEQAIWFQRRPDTAPLIAPIRVATPLTL 179

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           +       +A   + +  +   +       +  +  +  +   +  AL   +L  L Q M
Sbjct: 180 VIGDTGVRSA-THRPVCDLRERWQAEPATYEARFDAVAAVVTQARAALAAGDLAALGQIM 238

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           N  Q LLE LG+S  +L  +V   R Q   + +K+SG+G G  +IAL   D       ++
Sbjct: 239 NTNQTLLEELGISSPELDCLVHAAR-QAGALGAKLSGAGWGGVMIALAHSDQCQQVADAL 297

Query: 301 NCH 303
              
Sbjct: 298 QAA 300


>gi|229844687|ref|ZP_04464826.1| galactokinase [Haemophilus influenzae 6P18H1]
 gi|229812401|gb|EEP48091.1| galactokinase [Haemophilus influenzae 6P18H1]
          Length = 384

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L  +   S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GNLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALVPHDKVDAIRKIIADNYEK 364


>gi|289803446|ref|ZP_06534075.1| galactokinase [Salmonella enterica subsp. enterica serovar Typhi
           str. AG3]
          Length = 378

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/343 (18%), Positives = 116/343 (33%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 24  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 83

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 84  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 143

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 144 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 202

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 203 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 262

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 263 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 322

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G CV+AL   DL     Q+V     AK
Sbjct: 323 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAK 365


>gi|116628121|ref|YP_820740.1| galactokinase [Streptococcus thermophilus LMD-9]
 gi|122267283|sp|Q03JS8|GAL1_STRTD RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|116101398|gb|ABJ66544.1| galactokinase [Streptococcus thermophilus LMD-9]
          Length = 388

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I   +  
Sbjct: 84  RFENEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIVEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQCAIYLDTNTLKYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELSDSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL    L+   + MN     L+    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGELEGFGRLMNASHVSLKYDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|116334468|ref|YP_795995.1| galactokinase [Lactobacillus brevis ATCC 367]
 gi|122268853|sp|Q03PA8|GAL1_LACBA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|116099815|gb|ABJ64964.1| galactokinase [Lactobacillus brevis ATCC 367]
          Length = 387

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 56/352 (15%), Positives = 115/352 (32%), Gaps = 50/352 (14%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG- 62
              ++  S PG + L+GE+   +G      AI+       + R D+   + S+     G 
Sbjct: 17  APQRVFFS-PGRINLIGEYTDFNGGHVFPAAISMGTYAAYSARDDKQFRVYSANVPDAGV 75

Query: 63  ------SLDLAMFHPSFSFIIMAI-----NHIKPSCGFDLKVISQLDSQLGLGSSAAITV 111
                 +L         +++   +       +    GFDL V   L    GL SSA++ +
Sbjct: 76  LTFSLDNLAFDKADNWANYLKGMLFELAKQDLTIDHGFDLFVHGNLPDASGLSSSASMEM 135

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------------- 158
            +   L      K    + +              +  +D  A   G              
Sbjct: 136 LMGEILHAAYGMKLDEVEMVKVGQQVENDYFGLNTGIMDQFAIGMGKKDQAILLDTNTMD 195

Query: 159 --LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIY 214
                  +  Y +  ++      L  S Y    AQ  + +  ++ +     + ++N+  +
Sbjct: 196 YEYAPLALGDYVVVIMNTKKRRELTDSKYNERRAQCEEALRRLQTKLDIKTLGDLNEDEF 255

Query: 215 ALM-------------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSD 254
                                  + +  +  AL+  +L+     +N     L     V+ 
Sbjct: 256 DENAYLINDDVLIKRARHAVFENQRTLKAFDALQKNDLQRFGHLVNASHISLNYDFAVTG 315

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
            +L  +V    +QP ++ ++++G+G G C IA+ K D  +     V      
Sbjct: 316 KELDTLVETAWQQPGVLGARMTGAGFGGCAIAIVKKDNVADFEAQVGKTYED 367


>gi|52001494|gb|AAU21548.1| GalK [Streptococcus thermophilus]
          Length = 388

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 I   
Sbjct: 144 L-YDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQCAIYLDTNTLKYDLIPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDKNRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|56414123|ref|YP_151198.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197363045|ref|YP_002142682.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|81677844|sp|Q5PG77|GAL1_SALPA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889787|sp|B5BC50|GAL1_SALPK RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|56128380|gb|AAV77886.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094522|emb|CAR60042.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 382

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/343 (18%), Positives = 116/343 (33%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQADEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G CV+AL   DL     Q+V     AK
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAK 363


>gi|30995403|ref|NP_438979.2| galactokinase [Haemophilus influenzae Rd KW20]
 gi|1169820|sp|P31767|GAL1_HAEIN RecName: Full=Galactokinase; AltName: Full=Galactose kinase
          Length = 384

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALAPHDKVDSVRKIIADNYEK 364


>gi|262041187|ref|ZP_06014401.1| galactokinase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259041476|gb|EEW42533.1| galactokinase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 383

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 82

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 83  APIISHDTQQWSNYVRGVVKHLQQRNSHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 143 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 201

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 202 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 261

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 262 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHTSMRDDFEITVPQIDTLVEIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 322 AAIGDKGGVRMTGGGFGGCVVALIPEDLVDTVQQAVANEYEAKTGIKETFYVCKPSQGAG 381


>gi|260579911|ref|ZP_05847741.1| galactokinase [Haemophilus influenzae RdAW]
 gi|1573832|gb|AAC22478.1| galactokinase (galK) [Haemophilus influenzae Rd KW20]
 gi|260093195|gb|EEW77128.1| galactokinase [Haemophilus influenzae RdAW]
          Length = 397

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 28  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 87

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 88  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 147

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 148 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 206

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 207 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 266

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 267 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 326

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 327 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALAPHDKVDSVRKIIADNYEK 377


>gi|327304279|ref|XP_003236831.1| mevalonate kinase [Trichophyton rubrum CBS 118892]
 gi|326459829|gb|EGD85282.1| mevalonate kinase [Trichophyton rubrum CBS 118892]
          Length = 518

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/394 (19%), Positives = 138/394 (35%), Gaps = 81/394 (20%)

Query: 1   MGQCLHK-----ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINI 53
           MG+ +         VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + +
Sbjct: 61  MGRKMSSPMAPPFMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTL 120

Query: 54  DSSLGQYCGSLDLAMF-------------------------------------------- 69
           +        + D+                                               
Sbjct: 121 NFRDIGLDFTWDIDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEV 180

Query: 70  -----HPSFSFIIMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------- 116
                H +  F+ + ++   P     +  + S +    GLGSSA+++V ++ A       
Sbjct: 181 RKIHQHSANQFLYLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRI 240

Query: 117 -----LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
                        E   + I   A    L + G  SG+D   S  G  + ++   YS   
Sbjct: 241 LAGPHQDQPPDEAEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPP 300

Query: 172 IDFIFPIHL------IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKL 220
                          I S     TA  + K++ ++  +P + E     I+    +    +
Sbjct: 301 TVTPMLDFPQMKLLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLI 360

Query: 221 SQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGL 280
           +        ++ +  L +      GLL +LGVS  +L   + +L +   I  +K++G+G 
Sbjct: 361 ASDDFDEHCSEKINHLGELFRINHGLLVSLGVSHPRLER-IRELVDHADIGWTKLTGAGG 419

Query: 281 GDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI 314
           G C I L K   N    + +   ++ +G D    
Sbjct: 420 GGCTITLFKAKWNEEAIEHLEEQLNDEGYDRYET 453


>gi|320333984|ref|YP_004170695.1| galactokinase [Deinococcus maricopensis DSM 21211]
 gi|319755273|gb|ADV67030.1| galactokinase [Deinococcus maricopensis DSM 21211]
          Length = 345

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/339 (17%), Positives = 116/339 (34%), Gaps = 29/339 (8%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+    +  SAPG + L+GEH    G   L  AI +   +++         + ++  +  
Sbjct: 9   GRAPD-VTASAPGRVNLLGEHTDYQGGFVLPTAIPQDTTVHMGRNGTAEHRVYAADLERH 67

Query: 62  GSLDL-AMFHPSFS-FIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
               + A   P F+ ++  A+       G D+ V S +    GL SSAA+ V+   A   
Sbjct: 68  ARFPVGANAEPHFAQYVAGALALAGVQEGVDVHVTSTVPMGAGLSSSAALEVSTLRAARE 127

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKIDFI 175
           L +  +     +   A    ++  G++ GI    +        ++         E +   
Sbjct: 128 L-FALDLDDVRVAQIAQRAEIEFAGVNCGIMDQMASSLADARRMLRLDTRTLERETLPLP 186

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEIN------------------QKIYALM 217
               ++      P +      +    E  E + +                   + +    
Sbjct: 187 GGAQVLVIDSGVPRSLAESGYNTRRAEVEEASRLLGVHELRDVTDVQVVETLPEPLNRRA 246

Query: 218 GKLSQISCQAL--RNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQPHIMASK 274
             +   + + L   N +     Q MN     L     VS  K+ E+V  L+    +  ++
Sbjct: 247 RHVVTENARVLAAVNADAAAFGQLMNASHASLRDDYEVSHPKVDELVELLQTHADVFGAR 306

Query: 275 ISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVP 313
           ++G+G G  ++AL +          V       G  +VP
Sbjct: 307 MTGAGFGGALVALVREGAAEAVAADVLAQYDGPGRRVVP 345


>gi|322385461|ref|ZP_08059105.1| galactokinase [Streptococcus cristatus ATCC 51100]
 gi|321270199|gb|EFX53115.1| galactokinase [Streptococcus cristatus ATCC 51100]
          Length = 392

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++ + + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVPLENL 87

Query: 72  SF----------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +     K   G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHKIDRGMDVYVYGNIPNGSGLSSSASLELLTGIMAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C I+L + D      ++V  H   
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAISLVQKDAVEAFKEAVGKHYEE 371


>gi|241896261|ref|ZP_04783557.1| galactokinase [Weissella paramesenteroides ATCC 33313]
 gi|241870502|gb|EER74253.1| galactokinase [Weissella paramesenteroides ATCC 33313]
          Length = 388

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 119/362 (32%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI+      ++LR D  I+  S+  +  G        L
Sbjct: 25  SPGRVNLIGEHTDYNGGHVFPAAISVGTYAAVSLRDDNEIHAFSANFKDAGMVSFAKDDL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            +  +     ++   I+ +         GF+L ++  + +  GL SSA++ + I   L  
Sbjct: 85  KIRQYDSWVKYVRGVISELSKLGHEVPRGFNLAIVGDMPTASGLSSSASLELLIGVMLND 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L      +   +          +   +  +D  A   G                ++    
Sbjct: 145 LFDFGMDTLSLVKLGQAVENDYLGLQTGIMDQFAVAFGQEKQAIFLDTNTMDYEMVPADF 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINEINQKIY 214
             Y +  +       L+ S Y    A+  K +  ++              E  +I   I 
Sbjct: 205 GDYELVIMTTNKKRELVDSKYNERRAETQKALEELQAVADINSLGDLTTEEFEKIVDHIS 264

Query: 215 A-----------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
           +              + + ++ +AL   ++K   + +      L     V+  +L  +V 
Sbjct: 265 SPVNQRRARHAVAENERTVLAKKALSEHDMKRFGELLTESHNSLRDDYEVTGIELDTLVS 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
               QP ++ ++++G+G G   IAL           +V      K G             
Sbjct: 325 AAMAQPGVLGARMTGAGFGGSAIALVAKSEADNFAAAVGKVYDEKIGYQASFFVADIVDG 384

Query: 322 LY 323
            +
Sbjct: 385 TH 386


>gi|257892676|ref|ZP_05672329.1| galactokinase [Enterococcus faecium 1,231,408]
 gi|257829055|gb|EEV55662.1| galactokinase [Enterococcus faecium 1,231,408]
          Length = 395

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/363 (16%), Positives = 121/363 (33%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  DYDKKANWANYVKGMVLKLKEAGHPIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
             Y+I  ++      L  S Y    ++  + ++ ++   P                    
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            +      +      + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLTRRARHAVSENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|168333306|ref|ZP_02691590.1| galactokinase [Epulopiscium sp. 'N.t. morphotype B']
          Length = 389

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 61/352 (17%), Positives = 120/352 (34%), Gaps = 49/352 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD- 65
           ++   +PG + L+GEH   +G       I       +  R D+ +   S   +  G ++ 
Sbjct: 15  EVIYFSPGRINLIGEHIDYNGGLVFPCPITLGTYAAVARRDDKTVRCYSKNFEDLGIIEF 74

Query: 66  ---------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
                       +      +   +   + K + GFD  V   + +  GL SSA++ + I 
Sbjct: 75  NLDHLDYDKKDNWTNYAKGVAKFLXEKYPKINSGFDAVVYGNIPNGSGLSSSASLELLII 134

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------L 159
               +L        D  L         +   S  +D  A   G                 
Sbjct: 135 QIFKSLFNLPITEVDAALLGKKVENEYIGVNSGIMDQFAISLGKKDKAILLDCNSLDFTY 194

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--YPEINEINQKIYALM 217
           I   MP   I  ++      L  S Y    A+    ++ ++ +     + EI+       
Sbjct: 195 IPVDMPTTKIVIMNTNKRRELADSKYNERRAECESALAKLQSKVNAENLCEIDLAXLKAN 254

Query: 218 ------------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLS 258
                                ++ S +A +N +L    + +N     L E   V+  +L 
Sbjct: 255 KDLLTENEYKXACHAITENIRTKASAEAFKNNDLVEFGKLLNASHKSLKEDYEVTGIELD 314

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGI 309
            +V   +EQP  + ++++G+G G C +A+ + D      ++V   ++   G 
Sbjct: 315 TLVAAAQEQPGTLGARMTGAGFGGCSLAIVENDKIEAFVENVGKAYLDKIGY 366


>gi|307705514|ref|ZP_07642368.1| galactokinase [Streptococcus mitis SK597]
 gi|307620972|gb|EFO00055.1| galactokinase [Streptococcus mitis SK597]
          Length = 392

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI+         R+D+++   S+  +  G ++  +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKREDQVLRFYSANFEDKGIIEAPLADL 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         GFD  V   + +  GL SS+A    +T  +  
Sbjct: 88  KFEKEHSWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGL-SSSASLELLTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGK-- 219
           +    +  ++      L  S Y    A+  K +  +++      + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAFDQYSYLI 266

Query: 220 -----------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENKRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDILV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G G C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFGGCAIALVQKDTVETFKEAVGKHYEE 371


>gi|307204866|gb|EFN83424.1| Mevalonate kinase [Harpegnathos saltator]
          Length = 387

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/374 (17%), Positives = 137/374 (36%), Gaps = 67/374 (17%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL------INIDSSLG 58
           +H+  VSAPG ++L GEH V++   A+  ++++R+ L      D +      + I     
Sbjct: 3   IHQFKVSAPGKVILFGEHAVVYNKLAVAASLDQRMTLEFAELPDEVAESRQMVEISLPNI 62

Query: 59  QYCGS---------LDLAMFHPSFSF--IIMAINHIKPS--------------------- 86
               S         + L  +H  + +  +   +    P+                     
Sbjct: 63  DLYLSVHIKKIKDFISLDQYHEPYDYDNLYRLVREFVPTIINRATTEQIQSLEAFFFTMV 122

Query: 87  ---------CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY--------HKEPSPD 129
                      F + + ++     GLGSSA+  V                          
Sbjct: 123 FVNRNRTVLKPFRVHLDTEFPIGSGLGSSASFVVCFVTCFYYWWKLRKGEARKFIPYDLR 182

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKID--FIFPIHLIYSGYKT 187
            I   +      + G  SGID +    G ++ ++   Y +E +       I L+ +  + 
Sbjct: 183 HIADMSQMCEKVMHGNPSGIDTSVCTFGSIVKFRSNPYIMEPMAKAPKLKILLVDTQVQR 242

Query: 188 PTAQVLKKISYIEIEYPEINE--------INQKIYALMGKLSQISCQALRNKNLKVLAQA 239
            T  +++K+  ++ ++P I E        I+   +  +  + ++S         K L + 
Sbjct: 243 STKTMVQKVKELQAKHPTIYEPFIASIDGISDAAFQALVPIFRLSDNCEILLKYKELMKL 302

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
           +N  Q +L  L VS   L +I  + ++    +A+K++G+G G     L   D +     +
Sbjct: 303 INMNQNILSMLEVSHPALDKICDEAQKHG--LAAKLTGAGGGGHAYVLIPPDTSDETISN 360

Query: 300 VNCHMHAKGIDIVP 313
           ++  + A+G  + P
Sbjct: 361 LSQKLTAEGFKVTP 374


>gi|323342879|ref|ZP_08083111.1| galactokinase [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463991|gb|EFY09185.1| galactokinase [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 387

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/368 (17%), Positives = 120/368 (32%), Gaps = 50/368 (13%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL- 64
           H+    APG + L+GEH    G +    AI       +  R D+ +N+ S+  ++ G + 
Sbjct: 17  HEFEFFAPGRINLIGEHIDYSGGSVFPCAITYGTYALVRKRNDKQLNLYSTNFEHLGIIT 76

Query: 65  ---------DLAMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAI 113
                    +   +      +I         C  G D+     + +  GL SSA+I V  
Sbjct: 77  SEVDKLVYNENDDWANYPKGVIKMFELEGHVCDFGLDILYYGNIPNGAGLSSSASIEVLT 136

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------- 158
              +  L +  E     +  +  A    +      +D  A   G                
Sbjct: 137 AWIVNKLFHFNEDMITCVKLSQKAENEFIGVNCGIMDQFAVGMGQKDHAILLNTNSLAYE 196

Query: 159 LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--------------- 203
            +  ++   SI   +      L  S Y    AQ  K ++ ++ EY               
Sbjct: 197 YVPVELGDASIVIANTNKRRGLADSAYNERRAQCEKALAILKEEYNIEHLCDLSLDQLIA 256

Query: 204 PEINEINQKIYALMGKLSQISC------QALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
            E    ++ +Y         +       + L++ ++      MN     L     V+  +
Sbjct: 257 KESLFDDKVVYRRAYHAVSENERTKRASEVLKSGDINAFGMLMNESHQSLRDDYEVTGIE 316

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPIT 315
           L  +V     Q   + ++++G+G G C IA+ +        ++V      K G +     
Sbjct: 317 LDTLVESAWSQTGTIGARVTGAGFGGCAIAIVENQHVDAFIKNVGKRYADKIGYEATFYV 376

Query: 316 PSHSTSLY 323
            S     +
Sbjct: 377 ASVGEGTH 384


>gi|52001489|gb|AAU21544.1| GalK [Streptococcus thermophilus]
          Length = 388

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   L  AI          R D+++   S+  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGNVLPVAITLGTYGAARKRDDKVLRFFSANFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I   +  
Sbjct: 84  RFENEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIVEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQCAIYLDTNTLKYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELSDSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL    L+   + MN     L+    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGELEGFGRLMNASHVSLKYDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|39978123|ref|XP_370449.1| hypothetical protein MGG_06946 [Magnaporthe oryzae 70-15]
 gi|145013479|gb|EDJ98120.1| hypothetical protein MGG_06946 [Magnaporthe oryzae 70-15]
          Length = 494

 Score =  167 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/384 (19%), Positives = 139/384 (36%), Gaps = 78/384 (20%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQ 59
              +    VSAPG +++ GEH V++G  A+  AIN R  L +T   +  R I +      
Sbjct: 41  SPMMPAFMVSAPGKVIVFGEHSVVYGKKAVAAAINLRSYLLVTALSKSKRTITLRFPDID 100

Query: 60  YCGSLDLAMF-------------------------------------------------- 69
              + ++                                                     
Sbjct: 101 LIHTWNIDDLPWSTFSQPSKKKYYYDLVTSLDPDLMDAIQPHLEPVSSDAPDAQRKVHMS 160

Query: 70  -HPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL----TLQYHK 124
              +F ++ M++       G    + S +    GLGSSA+I+  ++AALL    TL    
Sbjct: 161 AAAAFLYLFMSLGSHAFPGGI-YTLRSTIPIGAGLGSSASISACLSAALLLQIRTLSGPH 219

Query: 125 EPSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF 176
              P          I   A    + + G  SG+D   S  G  + +Q   Y+   +    
Sbjct: 220 PDQPPDEARVQVERINRWAFVAEMCIHGNPSGVDNTVSTQGKAVVFQRLDYARPPVVTPM 279

Query: 177 PIHL------IYSGYKTPTAQVLKKISYIEIEYPE-----INEINQKIYALMGKLSQISC 225
                     + +     T   ++K++ +   +P+     ++ +++   A    L+    
Sbjct: 280 WDFPELPLLVVDTKQAKSTKYEVEKVAKLRETHPKIVNSILDSMDKLTQAATDVLTDEDF 339

Query: 226 QALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVI 285
                ++L+ + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I
Sbjct: 340 DNEDVESLQKVGELMGMNHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCSI 398

Query: 286 ALGKGDLNSLPYQSVNCHMHAKGI 309
            L + D+     + +   +  +G 
Sbjct: 399 TLMRPDVPREKLERLKERLDHEGY 422


>gi|291459045|ref|ZP_06598435.1| galactokinase [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418299|gb|EFE92018.1| galactokinase [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 397

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/345 (17%), Positives = 110/345 (31%), Gaps = 50/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           APG + L+GEH   +G      A++      + +RKD+ I   S     CG L+  ++  
Sbjct: 27  APGRVNLIGEHTDYNGGHVFPCALSLGTYAAVRVRKDQNIRFYSMNFPDCGVLETNIYEF 86

Query: 70  ------HPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                     S+ +  I   +        GFD+     + S  GL SSA+I V     L 
Sbjct: 87  RPGEEGENWSSYPMGVIWAFRERGLFLENGFDICYSGNIPSGSGLSSSASIEVLTGYLLR 146

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQ 163
            L +      D  L    A           +D  AS  G                     
Sbjct: 147 ELFHFPLELLDLALLGQDAENRYNGMNCGIMDQFASAMGKKYHAIYLNTEDLSFEYALLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGK-- 219
                +   +      L+ S Y     +  + +S ++   P   + E++++ +       
Sbjct: 207 FRDLRLIITNTNKKHKLVGSAYNDRRRECEEALSRLQWRLPIHSLGELDEESFEEYRFLI 266

Query: 220 -----------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                                +  AL+  +L+     MN     L     VS  +L  + 
Sbjct: 267 GDPLLEKRAKHAVYENLRVIDAYIALQQDDLRHFGILMNESHISLRDDYEVSCPELDLLT 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
            +  +   +  S+++G G G C ++L   D      + +      
Sbjct: 327 SEAWKTQGVFGSRMTGGGFGGCTVSLVHKDALPEFKKRLKSQYQK 371


>gi|238798986|ref|ZP_04642448.1| Galactokinase [Yersinia mollaretii ATCC 43969]
 gi|238717170|gb|EEQ09024.1| Galactokinase [Yersinia mollaretii ATCC 43969]
          Length = 383

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/344 (19%), Positives = 118/344 (34%), Gaps = 45/344 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSL 64
           I + APG + L+GEH   +    L  AI+   ++    R DR I +   D    Q   SL
Sbjct: 21  ITIKAPGRVNLIGEHTDYNDGFVLPCAIDYETVISCGKRDDRQIRVIAADYDNQQDIFSL 80

Query: 65  DLAM----FHPSFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
           D  +     +    ++   + H++       G DL +   +    GL SSA++ VA+  A
Sbjct: 81  DAPIVPHPEYRWADYVRGVVKHLQLRDTNFGGADLVISGNVPQGAGLSSSASLEVAVGQA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL--------------IC 161
           L +L Y    S  E+         +  G + G +D   S  G                  
Sbjct: 141 LQSL-YQLPLSGVELALNGQEAENQFVGCNCGIMDQLISALGQQDHALLIDCRTLETRAV 199

Query: 162 YQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYPE 205
               K ++  I+      L+ S Y T   Q                       I+ E   
Sbjct: 200 SMPDKVAVVIINSNVKRGLVDSEYNTRRQQCETAARFFGVKALRDVDPNLFFSIQDELDP 259

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     +      + +  +  AL   +LK++ Q M      +     ++   +  +V  +
Sbjct: 260 VVAKRARHVITENERTLAAADALACGDLKLMGQLMQESHISMRDDFEITVPPIDSLVDIV 319

Query: 265 REQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +         +++G G G C++AL    L      +V     A 
Sbjct: 320 KSVIGEQGGVRMTGGGFGGCIVALMPTSLVEQVRATVAREYPAH 363


>gi|325662493|ref|ZP_08151096.1| galactokinase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471189|gb|EGC74414.1| galactokinase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 389

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/360 (15%), Positives = 112/360 (31%), Gaps = 50/360 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           APG + L+GEH   +G      A+          R+D  +   S   +  G ++      
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTLGTYGIARKREDNKLRFYSVNFERLGVIESSLEDL 83

Query: 67  -----AMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A      K   G D+ +   + +  GL SSA++ V     L  
Sbjct: 84  KPYKAAEWTNYPKGVMWAFEERGYKLPNGLDILLYGNIPNGSGLSSSASLEVLTGVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------ICYQMPKY-- 167
           +        D  L    +           +D  AS  G            + Y+      
Sbjct: 144 MFGFDVSMTDIALIGQFSENNFNGCNCGIMDQFASAMGKKDNAIFLDTNTLQYEYAPVVL 203

Query: 168 ---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------Y 203
               I  I+      L+ S Y     +    +  ++                        
Sbjct: 204 EDAKIVIINSKVKHSLVDSAYNDRRNECETALKELQEVVAVQTLGDLTEEAFEKHKDAIK 263

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            EI +   +      + +  + +AL+   ++   + MN     L     VS  ++  +V 
Sbjct: 264 SEIRQKRARHAVYENQRTIRAVEALKENRIEEFGKLMNESHRSLRDDYEVSCKEIDILVD 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
              E   ++ S+I+G G G C +++ K +      +++   ++   G +           
Sbjct: 324 LAWETEGVIGSRITGGGFGGCTVSIVKNEAVDGFIKNIGEQYLAKVGHEAEFYVVDIGDG 383


>gi|327459777|gb|EGF06117.1| galactokinase [Streptococcus sanguinis SK1057]
          Length = 392

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G ++++    
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLGNL 87

Query: 68  ------MFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +     K   G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGYKIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSITTLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|325263695|ref|ZP_08130428.1| galactokinase [Clostridium sp. D5]
 gi|324030733|gb|EGB92015.1| galactokinase [Clostridium sp. D5]
          Length = 390

 Score =  167 bits (424), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/364 (17%), Positives = 123/364 (33%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      A+      +   R DR ++  S      G ++ ++   
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTLGTYGFARRRSDRTMHFYSMNLDSFGVVEASLDDL 83

Query: 69  -------FHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A     +K   GFD+ V   + +  GL SSA++ V     L  
Sbjct: 84  TNKEAYGWANYPLGVVWAFSEKGVKLDTGFDMVVWGNIPNGSGLSSSASLEVLTGVVLTD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L +    S  ++            G + G +D  A   G                    +
Sbjct: 144 LFHINHFSMTDLALIGQYSENNFNGCNCGIMDQFAVAMGKKDHAIFLDTATLNYEYAPVE 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE-------------YPEINEIN 210
           +    I   +      L+ S Y     +    +  ++ E             + +  E+ 
Sbjct: 204 LKDAKIIITNSKVKHSLVDSKYNERRQECADALKALQQELDINTLGDLDMDTFEKFKEVI 263

Query: 211 Q--------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +        K      + +  + +AL++ N+    + MN+    L     VS  ++  +V
Sbjct: 264 KDPIKVRRAKHAVAENQRTIEAVKALKDGNVTRFGELMNQSHISLRDDYEVSCEEIDILV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               + P ++ S+I+G G G C + + K D      ++V      K G +    T     
Sbjct: 324 DLAWKVPGVIGSRITGGGFGGCTVNIVKNDSADDFIKTVGSAYQEKTGCEAEFYTVDIGG 383

Query: 321 SLYR 324
              R
Sbjct: 384 GACR 387


>gi|237809373|ref|YP_002893813.1| galactokinase [Tolumonas auensis DSM 9187]
 gi|259647202|sp|C4LB24|GAL1_TOLAT RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|237501634|gb|ACQ94227.1| galactokinase [Tolumonas auensis DSM 9187]
          Length = 384

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/346 (17%), Positives = 113/346 (32%), Gaps = 47/346 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSL 64
           + V APG + L+GEH   +    L  AI+   ++ L  R D  + +   D +  +   SL
Sbjct: 21  LYVRAPGRVNLIGEHTDYNDGFVLPCAIDYETVVALQRRDDDKVVVVAADYANQRDEFSL 80

Query: 65  DLAMFHP----SFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAA 116
              +         ++I   + ++        G ++ V   +    GL SSA++ VAI  A
Sbjct: 81  SQPIEAHADQLWSNYIRGVVKYLLEKGLSLKGLNMVVSGNVPQGAGLSSSASLEVAIGQA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LIC 161
                Y    +P  I         K  G + GI        G                + 
Sbjct: 141 FND-AYQLGLTPAAIALNGQEAENKFVGCNCGIMDQMISASGEKDHALLLDCRSLQTRLV 199

Query: 162 YQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYI------------------EIEY 203
                 ++  +       L+ S Y T  AQ      Y                   + + 
Sbjct: 200 KMPDDLAVLIVHSNVKRGLVDSEYNTRRAQCESAARYFGVKALRDVTLEQLQQAAEQGKL 259

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
             +     +      + +  +  AL   +L+ +   M      +     ++   +  +V 
Sbjct: 260 EPVVYQRARHVITENERTLAAADALETGDLEKMGVLMAESHNSMRDDFAITVPAIDTLVE 319

Query: 263 KLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            L++       ++++G G G CV+AL +         +V     AK
Sbjct: 320 ILQQHIGNDGGARMTGGGFGGCVVALLRPAQVDDVIAAVEAEYPAK 365


>gi|258512287|ref|YP_003185721.1| galactokinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479013|gb|ACV59332.1| galactokinase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 405

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/368 (15%), Positives = 110/368 (29%), Gaps = 56/368 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G   L  A+     L +  R DR     ++       +       
Sbjct: 28  APGRVNLIGEHTDYNGGYVLPAALTMGTWLVVRPRADRRFRFATTFSNRVVEVSADDVRF 87

Query: 68  ----MFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                F      +I  +      + G DL     L    GL SSA++ V    A+  L  
Sbjct: 88  RPEQDFANYPLGVIDVLRRRGVEAPGMDLFFFGNLPVGAGLSSSASVEVVTAFAINDLTG 147

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQMPKY 167
                    +    A    V      +D  +   G                 +      Y
Sbjct: 148 AGLDRESLAVIAQQAENEFVGVNCGVMDQFSVAMGKKDMALSLNCLTLAYELVPVHSEGY 207

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------- 211
            +   +   P  L  S Y    A+    ++ ++  +PE+  + +                
Sbjct: 208 RLVIANSNVPRKLSGSKYNERRAECEAALAVVKRRFPEVQALAEIEPGQWSEAEALLRAE 267

Query: 212 --------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
                         +   +    ++ + + L + N++   + MN     L     V+   
Sbjct: 268 GAPGFEAEVLVRRARHVVMESHRAREAARLLADGNIEAFGELMNASHRSLRDDYEVTGEA 327

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH-AKGIDIVPIT 315
           L  +V         + S+++G+G G C ++L + D      + V      A G       
Sbjct: 328 LDALVEAAWSAEGCIGSRMTGAGFGGCTVSLVREDAVEAFTRHVEEVYERATGRRPSFYV 387

Query: 316 PSHSTSLY 323
                 ++
Sbjct: 388 TDIGDGVH 395


>gi|68249414|ref|YP_248526.1| galactokinase [Haemophilus influenzae 86-028NP]
 gi|68057613|gb|AAX87866.1| galactokinase [Haemophilus influenzae 86-028NP]
          Length = 398

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 29  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 88

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 89  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEV 148

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 149 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 207

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKKIS-------------YIEIEY 203
                       +  ++   P  L+   Y T   Q  + +                +   
Sbjct: 208 ETIPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAVKFFGAKALRDVSVEQFQKRE 267

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 268 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 327

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 328 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALTPHDKVDAVRKIIADNYEK 378


>gi|34762696|ref|ZP_00143687.1| Galactokinase [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|27887653|gb|EAA24731.1| Galactokinase [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
          Length = 392

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 117/351 (33%), Gaps = 51/351 (14%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD- 65
           KI  S PG + L+GEH   +G      A++      +  R+D++  + S   +  G ++ 
Sbjct: 20  KIFFS-PGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFENLGIIEF 78

Query: 66  ---------LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
                       +      +I      + K   GFD+     + +  GL SSA+I V   
Sbjct: 79  NLDNLVYDKKDDWANYPKGVIKTFLDRNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTA 138

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------L 159
             L  L        + +     A    +   S  +D  A   G                 
Sbjct: 139 VILKDLFKLDVDMIEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKYEY 198

Query: 160 ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE----------------- 202
           +  ++   SI   +      L  S Y    +   + +  +                    
Sbjct: 199 VPVKLKNMSIIIANTNKKRGLADSKYNERRSSCEEAVKILNKNGINIKYLGELTVAEFEK 258

Query: 203 ---YPEINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
              Y    E  ++        + ++ + + L+  ++    + M++    L     V+ S+
Sbjct: 259 VKHYITDKEQLKRATHAVTENERAKNAVEFLKKDDIAEFGRLMDKSHISLRDDYEVTGSE 318

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           L  +V    E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 319 LDSLVEAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|254519070|ref|ZP_05131126.1| galactokinase [Clostridium sp. 7_2_43FAA]
 gi|226912819|gb|EEH98020.1| galactokinase [Clostridium sp. 7_2_43FAA]
          Length = 387

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/361 (16%), Positives = 127/361 (35%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A++      ++LR D+ + + SS  +  G ++  +   
Sbjct: 24  SPGRVNLIGEHTDYNGGNVFPCALSFGTYGVISLRNDKKVRMYSSNFEDIGIIEFDLDNI 83

Query: 70  -----HPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I+ +K      + GFD+ V   + +  GL SSA++ + I   +  
Sbjct: 84  SYEKSHDWVNYPKGVIDVMKKHGYDINIGFDIAVYGNIPNGAGLSSSASLELLIAVMMDN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L +  +    +++  +     K  G++ GI    +I  G                    +
Sbjct: 144 L-FELKIDRVDLVKFSQEAENKFVGVNCGIMDQFAIGMGKKNNAILLDCNTLKYNYCPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
           +    +   +      L  S Y    ++  + +  ++ +                     
Sbjct: 203 LKDEILVIANTNKRRGLADSKYNERRSECEQALEELKTKLNINSLGELSIEDFENNKNLI 262

Query: 203 YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             EI     K      + + ++ +AL   +L    + MN     L     V+  +L  +V
Sbjct: 263 DSEIRIKRAKHAVYENQRTLMAKEALAKNDLSTFGKLMNESHISLRDDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
                    + ++++G+G G C +AL K D      + V      K G +      +   
Sbjct: 323 ELAWNHEATIGARMTGAGFGGCTVALVKKDRAQDFIEKVGQGYKEKIGYEASFYIANIGD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|168236697|ref|ZP_02661755.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194734125|ref|YP_002113867.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|229889788|sp|B4TQR9|GAL1_SALSV RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|194709627|gb|ACF88848.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290121|gb|EDY29478.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 382

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLE 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|307592207|ref|YP_003899798.1| galactokinase [Cyanothece sp. PCC 7822]
 gi|306985852|gb|ADN17732.1| galactokinase [Cyanothece sp. PCC 7822]
          Length = 354

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 65/342 (19%), Positives = 113/342 (33%), Gaps = 33/342 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           KI  SAPG + L+GEH   +    L  AI +R  + L L  D   +  S       +L  
Sbjct: 12  KIETSAPGRVNLLGEHTDYNDGFVLPTAIPQRTTVQLALSSDGYHHFYSENLDELINLVE 71

Query: 67  AMFHPS--FSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
               PS   S+I   +  ++         ++ + S +    GL SSAA+ VA   AL  L
Sbjct: 72  VNHSPSGFASYIFGCMEVLRKQDSRIPALNIYIKSSVPIGSGLSSSAALEVAFLRALRQL 131

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKIDFIF 176
               +     I   A    +   G+  GI    +        L+         + +    
Sbjct: 132 L-ELQLDDVMIAQLAQQAEILYAGVQCGIMDQMASSLADTEHLLFLDTRTLERQVLPLPA 190

Query: 177 PIHLIYSG-----------YKTPTAQVLKKISYIEIE------YPEINEINQKIYALMGK 219
              ++              Y    ++  +    + ++       PE  EI  +      +
Sbjct: 191 NTEIVVIDSGIPRSLASSYYNQRRSECEQAAHLLNVKALRDITNPEAVEILPEPLRKRAR 250

Query: 220 LS----QISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQPHIMASK 274
                     + L + + +   Q MN     L     VS   L  +V  L+    +  ++
Sbjct: 251 HVITENNRVLKVLDSVSPQEFGQLMNASHASLRDDYEVSVPPLDTLVDLLQNTAGVYGAR 310

Query: 275 ISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITP 316
           ++G+G G   +AL           SV    +  G     + P
Sbjct: 311 LTGAGFGGACVALTAAGKGFEVAASVLEQYNHLGYQGRVLVP 352


>gi|308186098|ref|YP_003930229.1| Galactokinase [Pantoea vagans C9-1]
 gi|308056608|gb|ADO08780.1| Galactokinase [Pantoea vagans C9-1]
          Length = 382

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/343 (17%), Positives = 113/343 (32%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR I +   D    Q   SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVIACARRDDRQIRVVAADYENAQDIFSLD 81

Query: 66  LAMF---HP-SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +     P   +++   + H++       G D+ +   +    GL SSA++ VA+   +
Sbjct: 82  EEIVSVQEPMWANYVRGVVKHLQQRHADFGGIDMVISGNVPQGAGLSSSASLEVAVGTVV 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---GLICYQMPKYSIEKID 173
             L Y+       I         +  G + G +D   S  G     +           + 
Sbjct: 142 QQL-YNLPLDGAAIAVNGQEAENQFVGCNCGIMDQLISALGQKDHAMLLDCRTLGTRPVS 200

Query: 174 FIFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ----------- 211
               I ++              Y T   Q      +   +     E+ +           
Sbjct: 201 MPEDIAVVIINSNFRRSLVGSEYNTRREQCEAGARFFSKKALRDVELTEFEAAQAQLDPQ 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L  + Q M      +     ++   +  +V  ++
Sbjct: 261 VAKRVRHVLTENARTLEAADALTQGDLTRMGQLMAESHASMRDDFEITVPPIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            Q       +++G G G C++AL   DL      +V     A 
Sbjct: 321 AQIGERGGVRMTGGGFGGCIVALMPLDLVDQVKAAVAEQYEAA 363


>gi|291520717|emb|CBK79010.1| galactokinase [Coprococcus catus GD/7]
          Length = 388

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/340 (18%), Positives = 118/340 (34%), Gaps = 52/340 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G      A++      +  R+D+ +   S      G +       
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALDIGTYAVVRKRQDKRLFFYSMNYPEAGIINSSLTGQ 83

Query: 65  ----DLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
               D   +      +I A     ++P+CGF++ V   L S  GL SSA++ V    AL 
Sbjct: 84  LEHDDEDGWANYPKGVIWAFEEKGMQPACGFEMMVYGNLPSGAGLSSSASLEVLTGWALR 143

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICY 162
            + +  E S  EI   +        G+  G +D  A   G                 +  
Sbjct: 144 DI-FEFEVSDQEIALISQHAENTFNGVRCGVMDQFAVAMGRAHQAIYLNTENLSYRYVPV 202

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE-------------------- 202
           Q+    +          L  S Y     +  + ++ ++                      
Sbjct: 203 QLQNMQLIISCTNKERGLADSKYNLRRMECERALADLQKVASIRQLGELSMDDFEKYQAA 262

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
              ++     +        +  + QAL N +L    + MN     L     V+  +L  +
Sbjct: 263 ITDDVCRRRARHAVSENARTIQAVQALENNDLNRFGRLMNASHQSLRDDYEVTGDELDAL 322

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           V    +   ++ S+++G+G G C I+L + +      ++V
Sbjct: 323 VEAAWDTEGVLGSRMTGAGFGGCTISLVRTEAVDNFIKNV 362


>gi|255036578|ref|YP_003087199.1| galactokinase [Dyadobacter fermentans DSM 18053]
 gi|254949334|gb|ACT94034.1| galactokinase [Dyadobacter fermentans DSM 18053]
          Length = 395

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 64/362 (17%), Positives = 115/362 (31%), Gaps = 50/362 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ--YCGSLDL 66
              +PG + L+GEH   +    L  +++K V   +  R+D  + + ++     Y  SLD 
Sbjct: 30  VFRSPGRINLIGEHTDYNNGFVLPASVDKAVYFVIAPREDDQVILYAADLDQTYAFSLDD 89

Query: 67  ------AMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                 +  H     +           GF       +    GL SSAA+   +  AL  +
Sbjct: 90  LSKPEKSWPHYQIGIVEQIQKKGLKIGGFQAAFGGNVPVGAGLSSSAALECCLLFALNEI 149

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDFIF 176
            Y        I+  +     +  G+  G +D  AS  G     I         E   F  
Sbjct: 150 -YGLNLDRFSIVKMSQKSENEYVGVQCGIMDQFASAFGKEESVIRLDCRSLEYEYFPFPM 208

Query: 177 PIHLIYSG------------YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQIS 224
             +LI               Y T   +  K  + ++     +  +     AL+ +     
Sbjct: 209 DDYLIVLCDTMVKHSLASSEYNTRRQECEKGTAILQQYDANVLSLRDATPALVEEHQDEM 268

Query: 225 ---------------------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
                                C  L   NL    + M      L+    VS  +L  +V 
Sbjct: 269 GDVVYRRCKFITEEIQRVQDACDLLVQGNLPDFGKKMYDTHFGLQDEYEVSCPELDFLVA 328

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC-HMHAKGIDI--VPITPSHS 319
           +  +   ++ +++ G G G C I L K +        +   ++    ID+    +  +  
Sbjct: 329 QTLDDDSVLGARMMGGGFGGCTINLVKKEGVDAFEAKMKQAYLEKYQIDLPCYRVKITDG 388

Query: 320 TS 321
           T 
Sbjct: 389 TE 390


>gi|227552360|ref|ZP_03982409.1| galactokinase [Enterococcus faecium TX1330]
 gi|257886469|ref|ZP_05666122.1| galactokinase [Enterococcus faecium 1,141,733]
 gi|257895067|ref|ZP_05674720.1| galactokinase [Enterococcus faecium Com12]
 gi|293377948|ref|ZP_06624129.1| galactokinase [Enterococcus faecium PC4.1]
 gi|227178528|gb|EEI59500.1| galactokinase [Enterococcus faecium TX1330]
 gi|257822523|gb|EEV49455.1| galactokinase [Enterococcus faecium 1,141,733]
 gi|257831632|gb|EEV58053.1| galactokinase [Enterococcus faecium Com12]
 gi|292643495|gb|EFF61624.1| galactokinase [Enterococcus faecium PC4.1]
          Length = 395

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/363 (16%), Positives = 121/363 (33%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   I  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMILKLKEAGHPIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
             Y+I  ++      L  S Y    ++  + ++ ++   P                    
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            +      +      + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLTRRARHAVSENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|332876929|ref|ZP_08444682.1| galactokinase [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685037|gb|EGJ57881.1| galactokinase [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 385

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/362 (19%), Positives = 116/362 (32%), Gaps = 52/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLG-------QYCGSL 64
           APG + L+GEH   +G      AI++     ++ R DR   + S               L
Sbjct: 22  APGRVNLIGEHTDYNGGNVFPCAIDRGTYGLVSKRADRTFRMYSENFADLGVMEFTLDEL 81

Query: 65  DLAMFHPSFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I        K   GFD  V   + +  GL SSA+I +     L  
Sbjct: 82  VNDKKHDWANYPKGVIKMFVEEGFKIDSGFDFLVSGNIPNGAGLSSSASIEMLTGIVLKD 141

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYS-------- 168
           L +         L       L +   S  +D  A   G     I                
Sbjct: 142 LFHLSIDPIAMALLGKKVENLFIGVNSGIMDQFAIAMGKKDHAILLDCNTLKYDYVPVVL 201

Query: 169 ----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP---------EINEINQKIYA 215
               I   +      L  S Y    A+  + ++ ++ + P         E  E N+ +  
Sbjct: 202 KDEVIVIANTNKRRGLADSKYNERRAECDEALAELQTKLPIKALGELSIEEFEANKDLIK 261

Query: 216 LM------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + + L   NL    + MN+    L     V+  +L  +  
Sbjct: 262 SPIRQKRAKHAVYENQRTLKAQKELSAGNLAEFGKLMNQSHISLRDDYEVTGVELDTLAA 321

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHS 319
              EQP ++ S+++G+G G C +++ K D      ++V      K G   D      S  
Sbjct: 322 LAWEQPGVVGSRMTGAGFGGCTVSIVKKDKVDDFIKNVGEAYKNKIGYAADFYIAAVSEG 381

Query: 320 TS 321
             
Sbjct: 382 AR 383


>gi|205352033|ref|YP_002225834.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|229889784|sp|B5R741|GAL1_SALG2 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|205271814|emb|CAR36648.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326627074|gb|EGE33417.1| galactokinase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 382

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 122/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQQRNNAFGGVDMVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L+  + +  E   +
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTHREQCETGARFFQQPALRDVSLEAFNAVASELDPV 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDQGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAQQYEAKTGIKETFYVCKPSQGAG 380


>gi|15903710|ref|NP_359260.1| galactokinase [Streptococcus pneumoniae R6]
 gi|116516140|ref|YP_817085.1| galactokinase [Streptococcus pneumoniae D39]
 gi|38604858|sp|Q8DNK7|GAL1_STRR6 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|15459341|gb|AAL00471.1| Galactokinase [Streptococcus pneumoniae R6]
 gi|116076716|gb|ABJ54436.1| galactokinase [Streptococcus pneumoniae D39]
          Length = 392

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 125/345 (36%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI+         R D+++   S+  +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPVAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADL 87

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        GFD  V   + +  GL SSA++   +T  +  
Sbjct: 88  KFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGSGLSSSASLE-ILTGVVAE 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
             +  +    +++           G++SGI    +I  G                 +   
Sbjct: 147 HLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +++      + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 KDENRLKRARHAVLENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                Q  ++ ++++G+G   C IAL + D      ++V  H   
Sbjct: 327 HTAWAQEGVLGARMTGAGFSGCAIALVQKDTVEAFKEAVGKHYEE 371


>gi|309973689|gb|ADO96890.1| Galactokinase [Haemophilus influenzae R2846]
          Length = 384

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAISGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKSGGARMTGGGFGGCIVALAPHDKVDSVRKIIADNYEK 364


>gi|302023327|ref|ZP_07248538.1| mevalonate kinase [Streptococcus suis 05HAS68]
 gi|330832128|ref|YP_004400953.1| mevalonate kinase [Streptococcus suis ST3]
 gi|329306351|gb|AEB80767.1| mevalonate kinase [Streptococcus suis ST3]
          Length = 311

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/311 (22%), Positives = 139/311 (44%), Gaps = 11/311 (3%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +   A G ++LMGEH V++G  A+    +   I+     +   + +     +        
Sbjct: 3   VVGKANGKIILMGEHAVVYGQPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPK 62

Query: 68  MFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
           ++      I  ++  I         +++ S + ++ G+GSSAA+ VA+  AL    Y KE
Sbjct: 63  IWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YKKE 121

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI--YS 183
            +  E+     +      G  SGID AA+  G    + +    IE  +  F  HL+   +
Sbjct: 122 LTDSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKFHAHLVVADT 180

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
           G    T + +  ++ +  + PE  ++ +++    G L++ + + L     ++L   MN+ 
Sbjct: 181 GVTGNTLEAISDVADLLEKKPEAIKLVEEL----GNLTRQAKEDLATDQAELLGSRMNQA 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
             LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +   ++     +   
Sbjct: 237 HALLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALARTAQDAQKLAHILDQ 295

Query: 304 MHAKGIDIVPI 314
             A+   I  +
Sbjct: 296 AGARQTWIQYL 306


>gi|322516419|ref|ZP_08069344.1| galactokinase [Streptococcus vestibularis ATCC 49124]
 gi|322125152|gb|EFX96545.1| galactokinase [Streptococcus vestibularis ATCC 49124]
          Length = 388

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+++   S   +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKVLRFFSGNFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-FDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HIAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|125717841|ref|YP_001034974.1| galactokinase [Streptococcus sanguinis SK36]
 gi|125497758|gb|ABN44424.1| Galactokinase, putative [Streptococcus sanguinis SK36]
          Length = 392

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G ++      
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEMSLENL 87

Query: 66  -LAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI---HGGLICY-------------Q 163
           L +  +    +++        +  G++SGI    +I    G    Y              
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGIGAGQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  NL    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRSRHAVLENQRTLQARAALQAGNLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL + D      ++V      
Sbjct: 327 HTAWEQKGVLGARMTGAGFGGCAIALVRKDAVDTFKENVGRKYQE 371


>gi|169773659|ref|XP_001821298.1| mevalonate kinase [Aspergillus oryzae RIB40]
 gi|238491672|ref|XP_002377073.1| mevalonate kinase [Aspergillus flavus NRRL3357]
 gi|83769159|dbj|BAE59296.1| unnamed protein product [Aspergillus oryzae]
 gi|220697486|gb|EED53827.1| mevalonate kinase [Aspergillus flavus NRRL3357]
          Length = 534

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 82/383 (21%), Positives = 137/383 (35%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQY----- 60
             VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R I ++           
Sbjct: 90  FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLTKSQRTITLNFRDIGLNHTWS 149

Query: 61  CGSLDLAMFH-----------------PSFSFIIMAINHIKPSCGFD------------- 90
              L   +FH                      I+  +  I P    D             
Sbjct: 150 IDELPWDLFHQPTKKKYYYDLVTSIDPELLDAILPLVERISPDLPEDKRKHQRGAATAFL 209

Query: 91  ---------------LKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S + +  GLGSSA+I V I+AALL    TL       P   
Sbjct: 210 YLFCALGSPQHPGAIYTLRSTIPTGAGLGSSASICVCISAALLLQIRTLAGPHPDQPPDE 269

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    + + G  SG+D   +  G  + ++   YS        P      
Sbjct: 270 AEVQIERINRWAFVGEMCIHGNPSGVDNTVAAGGKAVIFRRGDYSKPPAVSSLPNFPELP 329

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ-----ALRNKN 232
              + +     TA  + K+  ++ E P + E        +   +Q   +      +    
Sbjct: 330 LLLVDTRQSRSTAVEVAKVGQLKEEQPLVTEAILDTIEKVNASAQEIIRETDSSGISKDT 389

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ +   +    GLL +LGVS  +L   + +L +  +I  +K++G+G G C I L + D 
Sbjct: 390 LERIGALIRINHGLLVSLGVSHPRLER-IRELVDFANIGWTKLTGAGGGGCAITLLRPDA 448

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   +  +G      T
Sbjct: 449 DPSAIRQLEEKLDEEGFAKYETT 471


>gi|28849777|gb|AAN52120.1| galactokinase [Streptococcus gordonii]
          Length = 392

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRNDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +     K   G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHKIDRGMDIYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +       +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLNLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 EGENRLKRARHAVFENQRTLQARAALQAGDLEKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|329996676|ref|ZP_08302493.1| galactokinase [Klebsiella sp. MS 92-3]
 gi|328539375|gb|EGF65393.1| galactokinase [Klebsiella sp. MS 92-3]
          Length = 383

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/360 (16%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQTDEFSLD 82

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 83  APIISHDTQQWSNYVRGVVKHLQQRNSHFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 143 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 201

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 202 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLEQFNAVAHELDPV 261

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 262 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 322 AAIGDKGGVRMTGGGFGGCVVALIPEELVDTVQQAVANEYEAKTGIKETFYVCKPSQGAG 381


>gi|162447659|ref|YP_001620791.1| mevalonate kinase [Acholeplasma laidlawii PG-8A]
 gi|161985766|gb|ABX81415.1| mevalonate kinase [Acholeplasma laidlawii PG-8A]
          Length = 313

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/306 (21%), Positives = 125/306 (40%), Gaps = 7/306 (2%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           A G ++LMGEH V++G  A+     +  I     + +  I IDS   +          + 
Sbjct: 9   ASGKIILMGEHSVVYGKPAIALPFKQAQISSKVFKTNDKITIDSFYHKGYLDDAPDTLYG 68

Query: 72  SFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
               I + + ++K P  G  +++ S L  Q GLGSSA++++AI  +L    +  E S + 
Sbjct: 69  IKQLIYIVLVYLKQPFHGIHIQIESSLPPQRGLGSSASVSIAIVRSLFD-AFKVELSQER 127

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYS-IEKIDFIFPIHLIYSGYKTPT 189
           +               SG+D      G  + YQ      +  +     I +  +G K  T
Sbjct: 128 LNYFVDVAEQIHHVNPSGLDAITIAFGQAVFYQKDLGKTLIPLKMDAVIVVADTGKKGLT 187

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
            + ++++  +  + P    I   I   + +L+      L    +  L  AM     LL +
Sbjct: 188 KEAVQEVKQLWTDNPT---IVSPIMDRLEELTNEVRTYLETNEIIRLGLAMTEAHQLLRS 244

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
           + VSD  L ++V  +      + +K++G G G C+IAL + +   +       +  A   
Sbjct: 245 IKVSDDLLEKLVE-VSLLNGALGAKLTGGGKGGCMIALAQNEDQGIRIADALKNAGAVNT 303

Query: 310 DIVPIT 315
            +  + 
Sbjct: 304 WLYDLK 309


>gi|325696622|gb|EGD38511.1| galactokinase [Streptococcus sanguinis SK160]
          Length = 392

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FALQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LQDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSITTLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  NL+   + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGNLEKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|327489195|gb|EGF20988.1| galactokinase [Streptococcus sanguinis SK1058]
          Length = 392

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|262282502|ref|ZP_06060270.1| galactokinase [Streptococcus sp. 2_1_36FAA]
 gi|262261793|gb|EEY80491.1| galactokinase [Streptococcus sp. 2_1_36FAA]
          Length = 392

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++     
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVPLENL 87

Query: 68  ------MFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  RFESEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        K  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENKFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNIVVIMNTNKRRELADSKYNERQAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|324993071|gb|EGC24991.1| galactokinase [Streptococcus sanguinis SK405]
 gi|324995623|gb|EGC27535.1| galactokinase [Streptococcus sanguinis SK678]
 gi|327461335|gb|EGF07666.1| galactokinase [Streptococcus sanguinis SK1]
 gi|327473974|gb|EGF19387.1| galactokinase [Streptococcus sanguinis SK408]
          Length = 392

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|324990823|gb|EGC22758.1| galactokinase [Streptococcus sanguinis SK353]
          Length = 392

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LQDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSITTLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  NL    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGNLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVGKDAVESFKENVGRKYQE 371


>gi|283784512|ref|YP_003364377.1| galactokinase [Citrobacter rodentium ICC168]
 gi|282947966|emb|CBG87530.1| galactokinase [Citrobacter rodentium ICC168]
          Length = 382

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 124/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAARDDRKVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQKRDASFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL--------------ICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGTQIALNGQEAENQFVGCNCGIMDQLISALGKQDHALLIDCRSLGSKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L++   +  E   +
Sbjct: 201 MPQGVAVVIINSNFKRTLVGSEYNTRRQQCETGARFFQQPALRDVSLEQFDAVANELDPL 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL   DL     Q+V     A+ GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCVVALIPEDLVPAVQQAVAEQYEARTGIKETFYVCKPSQGAG 380


>gi|304395733|ref|ZP_07377616.1| galactokinase [Pantoea sp. aB]
 gi|304357027|gb|EFM21391.1| galactokinase [Pantoea sp. aB]
          Length = 382

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/343 (17%), Positives = 113/343 (32%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR I +   D    Q   SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVIACARRDDRQIRVVAADYENAQDTFSLD 81

Query: 66  LAMF---HP-SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +     P   +++   + H++       G D+ +   +    GL SSA++ VA+   +
Sbjct: 82  EEIVSVQEPMWANYVRGVVKHLQKRHADFGGIDMVISGNVPQGAGLSSSASLEVAVGTVV 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---GLICYQMPKYSIEKID 173
             L Y+       I         +  G + G +D   S  G     +           + 
Sbjct: 142 QQL-YNLPLDGAAIAVNGQEAENQFVGCNCGIMDQLISALGQKDHAMLLDCRTLGTRPVS 200

Query: 174 FIFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ----------- 211
               I ++              Y T   Q      +   +     E+ +           
Sbjct: 201 MPEDIAVVIINSNFRRTLVGSEYNTRREQCEAGARFFNKKALRDVELAELEAAQSQLDPQ 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L  + Q M      +     ++   +  +V  ++
Sbjct: 261 VAKRVRHVLTENARTLEAADALTQGDLTRMGQLMADSHASMRDDFEITVPPIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            Q       +++G G G C++AL   DL      +V     A 
Sbjct: 321 AQIGERGGVRMTGGGFGGCIVALMPLDLIDQVKAAVAEQYEAA 363


>gi|251792977|ref|YP_003007703.1| galactokinase [Aggregatibacter aphrophilus NJ8700]
 gi|247534370|gb|ACS97616.1| galactokinase [Aggregatibacter aphrophilus NJ8700]
          Length = 384

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/347 (17%), Positives = 119/347 (34%), Gaps = 47/347 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           ++ V APG + ++GEH   +    +  AIN    +    R D + N+ ++         L
Sbjct: 20  ELTVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAIAGAKRNDHVWNVYAADLDLSDEFSL 79

Query: 67  AMFHP-----SFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAITVAITAA 116
               P       +++   +  I+  C     G DL +   +    GL SSAA+ VA    
Sbjct: 80  EKEIPQSEQKWANYVRGVVKFIQERCPDFKQGADLVISGNVPHSSGLSSSAALEVATGKF 139

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS------- 168
              L      S  EI         K  G + G +D   S  G      M           
Sbjct: 140 CQQL-GDLPLSHTEIALIGQKAENKFVGANCGNMDQLISALGQQDHLLMIDCRSLETQPT 198

Query: 169 -------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEYPEINE 208
                  +  ++   P  L+   Y T   Q  +              ++  + + PE+  
Sbjct: 199 PVPHDVAVIIVNSNVPHDLVTGEYNTRRQQCERAAAFFGVKALRDVSVAQFKEKEPELTA 258

Query: 209 INQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIV 261
           ++  +      +   +       +AL++ +L  L + M +    +     ++  ++  +V
Sbjct: 259 LDPLVAKRARHVVTENQRVLDAVEALKHNDLTRLGELMGQSHDSMRDDFEITVPQIDYLV 318

Query: 262 WKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              +        ++++G G G C++AL   D      + V  +   +
Sbjct: 319 ELAQLVIGKQGGARMTGGGFGGCIVALAPHDKVEAVRKIVADNYEKQ 365


>gi|329122826|ref|ZP_08251398.1| galactokinase [Haemophilus aegyptius ATCC 11116]
 gi|327472090|gb|EGF17528.1| galactokinase [Haemophilus aegyptius ATCC 11116]
          Length = 398

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 29  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 88

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 89  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEV 148

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 149 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 207

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 208 ETTPTPVPQDVAVIIVNSNVPHDLVTGKYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 267

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 268 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 327

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 328 IDYLVELAQLVIGKSGGTRMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 378


>gi|313230995|emb|CBY18993.1| unnamed protein product [Oikopleura dioica]
          Length = 387

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 109/361 (30%), Gaps = 46/361 (12%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           +I  SAPG + L+GEH   +       A+  R ++         I   S +       ++
Sbjct: 24  QIIASAPGRVNLIGEHTDYNKGFVFPIALPLRTVVVGYPNNSDEIQAVSLVVDGKVRFNV 83

Query: 67  AM-------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           +        +   F  ++        K   GF+    S +    G+ SSA++ VA    L
Sbjct: 84  SDIQTGDPFWGDYFKGVVAEFQKKTGKQVPGFNAVFNSNVPLGGGVSSSASMEVATATFL 143

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG------------------ 158
             L       P E      A          G +D   S+HG                   
Sbjct: 144 EALTGIT-LDPTEKALLCQAAEHNYPNNPCGIMDQFISVHGKADHALLIDCLNESSKLVN 202

Query: 159 ----LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIY 214
                IC+ +   +++                   A  +    ++     E  E  +   
Sbjct: 203 MPSSTICFFVINSNVKHKLSGENNPFAERQKSCFKAAEICGKDFLRSVTLEDLEKCKSKM 262

Query: 215 A-----------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLG-VSDSKLSEIVW 262
                          K +  + + L   +     + MN     L  L  VS  ++ E+V 
Sbjct: 263 DQETYNRALHGVEEDKRTLEAAEVLIKGDFNRFGELMNASHDSLRDLYEVSCPEVDELVE 322

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSL 322
             R+   +  S+I+G G G C + L   D       +VN H           T S    +
Sbjct: 323 IARKTKGVYGSRITGGGFGGCTVTLIDRDAVESLKDAVNAHYSRT-ASFFDGTASDGAKI 381

Query: 323 Y 323
           +
Sbjct: 382 H 382


>gi|239611598|gb|EEQ88585.1| mevalonate kinase [Ajellomyces dermatitidis ER-3]
          Length = 545

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 78/383 (20%), Positives = 139/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I ++    +   + D
Sbjct: 99  FMVSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD 158

Query: 66  LAMF------HPSFS-------------------------------------------FI 76
           +         HPS                                             F+
Sbjct: 159 IDSLPWELFRHPSKKKFYYDSVTSLDTELLEAIQPHVADISIGKPDDVRKIHQSSATAFL 218

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+I V ++AALL     L    +  P   
Sbjct: 219 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQPPEE 278

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 279 AETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 338

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+      +P ++E     I+Q   +    +      +   + 
Sbjct: 339 LLLVNSRQPRSTATEVAKVGKFCKAHPAVSESILEAIDQVTESASDFIQSGDFDSSSIEA 398

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +      +K++G+G G C I L + + 
Sbjct: 399 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHTGSGWTKLTGAGGGGCAITLLRANT 457

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   +  +G +    T
Sbjct: 458 DPAVLRQLEKTLDDEGFERYETT 480


>gi|261204900|ref|XP_002627187.1| mevalonate kinase [Ajellomyces dermatitidis SLH14081]
 gi|239592246|gb|EEQ74827.1| mevalonate kinase [Ajellomyces dermatitidis SLH14081]
 gi|327348388|gb|EGE77245.1| mevalonate kinase [Ajellomyces dermatitidis ATCC 18188]
          Length = 556

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 78/383 (20%), Positives = 139/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I ++    +   + D
Sbjct: 110 FMVSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD 169

Query: 66  LAMF------HPSFS-------------------------------------------FI 76
           +         HPS                                             F+
Sbjct: 170 IDSLPWELFRHPSKKKFYYDSVTSLDTELLEAIQPHVADISIGKPDDVRKIHQSSATAFL 229

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+I V ++AALL     L    +  P   
Sbjct: 230 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQPPEE 289

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 290 AETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 349

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+      +P ++E     I+Q   +    +      +   + 
Sbjct: 350 LLLVNSRQPRSTATEVAKVGKFCKAHPAVSESILEAIDQVTESASDFIQSGDFDSSSIEA 409

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +      +K++G+G G C I L + + 
Sbjct: 410 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHTGSGWTKLTGAGGGGCAITLLRANT 468

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   +  +G +    T
Sbjct: 469 DPAVLRQLEKTLDDEGFERYETT 491


>gi|116753789|ref|YP_842907.1| mevalonate kinase [Methanosaeta thermophila PT]
 gi|116665240|gb|ABK14267.1| mevalonate kinase [Methanosaeta thermophila PT]
          Length = 321

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 77/307 (25%), Positives = 128/307 (41%), Gaps = 20/307 (6%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL-INIDS-----------SL 57
            SAPG ++L GEH V+ G  AL  AI+ R  + +     +  I+I             S 
Sbjct: 4   ASAPGKVILFGEHAVVSGAPALGTAIDLRARVLVEDLPGKTEISIHGLGLRLSGFSVDSD 63

Query: 58  GQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           G+            +  ++   +  +       + V S++    GLGSSAAI VA  AAL
Sbjct: 64  GRVVSLGSSDEAAAAARYVSAVVKALDVRD-VRITVSSEIPVASGLGSSAAIVVATLAAL 122

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
                                     G+ S +D A + +GG I        +  +D    
Sbjct: 123 SHHMGIDMEVKSIAAEAHRIEKTVQGGLGSPMDTALAAYGGYIQISDG---VTPLDLPQM 179

Query: 178 IHLIYSG-YKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL 236
             ++        T   + ++  +   YP   EI   I+  MG +S+ +   +++ +LK L
Sbjct: 180 DLVVGCTSVPHDTRAEVARVQELRSRYP---EIVDPIFKAMGVISRKAVPCIKDLDLKEL 236

Query: 237 AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLP 296
            + MN   GLLE +GV   +LSE+V+  R     + +K++G+G G C+IAL K  + S  
Sbjct: 237 GRLMNINHGLLEAIGVGTRELSELVYAARGAGMALGAKLTGAGGGGCMIALPKEGMCSRA 296

Query: 297 YQSVNCH 303
             ++   
Sbjct: 297 ITAITQA 303


>gi|94968728|ref|YP_590776.1| galactokinase [Candidatus Koribacter versatilis Ellin345]
 gi|94550778|gb|ABF40702.1| galactokinase [Candidatus Koribacter versatilis Ellin345]
          Length = 398

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/351 (15%), Positives = 112/351 (31%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
           G+        APG + L+GEH   +    +  AI+    +  + R DRL+ + S      
Sbjct: 25  GETPR--IFRAPGRVNLIGEHTDYNEGLVMPAAIDFYTWVAASPRNDRLLRVWSQQYNEQ 82

Query: 62  GSLDLAM--------FHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVA 112
             + L          +      +   +     +  G +L +   +    GL SSAA+ ++
Sbjct: 83  FEIYLDEVQGPPRKHWSDYVRGMAGVLESAGYTLNGANLLIDGHVPVGAGLSSSAALELS 142

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---LICYQMPKYSI 169
              AL  +   +    D ++ +  A       +   +D   +  G     I         
Sbjct: 143 TGLALSGVSGIEIARLDLVMLSQKAENNYAGAMCGIMDQFIAGFGHAGNAILLDCRSLEY 202

Query: 170 EKIDFIFPIHLIYSG-----------YKTPTAQVLKKISYIEIEYPEINEINQ------- 211
             +     + L+              Y    A+  + +  +   YP++  +         
Sbjct: 203 SLLPIASDVRLVICNSMVKHDLAAGEYNHRRAECAEAVKLLRRSYPQVTALRDVTTEMLE 262

Query: 212 --------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
                         +        +  + +ALR+ +L  L + M      L     VS  +
Sbjct: 263 SHRSDLSDLIYRRARHVVTENDRTANAAKALRSNHLDELGRLMFASHASLRDDYEVSCRE 322

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           L  +V    +   ++ ++++G G G C I L + D  +     +       
Sbjct: 323 LDLLVEFASKVEGLIGARMTGGGFGGCTINLVRADAVNAFRAEIIAKYKQA 373


>gi|327469500|gb|EGF14969.1| galactokinase [Streptococcus sanguinis SK330]
          Length = 392

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +     K   G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHKIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+   L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGALDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|226328214|ref|ZP_03803732.1| hypothetical protein PROPEN_02106 [Proteus penneri ATCC 35198]
 gi|225202947|gb|EEG85301.1| hypothetical protein PROPEN_02106 [Proteus penneri ATCC 35198]
          Length = 386

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/339 (17%), Positives = 112/339 (33%), Gaps = 43/339 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI-------DSSLGQYCGSL 64
           APG + L+GEH   +    L  AIN ++++    R+D  I +       D        ++
Sbjct: 26  APGRVNLIGEHTDYNDGFVLPCAINYQMVVAAARREDNTIRVIAVDYQNDVDEFSLDNTI 85

Query: 65  DLAMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           +        +++   I+ ++       G D+ +   +    GL SSAA+ VAI   L TL
Sbjct: 86  EFLPNKMWANYVRGVIHFLQKDNYSFHGMDIAISGNVPQGAGLSSSAALEVAIGQTLKTL 145

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIFP 177
                   +  L    A    V      +D   S  G     +           +     
Sbjct: 146 YQLPISQKEIALNGQKAENQFVGCNCGIMDQLISACGEENHALLIDCRSLETSAVTMPEN 205

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEI---------------------------N 210
           + ++          V  + +    +  E   I                            
Sbjct: 206 MVVMIINTNKKRGLVDSEYNTRRQQCEEAARILNVAALRDATLDDLVAKKSLMSEVVYRR 265

Query: 211 QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQPH 269
            +        +  + +ALR+ +L  L++ M +    +     ++  ++  +V  ++    
Sbjct: 266 ARHVITENDRTLDAAEALRHGDLSTLSKLMMQSHLSMRDDFEITVKEVDSLVEIVKSVIG 325

Query: 270 -IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                +++G G G CV+AL   DL      SV     AK
Sbjct: 326 DCGGVRMTGGGFGGCVVALVTPDLVDKVVDSVKAQYEAK 364


>gi|332523690|ref|ZP_08399942.1| galactokinase [Streptococcus porcinus str. Jelinkova 176]
 gi|332314954|gb|EGJ27939.1| galactokinase [Streptococcus porcinus str. Jelinkova 176]
          Length = 387

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 61/345 (17%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI          R D+     S      G        L
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAAKKRTDQTCLFYSENFSELGVIAVDLNDL 83

Query: 65  DLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    I ++K        GFDL V   + +  GL SSA++ + +      
Sbjct: 84  VFDKEDNWTNYAKGVIKYLKAAGHRIDTGFDLYVKGTIPNGSGLSSSASLELLVGIVCEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +  +
Sbjct: 144 L-YDLDLERIDLVKIGKKTENDFIGVNSGIMDQFAIGMGADQKAIYLDTNTLDYELVPLE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +  Y I  ++      L  S Y    ++  K +  ++       + +++  ++       
Sbjct: 203 LGDYQIVIMNTNKRRELADSKYNQRRSECEKALEELQQVLSITSLGDLDDALFDQYAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL+   L+V  + MN     LE    V+  +L  +V
Sbjct: 263 KDGVRIKRARHAVSENQRTLRALEALQAGELEVFGRLMNASHVSLEHDYDVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IA+   D      + V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIAIVDKDHVESFKKVVEDRYQD 367


>gi|322373263|ref|ZP_08047799.1| galactokinase [Streptococcus sp. C150]
 gi|321278305|gb|EFX55374.1| galactokinase [Streptococcus sp. C150]
          Length = 388

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+++   S   +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKVLRFFSGNFEDKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|313836508|gb|EFS74222.1| galactokinase [Propionibacterium acnes HL037PA2]
 gi|314928962|gb|EFS92793.1| galactokinase [Propionibacterium acnes HL044PA1]
 gi|314971048|gb|EFT15146.1| galactokinase [Propionibacterium acnes HL037PA3]
 gi|328906591|gb|EGG26366.1| galactokinase [Propionibacterium sp. P08]
          Length = 411

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/357 (15%), Positives = 107/357 (29%), Gaps = 53/357 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + ++GEH   +    L  A+  R  +    R D  + + S L     + +      
Sbjct: 48  APGRVNIIGEHTDYNNGLCLPIALPHRTYVAARRRDDDKVILVSQLDDSVLTWEGTLEEI 107

Query: 66  ----LAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
               +A +      +  A+        GF+  +++ +    GL SSAA+   +   L  L
Sbjct: 108 APGSVAGWKAYTGGVAWALRQAGHDLSGFEAALVTCVPLGAGLSSSAAVECGVGLVLADL 167

Query: 121 QY----HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKI 172
                   +    +++  A      V    +G     +      G  +      +S+ ++
Sbjct: 168 YDLGLTDSDARRTDLVNAARTAENNVAEAPTGGLDQTASLRTTEGHALLLDCNDWSVRQV 227

Query: 173 DFI--------------FPIHLIYSGYKTPTAQVLKKISYI---------------EIEY 203
            F                P  L+   Y+            +                   
Sbjct: 228 PFDLDAVGLELLVIDTRAPHRLVDGQYEARRRACENAARILGVGSLRDVGDLGAAVAALD 287

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E      +             + L    ++ +   M+     L     V+  +L   V 
Sbjct: 288 DEELASRVRHVVTENDRVTQFVKLLDTGRVREVGPLMDASHNSLRDDYEVTCPELDTAVD 347

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI---DIVPITP 316
             R+    + ++++G G G C IAL   D+ +     V       G    +   +TP
Sbjct: 348 AARD-AGALGARMTGGGFGGCAIALVDRDVRNEVATQVVSSFREAGFAHPEFYVVTP 403


>gi|116617993|ref|YP_818364.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116096840|gb|ABJ61991.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 394

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 125/362 (34%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      +I        + R D L+ + S+     G +   +   
Sbjct: 26  SPGRINLIGEHTDYNGGHVFPASITLGTYGVASQRADSLVKLYSTNFPDEGVISFDVNDE 85

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A+         GF+L +   + +  GL SS+++ + I      
Sbjct: 86  EKLPGSSWGNFVKGVLQALRGYGNRFEHGFELVINGNIPNGSGLSSSSSLELLIGVVAQK 145

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K P    + +   A    V   +  +D  A   G                ++   +
Sbjct: 146 LYDLKIPRLQLVASGQRAENDFVGVNTGIMDQFAIGFGEADQAIYLDTNTMIYEMVPIHL 205

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y +  ++      L  S Y     +  + +  ++   P   + E++ K +        
Sbjct: 206 GDYVVVIMNTNKRRELADSKYNERVRETQEAVYQLQKYTPIQYLGELDAKTFNKYADKLE 265

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
                          + ++I+ +AL++ +L    + MN     L+    V+  +L  +V 
Sbjct: 266 SNILVKRARHAVYENERTKIAVEALKSNDLASFGKLMNESHQSLKDDYAVTGIELDTLVE 325

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDIVPITPSHSTS 321
             +    ++ ++++G+G G C IAL   D       +V     +  G D      +    
Sbjct: 326 TAQTVDGVLGARMTGAGFGGCAIALVHQDNVDDLKAAVGAKYESVVGYDPSFYVANVGDG 385

Query: 322 LY 323
            +
Sbjct: 386 AH 387


>gi|148828006|ref|YP_001292759.1| galactokinase [Haemophilus influenzae PittGG]
 gi|166216974|sp|A5UHX0|GAL1_HAEIG RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|148719248|gb|ABR00376.1| galactokinase [Haemophilus influenzae PittGG]
          Length = 384

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFDVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|260581636|ref|ZP_05849433.1| galactokinase [Haemophilus influenzae NT127]
 gi|260095229|gb|EEW79120.1| galactokinase [Haemophilus influenzae NT127]
          Length = 397

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 28  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 87

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 88  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 147

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 148 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRNL 206

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 207 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 266

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 267 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 326

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 327 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 377


>gi|296242058|ref|YP_003649545.1| mevalonate kinase [Thermosphaera aggregans DSM 11486]
 gi|296094642|gb|ADG90593.1| mevalonate kinase [Thermosphaera aggregans DSM 11486]
          Length = 307

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 75/313 (23%), Positives = 140/313 (44%), Gaps = 15/313 (4%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
           C  APG +VL GEH V+ G  A+ FA++K   + +    D  +NI S         D  +
Sbjct: 3   CSKAPGKIVLFGEHFVVKGAPAIGFAVSKYAKVCVE---DGSLNIISKQTGRV-EQDSLL 58

Query: 69  FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP 128
           +      I    +  + S    + + S++    G+GSSAA++VA+  A LT     +   
Sbjct: 59  YRAVKRLITKVNSIFECSEDVKILIDSEIPIGSGMGSSAALSVALAHAYLTHCNV-DFDK 117

Query: 129 DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP 188
             +   A+    +V    SGID   +  GG + Y+   +   ++     ++ +       
Sbjct: 118 KLVNEIAYEAEKEVHSKPSGIDNTLATFGGFLKYRSGVFEKLEVRLGEEVYFLVVNTNLR 177

Query: 189 TA--QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
               ++++++  +  +YP   EI + +Y     L + + ++L  ++ + + + M    GL
Sbjct: 178 RQTGKIVEEVLKLYEKYP---EILENVYNAASALVEKALKSLEERDYESIGRLMLLNHGL 234

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L T+GVS      IV KL  +   + +K+SG+G G  VI L K  L       +   +  
Sbjct: 235 LWTIGVSHEVNDLIVHKLVAK-GCLGAKLSGAGKGGIVIGLVKESL----VDKIEGELRN 289

Query: 307 KGIDIVPITPSHS 319
           +G ++  +TP + 
Sbjct: 290 EGFEVFRVTPDYE 302


>gi|270290479|ref|ZP_06196704.1| galactokinase [Pediococcus acidilactici 7_4]
 gi|304384637|ref|ZP_07366983.1| galactokinase [Pediococcus acidilactici DSM 20284]
 gi|270281260|gb|EFA27093.1| galactokinase [Pediococcus acidilactici 7_4]
 gi|304328831|gb|EFL96051.1| galactokinase [Pediococcus acidilactici DSM 20284]
          Length = 387

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/358 (17%), Positives = 127/358 (35%), Gaps = 53/358 (14%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-- 62
             ++  S PG + L+GEH   +G      AI          R D  + + S+     G  
Sbjct: 18  PERVFFS-PGRINLIGEHTDYNGGHVFPCAITIGTYGVYAPRTDSTVRMYSANIPDSGVV 76

Query: 63  -----SLDLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
                +L+        ++    +N +     K   GFDL V   +    GL SSA+I + 
Sbjct: 77  TFDVNNLEYDKAAGWTNYPKGMMNELVKTGAKFDHGFDLYVHGNMPDGAGLSSSASIEL- 135

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG-------------- 158
           +T A+L   ++   S  +++           G++SGI    ++  G              
Sbjct: 136 LTGAILNTAFNLGVSQLDLVKIGQKCENNYVGVNSGIMDQFAVGMGKQEQAILLDTNTLD 195

Query: 159 --LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE----------YPEI 206
                 ++  + I  ++      L  S Y    ++  + +  ++ +            E 
Sbjct: 196 YSYAPVKLGNHVIVIMNTNKRRELADSKYNERRSECEEALRRLQTKLDINSLGDLTNDEF 255

Query: 207 NEI-----------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSD 254
           +E              +      + +  + +AL + +LK     +      L     V+ 
Sbjct: 256 DEAAYLINDETLIKRARHAVSENQRTIRAAKALADDDLKTFGDLVTASHVSLHFDYEVTG 315

Query: 255 SKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
            +L  +     +QP ++ ++++G+G G C IA+ + D      ++V      K G D 
Sbjct: 316 KELDTLAEAAWKQPGVLGARMTGAGFGGCGIAIVEKDQVEAFKENVGKIYRDKIGYDA 373


>gi|326792041|ref|YP_004309862.1| galactokinase [Clostridium lentocellum DSM 5427]
 gi|326542805|gb|ADZ84664.1| galactokinase [Clostridium lentocellum DSM 5427]
          Length = 387

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 115/345 (33%), Gaps = 52/345 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      AI++    +++ R+D L    S   +  G        L
Sbjct: 24  APGRVNLIGEHIDYNGGLVFPCAISQGTYAFVSKREDNLFQAYSMNFESLGLVSFSLDDL 83

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++I   +  ++      +CG +L V+  L +  GL SSA++ V +      
Sbjct: 84  SFNPKHEWCNYIKGVLETLQEQNHEITCGLNLVVLGTLPNGSGLSSSASLEVLMCKLCSD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L           L   +     +   S  +D  A   G                 I  ++
Sbjct: 144 LYELNLDPVQMALIGKYVENHYIGVNSGIMDQFAIALGEKNKALLLDCALQKYQYIPLEL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--------------------- 203
             Y +  ++      L  S Y    A+  + ++ ++  Y                     
Sbjct: 204 DGYKLIIMNTNKRRELADSKYNERFAECQEALAILKKHYTIEHLCDLPSQELDHIKGYLQ 263

Query: 204 -PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              + +  + +     ++       L +KNLK   + +      L+    V+   L  +V
Sbjct: 264 NDTLYKRVKHVITENERVITAHK-VLFDKNLKTFGELLTASHVSLKDDYCVTGKALDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
                    + ++++G+G G C I+L   +      + V      
Sbjct: 323 E-AALNAGAIGARMTGAGFGGCAISLVPEEKIDSFIEQVGKQYQE 366


>gi|328946032|gb|EGG40178.1| galactokinase [Streptococcus sanguinis SK1087]
          Length = 392

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 124/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LQDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L+   + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLEKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D+     ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDVVEFFKENVGRKYQE 371


>gi|149246950|ref|XP_001527900.1| hypothetical protein LELG_00420 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146447854|gb|EDK42242.1| hypothetical protein LELG_00420 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 439

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 79/380 (20%), Positives = 134/380 (35%), Gaps = 72/380 (18%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLI 51
           K  VSAPG +++ GEH  ++G  A+  A++ R  L +T                  D   
Sbjct: 10  KFVVSAPGKVIIFGEHAAVYGKPAIAAALSLRCFLLVTPSTGDSNMVRLKFPDIGLDHSW 69

Query: 52  NIDS------------------------------SLGQYCGSLDLAMFH-PSFSFIIMAI 80
           +I S                              SL     +LD  + +   F F+ +  
Sbjct: 70  DISSIPWETIKAKVKADSNGKPQPPAELDPEIVDSLSPLLRNLDDNVHYIACFCFLYLYT 129

Query: 81  NHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSP----------- 128
           N       G+   V S L    GLGSSA+  V ++AAL  L    +              
Sbjct: 130 NLCSQDLQGYTFVVRSTLPIGAGLGSSASTAVCLSAALSKLGNWIKDPKLSNHDHVLESE 189

Query: 129 ----DEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI-------DFIFP 177
               D I   +        G  SGID A + HGG + YQ    S +              
Sbjct: 190 IPELDFIDNWSLIGEKCFHGNPSGIDNAVATHGGAVKYQRILNSTKSSLRSSIRDFPPIK 249

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVL- 236
           + L  +     TA+++  +  +  E+P+I          + + +       +    +   
Sbjct: 250 LLLTNTKVPKSTAKLVAGVGELTKEFPDITNPILNAVEFISEQAYEVMHLPQFGKQETAT 309

Query: 237 -AQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSL 295
             + +N   GLL  LGVS   L   V  + ++ ++ A+K++G+G G C I L    ++  
Sbjct: 310 LRKLVNMNHGLLVALGVSHPALET-VKIISDKYNLGATKLTGAGGGGCAITLVDESIDKS 368

Query: 296 PYQSVNCHMHAKGIDIVPIT 315
              +       +G +    +
Sbjct: 369 VIHNAMKEYENEGFESFETS 388


>gi|225680902|gb|EEH19186.1| mevalonate kinase [Paracoccidioides brasiliensis Pb03]
          Length = 490

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 85/383 (22%), Positives = 139/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLIN 52
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T                  D   N
Sbjct: 42  FMVSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSQRTITLNFRDIELDHTWN 101

Query: 53  IDS-------------SLGQYCGSLD---LAMFHPSFS--------------------FI 76
           IDS                    SLD   L    P  +                    F+
Sbjct: 102 IDSLPWALFCQPSKKKFYYDSVTSLDPELLEAIQPHIADISIGKPDEVRKIHRSSATAFL 161

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+I V ++AALL     L    +  P   
Sbjct: 162 YLFLSLSSPDSHAAIYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQPPEE 221

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 222 AEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 281

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+      +P + E     I+Q   +    +         N++
Sbjct: 282 LLLVNSRQPRSTATEVAKVGRFCKAHPAVAESTLAAIDQVTESANNFIQSGRFDKDSNED 341

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L + + 
Sbjct: 342 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHAGIGWTKLTGAGGGGCAIVLLRANT 400

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           N      +  ++  +G +    T
Sbjct: 401 NQAVLHHLEQNLDDEGFERYETT 423


>gi|145628285|ref|ZP_01784086.1| galactokinase [Haemophilus influenzae 22.1-21]
 gi|145638379|ref|ZP_01793989.1| galactokinase [Haemophilus influenzae PittII]
 gi|144980060|gb|EDJ89719.1| galactokinase [Haemophilus influenzae 22.1-21]
 gi|145272708|gb|EDK12615.1| galactokinase [Haemophilus influenzae PittII]
 gi|309751519|gb|ADO81503.1| Galactokinase [Haemophilus influenzae R2866]
          Length = 384

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ +
Sbjct: 75  DEFSLNIEIPKSEHKWANYVRGVVKFIQEHYPDFQQGANLVISGNVPLSSGLSSSAALEI 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKSGGTRMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|46123069|ref|XP_386088.1| hypothetical protein FG05912.1 [Gibberella zeae PH-1]
          Length = 508

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 72/391 (18%), Positives = 136/391 (34%), Gaps = 77/391 (19%)

Query: 1   MGQCL-HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQ 59
           M   +     VSAPG +++ GEH V+HG AA+  AI+ R  L++T        +      
Sbjct: 53  MSSPMAPPFMVSAPGKVIVFGEHSVVHGKAAIAAAISLRSYLHVTTLSKSKRTVSLRFAD 112

Query: 60  Y-------CGSLDLAMFH-----------------PSFSFIIMAINHIKPSCGFDLK--- 92
                      L    F                     + I   I  + P+   +++   
Sbjct: 113 IGLVHTWNIEDLPWEAFQQPSKKKSYYSLVTELDPDLVAAIQPHIEVVSPNHPEEIRRVH 172

Query: 93  -------------------------VISQLDSQLGLGSSAAITVAITAA----------- 116
                                    + S +    GLGSSA+++V + +A           
Sbjct: 173 HSSVSAFLYLFLSLGSPSFPPCLYTLRSTIPIGAGLGSSASVSVCLASALLLQLRTLSGP 232

Query: 117 -LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
                        + I   A    + + G  SG+D   +  G  + +Q   YS       
Sbjct: 233 HPDQPADEARLQVERINRWAFVSEMCIHGNPSGVDNTVATQGKAVVFQRTDYSKPPNVRP 292

Query: 176 FPIHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQIS 224
                      + +     TA  + K++ ++  +P++     + +++   A    + + S
Sbjct: 293 LWDFPELPLLLVDTRQAKSTAHEVAKVAKLKQTHPKLVNSILDAMDKVTDAASELIEETS 352

Query: 225 CQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCV 284
                 ++L  + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C 
Sbjct: 353 FDNGSVEDLSKVGELMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCS 411

Query: 285 IALGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           I L + D+ +   Q +   +  +       T
Sbjct: 412 ITLLRPDVPAEKLQKLEERLETENYAKFETT 442


>gi|237741022|ref|ZP_04571503.1| galactokinase [Fusobacterium sp. 4_1_13]
 gi|229431066|gb|EEO41278.1| galactokinase [Fusobacterium sp. 4_1_13]
          Length = 390

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 115/346 (33%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D++  + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFENLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYDKKDDWANYPKGVVKTFLDRNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNILKYEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y    +   + +  +                       Y 
Sbjct: 204 KNMSIIIANTNKKRGLADSKYNERRSSCEEAVKILNKNGINIKYLGELTVAEFEKVKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++ + + L+  ++    + MN+    L     V+ S+L  +V
Sbjct: 264 TDKEQLKRATHAVTENERAKNAVEFLKKDDIAEFGRLMNKSHISLRDDYEVTGSELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|67078216|ref|YP_245836.1| galactokinase [Bacillus cereus E33L]
 gi|66970522|gb|AAY60498.1| galactokinase [Bacillus cereus E33L]
          Length = 389

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 60/359 (16%), Positives = 136/359 (37%), Gaps = 52/359 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      +I          R+D  + + S+  +  G +D      
Sbjct: 25  SPGRINLIGEHTDYNGGYVFPASITYGTYGVARRREDDRVLVYSTNFEKLGVIDFTVNEL 84

Query: 66  ----LAMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +++ +     K   GF+L V   + +  GL SSA++ + +   +L 
Sbjct: 85  NYDKNDNWANYVKGVLLTLKEAGHKIDFGFELLVEGTIPNGAGLSSSASLELLV-GVVLE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG----------GLICYQM---- 164
             ++ + +  E++     +  +  G++SG +D  A   G            + Y+M    
Sbjct: 144 HLFNLDVTRLELVKMGKKVENEFIGVNSGIMDQFAIGFGEEDKAILLDTNTLEYEMVPVI 203

Query: 165 -PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
              Y+I  ++      L  S Y    A+  + ++ ++ +       E+++  +       
Sbjct: 204 LNDYAIVIMNTNKRRELADSKYNERRAECEEALACLQTKLEIKAFGELSKAEFDANQILI 263

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + ++ + +AL   +L+   + +N     L     V+  +L  +V
Sbjct: 264 GDEILIKRAKHAVYENERTKKAKEALTANDLEEFGKLLNASHASLRDDYEVTGLELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHS 319
              ++Q  ++ ++++G+G G C IAL K +        V + ++   G   V       
Sbjct: 324 AAAQKQEGVLGARMTGAGFGGCAIALVKENEIHAFKNKVYDEYLKVIGYAPVFYVAHIG 382


>gi|293375315|ref|ZP_06621597.1| galactokinase [Turicibacter sanguinis PC909]
 gi|325842523|ref|ZP_08167694.1| galactokinase [Turicibacter sp. HGF1]
 gi|292646071|gb|EFF64099.1| galactokinase [Turicibacter sanguinis PC909]
 gi|325489567|gb|EGC91931.1| galactokinase [Turicibacter sp. HGF1]
          Length = 389

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/356 (17%), Positives = 125/356 (35%), Gaps = 51/356 (14%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
            K+  S PG + L+GEH   +G      AI       ++ R+D+ + + S   +  G ++
Sbjct: 20  TKMFFS-PGRVNLIGEHIDYNGGCVFPCAITYGTYAVVSEREDKKVRLYSGNFEERGMIE 78

Query: 66  LA-------MFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
                          +++   +        + + GFD  V   + +  GL SSA++ + +
Sbjct: 79  FELTNLAHTEDENWSAYVKGVMVQFLEAGYEIANGFDAYVFGTIPNGSGLSSSASLELLV 138

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------LICYQ 163
           +  L  L  +     D +  +  A    V      +D  A   G            + Y+
Sbjct: 139 SQILKELNGYDITMVDMVKLSQKAENEYVGVNCGIMDQFAIGMGKKDSAIKLNTNDLSYE 198

Query: 164 MP-----KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------- 202
                   +SI  ++      L  S Y     +    +  ++ +                
Sbjct: 199 YAEANLGNHSILIMNTNKKRELADSKYNERRGECEAALELLKTKVDINFLCDLSVAEFDN 258

Query: 203 -----YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSK 256
                  +I     K      +  +++  AL + +L+   + +N     L     V+ ++
Sbjct: 259 VSRVLNKDILYRRAKHAVTENERVKLAIDALGSGDLRRFGKLLNASHKSLRDDYEVTGTE 318

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDI 311
           L  IV     Q  ++ ++++G+G G C IAL K +      Q++      A G D 
Sbjct: 319 LDTIVELAWAQEGVLGARMTGAGFGGCAIALVKNETLETVKQAIAKGYKEAIGYDA 374


>gi|315633877|ref|ZP_07889166.1| galactokinase [Aggregatibacter segnis ATCC 33393]
 gi|315477127|gb|EFU67870.1| galactokinase [Aggregatibacter segnis ATCC 33393]
          Length = 458

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/347 (16%), Positives = 115/347 (33%), Gaps = 47/347 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           ++ V APG + ++GEH   +    +  AIN    +    R D + N+ ++         L
Sbjct: 94  ELTVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAIAGAKRNDHVWNVYAADLDLSDEFSL 153

Query: 67  AMFHP-----SFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAITVAITAA 116
               P       +++   +  I+  C     G DL +   +    GL SSAA+ VA    
Sbjct: 154 DKEIPQSEQKWANYVRGVVKFIQERCPDFKQGADLVISGNVPHSSGLSSSAALEVATGKF 213

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS------- 168
              L      S  +I         K  G + G +D   S  G      M           
Sbjct: 214 CQQL-GDLPLSHTDIALIGQKAENKFVGANCGNMDQLISALGQQDHLLMIDCRSLETQPT 272

Query: 169 -------IEKIDFIFPIHLIYSGYKTPTAQVLKKIS-------------YIEIEYPEINE 208
                  +  ++   P  L+   Y T   Q  +                  + +  E+  
Sbjct: 273 PVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCERAAEFFGVKALRDVSVAQFKEKEAELTA 332

Query: 209 INQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIV 261
           ++  +      +   +        AL++ +L  L + M +    +     ++  ++  +V
Sbjct: 333 LDPLVAKRARHVVTENQRVLDAVDALKHNDLTRLGELMGQSHDSMRDDFEITVPQIDYLV 392

Query: 262 WKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              +        ++++G G G C++AL   D      + V  +   +
Sbjct: 393 ELAQLVIGKQGGARMTGGGFGGCIVALAPHDKVEAVRKIVADNYEKQ 439


>gi|319775248|ref|YP_004137736.1| galactokinase [Haemophilus influenzae F3047]
 gi|319897687|ref|YP_004135884.1| galactokinase [Haemophilus influenzae F3031]
 gi|317433193|emb|CBY81567.1| galactokinase [Haemophilus influenzae F3031]
 gi|317449839|emb|CBY86048.1| galactokinase [Haemophilus influenzae F3047]
          Length = 384

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHIVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAIRKIIADNYEK 364


>gi|313891189|ref|ZP_07824808.1| galactokinase [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120552|gb|EFR43672.1| galactokinase [Streptococcus pseudoporcinus SPIN 20026]
          Length = 387

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 61/345 (17%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI          R D+     S      G       +L
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRADQTCRFYSENFSELGVIAVDLNNL 83

Query: 65  DLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    I ++K        GFDL V   + +  GL SSA++ + +     T
Sbjct: 84  AFDKKDNWTNYAKGVIKYLKAAGHRIDTGFDLYVKGTIPNGSGLSSSASLELLVGIVCET 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  + +  +++           G++SGI    +I  G                 +  +
Sbjct: 144 L-YELDLARLDLVKIGKETENNFIGVNSGIMDQFAIGMGADEKAIYLDTNTLDYALVPLE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +  Y I  ++      L  S Y    ++  K +  ++   P   + +++  ++       
Sbjct: 203 LGDYQIVIMNTTKRRELADSKYNQRRSECEKALEELQKGVPITSLGDLDDALFDQYAYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL+   L +  + MN     LE    V+  +L  +V
Sbjct: 263 KDGIRIKRARHAVSENQRTLKALEALQAGKLDIFGRLMNASHISLEHDYDVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IA+          ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIAIVDKKQVESFKKAVEERYQD 367


>gi|226292608|gb|EEH48028.1| mevalonate kinase [Paracoccidioides brasiliensis Pb18]
          Length = 490

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 85/383 (22%), Positives = 139/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLIN 52
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T                  D   N
Sbjct: 42  FMVSAPGKVIVFGEHAVVHGKRAMAAAISLRSYLLVTTLSKSQRTITLNFRDIELDHTWN 101

Query: 53  IDS-------------SLGQYCGSLD---LAMFHPSFS--------------------FI 76
           IDS                    SLD   L    P  +                    F+
Sbjct: 102 IDSLPWALFCQPSKKKFYYDSVTSLDPELLEAIQPHIADISIGKPDEVRKIHRSSATAFL 161

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+I V ++AALL     L    +  P   
Sbjct: 162 YLFLSLSSPDSHAAIYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQPPEE 221

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
                  I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 222 AEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 281

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+      +P + E     I+Q   +    +         N++
Sbjct: 282 LLLVNSRQPRSTATEVAKVGRFCKAHPAVAESTLAAIDQVTESANNFIQSGRFDKDSNED 341

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L + + 
Sbjct: 342 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHAGIGWTKLTGAGGGGCAIVLLRANT 400

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           N      +  ++  +G +    T
Sbjct: 401 NQAVLHHLEQNLDDEGFERYETT 423


>gi|146317945|ref|YP_001197657.1| mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|146320132|ref|YP_001199843.1| mevalonate kinase [Streptococcus suis 98HAH33]
 gi|145688751|gb|ABP89257.1| Mevalonate kinase [Streptococcus suis 05ZYH33]
 gi|145690938|gb|ABP91443.1| Mevalonate kinase [Streptococcus suis 98HAH33]
 gi|292557729|gb|ADE30730.1| Mevalonate kinase [Streptococcus suis GZ1]
          Length = 317

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 71/316 (22%), Positives = 141/316 (44%), Gaps = 12/316 (3%)

Query: 3   QCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG 62
           + +  +   A G ++LMGEH V++GH A+    +   I+     +   + +     +   
Sbjct: 5   KSMS-VVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLV 63

Query: 63  SLDLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                ++      I  ++  I         +++ S + ++ G+GSSAA+ VA+  AL   
Sbjct: 64  HKMPKIWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY 123

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
            Y KE +  E+     +      G  SGID AA+  G    + +    IE  +     HL
Sbjct: 124 -YEKELTDSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAHL 181

Query: 181 I--YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
           +   +G    T + +  ++ +  + PE  ++ +++    G L++ + + L     ++L  
Sbjct: 182 VVADTGVTGNTLEAISDVADLLEKKPEAIKLVEEL----GNLTRQAKEDLATDQAELLGS 237

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ 298
            MN+   LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +   ++    
Sbjct: 238 RMNQAHALLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALARTAQDAQKLA 296

Query: 299 SVNCHMHAKGIDIVPI 314
            +     A+   I  +
Sbjct: 297 HILDQAGARQTWIQYL 312


>gi|257452032|ref|ZP_05617331.1| galactokinase [Fusobacterium sp. 3_1_5R]
 gi|257466168|ref|ZP_05630479.1| galactokinase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 399

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/347 (16%), Positives = 117/347 (33%), Gaps = 52/347 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      A++      L  RKD+L  + S+  +  G  ++     
Sbjct: 32  SPGRVNLIGEHTDYNGGYVFPCALSFGTYAVLKRRKDKLCRMYSNNFKELGIFEISLENI 91

Query: 67  -----AMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I     +  +   GFD+     + +  GL SSA+I + +   +  
Sbjct: 92  IYDEKDAWTNYPKGVIKMFQELGVNTSFGFDILFEGNIPNGAGLSSSASIELLMAEIVRD 151

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
           L Y  E     ++            ++ G +D  A   G                 +   
Sbjct: 152 L-YQVEMDRVAMVKLCQKSENVFNKVNCGIMDQFAIGMGKKDHAILLDCNSLEYHYVPVV 210

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
           +   SI   +      L  S Y    A     ++ ++ E                     
Sbjct: 211 LEDASIVIANTNKKRGLADSKYNERRASCEAAVADLQKEGCKIQYLGELSLQEFEEKKSL 270

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
              E  +   K      + ++I+ + L   ++    + MN     L     V+  +L  +
Sbjct: 271 ILGEEKQKRAKHAVAENERTKIAVEKLNQNDICAFGKLMNDSHISLRDDYEVTGFELDSL 330

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V    E+   + S+++G+G G C +++ K +      ++V      K
Sbjct: 331 VEAAWEEEGCLGSRMTGAGFGGCTVSIVKNEAVEHFIENVGKKYQEK 377


>gi|238788744|ref|ZP_04632535.1| Galactokinase [Yersinia frederiksenii ATCC 33641]
 gi|238723049|gb|EEQ14698.1| Galactokinase [Yersinia frederiksenii ATCC 33641]
          Length = 383

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 64/344 (18%), Positives = 116/344 (33%), Gaps = 45/344 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGS 63
           +I + APG + L+GEH   +    L  AI+   ++    R DR I +   D    Q   S
Sbjct: 20  EITIKAPGRVNLIGEHTDYNDGFVLPCAIDYETVISCGKRDDRQIRVIAADYENQQDIFS 79

Query: 64  LDLAM----FHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITA 115
           LD  +     +    ++   + H++       G DL +   +    GL SSA++ VA+  
Sbjct: 80  LDAPIVPHPEYRWADYVRGVVKHLQLRHADFGGADLVISGNVPQGAGLSSSASLEVAVGQ 139

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS--- 168
           AL +L Y    S  E+         +  G + GI           G  +           
Sbjct: 140 ALQSL-YQLPLSGVELALNGQEAENQFVGCNCGIMDQLISALGEQGHALLIDCRTLETRA 198

Query: 169 --------IEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYP 204
                   +  I+      L+ S Y T   Q                       I+ E  
Sbjct: 199 VPMPDNVAVVIINSNVKRGLVDSEYNTRRQQCETAARFFGVKALRDVDPNLFFSIQDELD 258

Query: 205 EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
            +     +      + +  +  AL   +LK++ Q M+     +     ++   +  +V  
Sbjct: 259 PVVAKRARHVITENERTLAAADALARGDLKLMGQLMHESHISMRDDFEITVPPIDHLVDI 318

Query: 264 LREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           ++         +++G G G C++AL    L      +V      
Sbjct: 319 VKSVIGEQGGVRMTGGGFGGCIVALMPTSLVEQVRAAVAREYPK 362


>gi|293571389|ref|ZP_06682419.1| galactokinase [Enterococcus faecium E980]
 gi|291608528|gb|EFF37820.1| galactokinase [Enterococcus faecium E980]
          Length = 395

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 126/363 (34%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMVLKLKEAGHPIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y+I  ++      L  S Y    ++  + ++ ++   P   + +++++ +        
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLIRRARHAVYENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQAGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|291461078|ref|ZP_06026798.2| galactokinase [Fusobacterium periodonticum ATCC 33693]
 gi|291379089|gb|EFE86607.1| galactokinase [Fusobacterium periodonticum ATCC 33693]
          Length = 392

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/346 (14%), Positives = 113/346 (32%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D    + S   +  G+++      
Sbjct: 28  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDNTFRMYSKNFKNLGTIEFNLDNL 87

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++        K   GFD+     + +  GL SSA+I V     L  
Sbjct: 88  VYNKKDNWANYPKGVVKTFLDKAYKIDSGFDVLFYGNIPNGAGLSSSASIEVLTAVILKD 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 148 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDHAILLDCNTLKFEYVPVKL 207

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--------------------IEYP 204
              SI   +      L  S Y    +   + +  +                       + 
Sbjct: 208 KNMSIVIANTNKKRGLADSKYNERRSSCEEAVKILNDNGVNIKYLGELTVAEFDKVKHFI 267

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++++ + L+  ++    + MN+    L     V+  +L  ++
Sbjct: 268 TDEEQLKRATHAVSENERAKVAVEFLKKDDIAEFGKLMNQSHISLRDDYEVTGIELDSLI 327

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + +      ++V      K
Sbjct: 328 EAAWEEEGTVGSRMTGAGFGGCTVSIVENEHVENFIKNVEKKYKEK 373


>gi|317047379|ref|YP_004115027.1| galactokinase [Pantoea sp. At-9b]
 gi|316948996|gb|ADU68471.1| galactokinase [Pantoea sp. At-9b]
          Length = 382

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 55/340 (16%), Positives = 117/340 (34%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSLDLAM 68
           APG + L+GEH   +    L  AI+ + ++    R DR +    +D    Q   SLD  +
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAKRDDRQVRVVAVDYDNQQDSFSLDAPI 84

Query: 69  FHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                    +++   + H++       G D+ +   +    GL SSA++ VA+      L
Sbjct: 85  EPLSEPMWANYVRGVVKHLQKRDASFGGVDMVISGNVPQGAGLSSSASLEVAVGTVFQQL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDFIF 176
            Y        I         +  G + G +D   S  G     +       S   +    
Sbjct: 145 -YQLPLDGAAIAVNGQEAENQFVGCNCGIMDQLISALGKQDHAMLLDCRSLSTRAVPMPA 203

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIE---------YPEINE----------------INQ 211
            + ++          V  + +    +          P + +                + +
Sbjct: 204 DVAVVIINSNFRRTLVGSEYNTRREQCETGARFFNKPALRDVTLAEFTAAEAQLDPLVAK 263

Query: 212 KIYALM--GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
           ++  ++     +  +  AL   +L ++ + M      +     ++   + ++V  ++ + 
Sbjct: 264 RVRHVITENARTLEAADALSAGDLTLMGKLMAESHASMRDDFEITVPPIDQLVEIVKAEI 323

Query: 269 H-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G C++AL   DL      +V     AK
Sbjct: 324 GPRGGVRMTGGGFGGCIVALMPTDLVDQVQAAVAEQYEAK 363


>gi|229829466|ref|ZP_04455535.1| hypothetical protein GCWU000342_01556 [Shuttleworthia satelles DSM
           14600]
 gi|229791897|gb|EEP28011.1| hypothetical protein GCWU000342_01556 [Shuttleworthia satelles DSM
           14600]
          Length = 405

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 63/365 (17%), Positives = 124/365 (33%), Gaps = 52/365 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      A+          R+D  I   S   +    ++  +   
Sbjct: 36  SPGRVNLIGEHTDYNGGHVFPCALTIGTYGIARKREDSKIRFYSLNMEDRPPMEADLSDL 95

Query: 69  -------FHPSFSFIIMAINHIK---PSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                  +      ++ A+  +K   P  GFD+ V   + +  GL SSA++ V     + 
Sbjct: 96  SYREEYGWANYPLGVVWAMKKVKGLTPGTGFDMAVYGNIPNGSGLSSSASLEVLTGVIVR 155

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICY 162
            L      +  ++            G + G +D  A   G                    
Sbjct: 156 DLFGFDSLTNIDLALVGQYSENNFNGCNCGIMDQFAVAMGKKDAAIFLDCSDLSYEYAPI 215

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM--- 217
            +P   I   +      L+ S Y     +  + +S +++E     + E++Q+ +      
Sbjct: 216 ALPDAKILITNSKVKHSLVDSAYNDRREECARALSMLQVELDIEALGELSQEEFEEHADL 275

Query: 218 ----------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
                            + +  + +AL++  +++  Q MN     L     VS  ++  +
Sbjct: 276 IWDPVCRRRAKHAVYENQRTIRAVEALKSGQIEMFGQLMNASHISLRDDYEVSCREVDIL 335

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSHS 319
           V +  + P ++ S+I+G G G C ++L K D        V        GI+         
Sbjct: 336 VDEAWKIPGVIGSRITGGGFGGCTVSLVKNDAIDPFIDWVGSAYREKTGIEAEFYAVEIG 395

Query: 320 TSLYR 324
               R
Sbjct: 396 DGAGR 400


>gi|315917326|ref|ZP_07913566.1| galactokinase [Fusobacterium gonidiaformans ATCC 25563]
 gi|317058580|ref|ZP_07923065.1| galactokinase [Fusobacterium sp. 3_1_5R]
 gi|313684256|gb|EFS21091.1| galactokinase [Fusobacterium sp. 3_1_5R]
 gi|313691201|gb|EFS28036.1| galactokinase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 396

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/347 (16%), Positives = 117/347 (33%), Gaps = 52/347 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      A++      L  RKD+L  + S+  +  G  ++     
Sbjct: 29  SPGRVNLIGEHTDYNGGYVFPCALSFGTYAVLKRRKDKLCRMYSNNFKELGIFEISLENI 88

Query: 67  -----AMFHPSFSFIIMAINHIKPSC--GFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I     +  +   GFD+     + +  GL SSA+I + +   +  
Sbjct: 89  IYDEKDAWTNYPKGVIKMFQELGVNTSFGFDILFEGNIPNGAGLSSSASIELLMAEIVRD 148

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
           L Y  E     ++            ++ G +D  A   G                 +   
Sbjct: 149 L-YQVEMDRVAMVKLCQKSENVFNKVNCGIMDQFAIGMGKKDHAILLDCNSLEYHYVPVV 207

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------- 202
           +   SI   +      L  S Y    A     ++ ++ E                     
Sbjct: 208 LEDASIVIANTNKKRGLADSKYNERRASCEAAVADLQKEGCKIQYLGELSLQEFEEKKSL 267

Query: 203 -YPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
              E  +   K      + ++I+ + L   ++    + MN     L     V+  +L  +
Sbjct: 268 ILGEEKQKRAKHAVAENERTKIAVEKLNQNDICAFGKLMNDSHISLRDDYEVTGFELDSL 327

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V    E+   + S+++G+G G C +++ K +      ++V      K
Sbjct: 328 VEAAWEEEGCLGSRMTGAGFGGCTVSIVKNEAVEHFIENVGKKYQEK 374


>gi|315045368|ref|XP_003172059.1| mevalonate kinase [Arthroderma gypseum CBS 118893]
 gi|311342445|gb|EFR01648.1| mevalonate kinase [Arthroderma gypseum CBS 118893]
          Length = 519

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/382 (19%), Positives = 134/382 (35%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 74  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 133

Query: 66  LAMF------HPSFS-------------------------------------------FI 76
           +         HPS                                             F+
Sbjct: 134 IDSLPWEVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEIRKIHQASANQFL 193

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 194 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 253

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 254 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQMK 313

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              I S     TA  + K++ ++  +P + E     I     +    ++        +  
Sbjct: 314 LLLINSRQPRSTAVEVAKVATLKKAHPLVTESVLDSIEHATESAYSLIASDEFDEHCSDK 373

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +  L Q      GLL +LGVS  +L   + +L +  +I  +K++G+G G C I L K + 
Sbjct: 374 IDHLGQLFRINHGLLVSLGVSHPRLER-IRELVDHANIGWTKLTGAGGGGCTITLLKANW 432

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           N    + +   +  +G D    
Sbjct: 433 NEEAIEHLEEQLDDEGYDRYET 454


>gi|253751169|ref|YP_003024310.1| mevalonate kinase [Streptococcus suis SC84]
 gi|253753070|ref|YP_003026210.1| mevalonate kinase [Streptococcus suis P1/7]
 gi|253754892|ref|YP_003028032.1| mevalonate kinase [Streptococcus suis BM407]
 gi|251815458|emb|CAZ51036.1| mevalonate kinase [Streptococcus suis SC84]
 gi|251817356|emb|CAZ55092.1| mevalonate kinase [Streptococcus suis BM407]
 gi|251819315|emb|CAR44664.1| mevalonate kinase [Streptococcus suis P1/7]
 gi|319757438|gb|ADV69380.1| mevalonate kinase [Streptococcus suis JS14]
          Length = 311

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 71/311 (22%), Positives = 139/311 (44%), Gaps = 11/311 (3%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +   A G ++LMGEH V++GH A+    +   I+     +   + +     +        
Sbjct: 3   VVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPK 62

Query: 68  MFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
           ++      I  ++  I         +++ S + ++ G+GSSAA+ VA+  AL    Y KE
Sbjct: 63  IWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YEKE 121

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI--YS 183
            +  E+     +      G  SGID AA+  G    + +    IE  +     HL+   +
Sbjct: 122 LTDSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAHLVVADT 180

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
           G    T + +  ++ +  + PE  ++ +++    G L++ + + L     ++L   MN+ 
Sbjct: 181 GVTGNTLEAISDVADLLEKKPEAIKLVEEL----GNLTRQAKEDLATDQAELLGSRMNQA 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
             LL+ LGVSD  L ++V  L ++   + +K++G G G C+IAL +   ++     +   
Sbjct: 237 HALLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMIALARTAQDAQKLAHILDQ 295

Query: 304 MHAKGIDIVPI 314
             A+   I  +
Sbjct: 296 AGARQTWIQYL 306


>gi|227432178|ref|ZP_03914177.1| galactokinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352061|gb|EEJ42288.1| galactokinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 396

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 57/362 (15%), Positives = 125/362 (34%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      +I        + R D L+ + S+     G +   +   
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPASITLGTYGVASQRADSLVKLYSTNFPDEGVISFDVNDE 87

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A+         GF+L +   + +  GL SS+++ + I      
Sbjct: 88  EKLPGSSWGNFVKGVLQALRGYGNHFEHGFELVINGNIPNGSGLSSSSSLELLIGVVAQK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K P    + +   A    V   +  +D  A   G                ++   +
Sbjct: 148 LYDLKIPRLQLVASGQRAENDFVGVNTGIMDQFAIGFGEADQAIYLDTNTMIYEMVPIHL 207

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y +  ++      L  S Y     +  + +  ++   P   + E++ K +        
Sbjct: 208 GDYVVVIMNTNKRRELADSKYNERVRETQEAVYQLQKYTPVQYLGELDAKTFNKYADKLE 267

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
                          + ++++ +AL++ +L    + MN     L+    V+  +L  +V 
Sbjct: 268 SNILVKRARHAVYENERTRVAVEALKSNDLASFGKLMNESHQSLKDDYAVTGIELDTLVE 327

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDIVPITPSHSTS 321
             +    ++ ++++G+G G C IAL   D       +V     +  G D      +    
Sbjct: 328 TAQTVDGVLGARMTGAGFGGCAIALVHQDNVDDLKAAVGAKYESVVGYDPSFYVANVGDG 387

Query: 322 LY 323
            +
Sbjct: 388 AH 389


>gi|227494752|ref|ZP_03925068.1| galactokinase [Actinomyces coleocanis DSM 15436]
 gi|226831752|gb|EEH64135.1| galactokinase [Actinomyces coleocanis DSM 15436]
          Length = 406

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 67/374 (17%), Positives = 122/374 (32%), Gaps = 65/374 (17%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM-- 68
           SAPG + ++GEH   +G  AL  A+  R  + ++ R DRL+ + S+       ++L    
Sbjct: 33  SAPGRVNVIGEHTDYNGGYALPLALPHRTYVAVSKRDDRLVRLISAQESGVREVNLDEVD 92

Query: 69  ----------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                     +      +  A+      P  G D+ V S +    GL SSAA+  A+ AA
Sbjct: 93  TFDSQNPVAGWPAYVVGVAWALEKAGYGPFPGIDIAVDSSVPFGAGLSSSAALECAVAAA 152

Query: 117 LLTL----QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS 168
             TL        +    E++        ++ G  +G    A+      G +I       S
Sbjct: 153 WDTLTETGLLATDEGRAELVKACVKAENQIAGAPTGGMDQAASLRCQEGHVILLDCRDQS 212

Query: 169 IEKIDFI--------------FPIHLIYSGYKTPTAQVLKKISYI--------------- 199
           ++ + F                P  L+   Y        +    +               
Sbjct: 213 VKHLPFDLAKAGLELLVVDTRAPHALVDGQYAARRQACEEAAQALGVSLLVELSADTYQE 272

Query: 200 ---EIEYPEINEINQKIYALMGKLSQISCQALRNKN------LKVLAQAMNRQQGLLE-T 249
                   E+++   +        +    + L           + L Q MN     L   
Sbjct: 273 LPGWASLSEVHQARVRHVVSEIARTAEFAELLHKGEESGEFAWERLGQLMNESHDSLRFD 332

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
             V+  +L  +V   R     + ++++G G G   IAL   +       ++     A G 
Sbjct: 333 YEVTCPELDLMVETARA-NGALGARMTGGGFGGSAIALVSSEDGVKISAAIAEAFAAAGF 391

Query: 310 ---DIVPITPSHST 320
                + ++PS   
Sbjct: 392 NEPHFLQVSPSAPA 405


>gi|228477636|ref|ZP_04062265.1| galactokinase [Streptococcus salivarius SK126]
 gi|228250525|gb|EEK09736.1| galactokinase [Streptococcus salivarius SK126]
          Length = 388

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+++   S   +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGVARKRDDKVLRFFSGNFEDKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L Y  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-YDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECETAVSELQKKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL + +L+   + +N     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALESGDLEGFGRLLNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|238793910|ref|ZP_04637530.1| Galactokinase [Yersinia intermedia ATCC 29909]
 gi|238726813|gb|EEQ18347.1| Galactokinase [Yersinia intermedia ATCC 29909]
          Length = 383

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 65/344 (18%), Positives = 118/344 (34%), Gaps = 45/344 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSL 64
           I + APG + L+GEH   +    L  AI+   ++    R DR I +   D    Q   SL
Sbjct: 21  ITIKAPGRVNLIGEHTDYNDGFVLPCAIDYETVISCGKRDDRQIRVIAADYENQQDIFSL 80

Query: 65  DLAM----FHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAA 116
           D  +     +    ++   + H++       G DL +   +    GL SSA++ VA+  A
Sbjct: 81  DAPIVPHAEYRWADYVRGVVKHLQLRHADFGGADLVISGNVPQGAGLSSSASLEVAVGQA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS---- 168
           L +L Y    S  ++         +  G + G +D   S  G     +            
Sbjct: 141 LQSL-YQLPLSGVDLALNGQEAENQFVGCNCGIMDQLISALGKQDHALLIDCRTLETRAV 199

Query: 169 -------IEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYPE 205
                  +  I+      L+ S Y T   Q                       I+ E   
Sbjct: 200 AMPANVAVVIINSNVKRGLVDSEYNTRRQQCETAARFFGVKALRDVDPTLFFSIQDELDP 259

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     +      + +  +  AL + +LK++ Q M      +     ++   +  +V  +
Sbjct: 260 VVAKRARHVITENERTLAAADALASGDLKLMGQLMQESHISMRDDFEITVPPIDSLVDIV 319

Query: 265 REQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +         +++G G G C++AL    L      +V     A 
Sbjct: 320 KSVIGEQGGVRMTGGGFGGCIVALMPTSLVEQVRAAVAQEYPAH 363


>gi|294781830|ref|ZP_06747162.1| galactokinase [Fusobacterium sp. 1_1_41FAA]
 gi|294481641|gb|EFG29410.1| galactokinase [Fusobacterium sp. 1_1_41FAA]
          Length = 388

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 117/346 (33%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH- 70
           +PG + L+GEH   +G      A++      +  R+D++  + S   +  G+++  + + 
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFKNLGTIEFNLDNL 83

Query: 71  ------PSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                    ++    +        K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYNKRDNWVNYPKGVVKTFLDENYKIDSGFDVLFYGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDHAILLDCNTLKFEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--------------------IEYP 204
              SI   +      L  S Y    +   + +  +                       + 
Sbjct: 204 KNMSIVIANTNKKRGLADSKYNERRSSCEEAVKVLNNNGINIKYLGELTVAEFDKVKHFI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++++ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVSENERAKVAVEFLKKDDIAEFGRLMNQSHISLRDDYEVTGIELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEEGTIGSRMTGAGFGGCTVSIVENDYVENFIENVGKKYKEK 369


>gi|170781017|ref|YP_001709349.1| galactokinase [Clavibacter michiganensis subsp. sepedonicus]
 gi|169155585|emb|CAQ00702.1| galactokinase [Clavibacter michiganensis subsp. sepedonicus]
          Length = 386

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/361 (16%), Positives = 118/361 (32%), Gaps = 52/361 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS------- 63
           S+PG + L+GEH   +      FAI++R ++ L  R D  I + SS              
Sbjct: 25  SSPGRVNLIGEHTDYNEGFVFPFAIDRRTVIALAPRDDDRIRLASSFSDEVVEARLADLT 84

Query: 64  -LDLAMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
              +  +      +  A+           GFD+ + S +    GL SSAA+  +I  AL 
Sbjct: 85  GERIDGWQAYPLGVAWALGQRGADLAAVPGFDVFIDSDVPVGAGLSSSAALEGSIALALD 144

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDF 174
            + +        +         ++ G  +G +D +AS+ G     +         E I  
Sbjct: 145 DI-WRLGLDRPTLAAVGQLAENEIVGAPTGIMDQSASLLGRQDAGVFLDCRSLDAEVIPL 203

Query: 175 --------------IFPIHLIYSGYKTPTAQVLKKISYI--------------EIEYPEI 206
                                  GY+       K    +                     
Sbjct: 204 GLEAAGLTIAVIDTHVAHAHADGGYRARRESCEKGARLLGVSSLRDVAVDDLVRAREVLD 263

Query: 207 NEINQKIYA--LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
           +E  +++       +    + +ALR +  + + + ++     +     +S  +L   V  
Sbjct: 264 DETFRRVRHIVTENQRVLDTVRALREEGPRAIGELLDASHRSMRDDFEISVPELDLAVEV 323

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI---DIVPITPSHST 320
             +    + ++++G G G   IAL   D  S    +++      G     +  +TPS   
Sbjct: 324 A-QNEGAIGARMTGGGFGGSAIALIDADSLSRLQVAIDGAFAEHGYTGPTVFTVTPSDGA 382

Query: 321 S 321
            
Sbjct: 383 K 383


>gi|332366519|gb|EGJ44265.1| galactokinase [Streptococcus sanguinis SK1059]
          Length = 392

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 60/345 (17%), Positives = 123/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++ + + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVPLENL 87

Query: 72  SF----------SFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +     K   G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHKIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSITTLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  NL+   + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGNLEKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVGKDAVESFKENVGRKYQE 371


>gi|293552722|ref|ZP_06673387.1| galactokinase [Enterococcus faecium E1039]
 gi|291603146|gb|EFF33333.1| galactokinase [Enterococcus faecium E1039]
          Length = 395

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 125/363 (34%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMVLKLKEAGHSIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ----------- 211
             Y+I  ++      L  S Y    ++  + ++ ++   P   + ++++           
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 212 --------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                   +      + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLIRRARHAVSENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|223934110|ref|ZP_03626056.1| galactokinase [Streptococcus suis 89/1591]
 gi|302023385|ref|ZP_07248596.1| galactokinase [Streptococcus suis 05HAS68]
 gi|330832195|ref|YP_004401020.1| galactokinase [Streptococcus suis ST3]
 gi|223897219|gb|EEF63634.1| galactokinase [Streptococcus suis 89/1591]
 gi|329306418|gb|AEB80834.1| galactokinase [Streptococcus suis ST3]
          Length = 390

 Score =  166 bits (420), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 56/350 (16%), Positives = 119/350 (34%), Gaps = 50/350 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI          R D+L+   S+  +  G +++ + + 
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQLLRFYSANFEELGIIEVDLNNL 83

Query: 72  SF-------SFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F       ++    +  ++        G ++ V   + +  GL SSA++ + I      
Sbjct: 84  VFDKADNWTNYAKGVLKFLQEAGHAIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   +    D +          +   S  +D  A   G                L+   +
Sbjct: 144 LYGLELTRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADNRAIYLDTNTLEYDLVPLDL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM----- 217
             + I  ++      L  S Y    A+  K +  +        + E+++  +        
Sbjct: 204 GDHVIVIMNTNKRRELADSKYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIK 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + +AL   +L    + +N     LE    V+  +L  +  
Sbjct: 264 DENRIKRARHAVLENQRTLQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAH 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDI 311
              EQ  ++ ++++G+G G C IA+   D      ++V        G + 
Sbjct: 324 TAWEQEGVLGARMTGAGFGGCGIAIVHKDKVEAFTENVGKTYTEVVGYEP 373


>gi|256027582|ref|ZP_05441416.1| galactokinase [Fusobacterium sp. D11]
 gi|289765541|ref|ZP_06524919.1| galactokinase [Fusobacterium sp. D11]
 gi|289717096|gb|EFD81108.1| galactokinase [Fusobacterium sp. D11]
          Length = 390

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 115/346 (33%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D++  + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVIKKREDKIFRMYSKNFENLGVIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++      + K  CGFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYEKKDDWANYPKGVVKTFLDRNYKIDCGFDILFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKFEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y        + +  +                       Y 
Sbjct: 204 MNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNKNGINIKYLGELTVAEFEKVKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              +  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEDQLKRATHAVTENERAKIAVEFLKKDDIAEFGRLMNKSHVSLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|312863724|ref|ZP_07723962.1| galactokinase [Streptococcus vestibularis F0396]
 gi|311101260|gb|EFQ59465.1| galactokinase [Streptococcus vestibularis F0396]
          Length = 388

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+++   S   +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKVLRFFSGNFEEKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ +   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYIYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-FDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVLVIMNTNKRRELADSKYNERRAECETAVSELQEKLDIQTLGELDLWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HIAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|53830048|gb|AAU94932.1| GalK [Leuconostoc mesenteroides]
          Length = 404

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 125/362 (34%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      +I        + R D L+ + S+     G +   +   
Sbjct: 36  SPGRINLIGEHTDYNGGHVFPASITLGTYGVASQRADSLVKLYSTNFPDEGVISFDVNDE 95

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A+         GF+L +   + +  GL SS+++ + I      
Sbjct: 96  EKLPGSSWGNFVKGVLQALRGYGNRFEHGFELVINGNIPNGSGLSSSSSLELLIGVVAQK 155

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K P    + +   A    V   +  +D  A   G                ++   +
Sbjct: 156 LYDLKIPRLQLVASGQRAENDFVGVNTGIMDQFAIGFGEADQAIYLDTNTMIYEMVPIHL 215

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y +  ++      L  S Y     +  + +  ++   P   + E++ K +        
Sbjct: 216 GDYVVVIMNTNKRRELADSKYNERVRETQEAVYQLQKYTPIQYLGELDAKTFNKYADKLE 275

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
                          + ++I+ +AL++ +L    + MN     L+    V+  +L  +V 
Sbjct: 276 SNILVKRARHAVYENERTKIAVEALKSNDLASFGKLMNESHQSLKDDYAVTGIELDTLVE 335

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDIVPITPSHSTS 321
             +    ++ ++++G+G G C IAL   D       +V     +  G D      +    
Sbjct: 336 TAQTVDGVLGARMTGAGFGGCAIALVHQDNVDDLKAAVGAKYESVVGYDPSFYVANVGDG 395

Query: 322 LY 323
            +
Sbjct: 396 AH 397


>gi|297623096|ref|YP_003704530.1| galactokinase [Truepera radiovictrix DSM 17093]
 gi|297164276|gb|ADI13987.1| galactokinase [Truepera radiovictrix DSM 17093]
          Length = 388

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 56/346 (16%), Positives = 108/346 (31%), Gaps = 42/346 (12%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS 63
              ++ V APG + L+GEH   +    L  A+ +   L L  R D  + + S       S
Sbjct: 21  APPEVLVRAPGRVNLIGEHTDYNDGFVLPMALERAAWLALRARPDDTVTVRSLELGDEVS 80

Query: 64  LDLAM------FHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
             L+       +         A+        GF+  + S +    GL SSAA+ +A   A
Sbjct: 81  FRLSALERGEGWAEYLKGSAWALQEDGFHLRGFEGVLRSDVPLGAGLSSSAALELATMRA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI---HGGLICYQMPKYSIEKID 173
              +                     V   +  +D   S     G  +         E + 
Sbjct: 141 FAEVSGFPWEPKRMARLAQRTENAWVGAQTGIMDQLISACGEAGRALLIDCRSLETEAVA 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEI--------------------------- 206
                 ++     T    V    +    +  E                            
Sbjct: 201 LPAGTAVVIMDTATRHKHVESGYNDRRRQCEEAAAFFGVRALRDVSLADFRAREEALAAA 260

Query: 207 --NEINQKIYA--LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             +E+ ++          +  +  A+R  +   L + M+     ++    +S S+L  +V
Sbjct: 261 CGDEVRRRARHVVSENARTLAAAAAMRAGDAPALGRLMDESHASMQGDFEISSSELDLMV 320

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              R+QP  + ++++G G   C +AL +         +V+    A+
Sbjct: 321 SLARQQPGCLGARMTGGGFAGCAVALVREADAPALVAAVSQRYAAE 366


>gi|291486412|dbj|BAI87487.1| galactokinase [Bacillus subtilis subsp. natto BEST195]
          Length = 390

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/345 (17%), Positives = 112/345 (32%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----SLD-- 65
           APG + L+GEH   +G      A+       +  RKD L+ + S   +  G    SLD  
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTMGTYAAVAERKDGLVRMYSDNFRNAGIKECSLDDI 83

Query: 66  ----LAMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I            GFD+     + +  GL SSA+I + +   L  
Sbjct: 84  RYQKEDDWANYPKGVIYEFQQRGYAVPHGFDIVFSGNIPNGAGLSSSASIELLMGVVLQN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC----------YQMPKYSI 169
             + +  + + +    HA    +      +D  A   G              Y+  K ++
Sbjct: 144 YFHPEVDALELVKMAQHAENHFIGVNCGIMDQFAIGMGKKHHAMLLNCDTLDYEYSKLNV 203

Query: 170 EKIDF-----IFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
             +            L  S Y T   +    +  ++                        
Sbjct: 204 SGLALVIANTNKKRTLADSSYNTRRQECNDALLDLKKGLDITALGDIKPSDFDAHSSLIQ 263

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E N    K        +  +    +  N+  + Q M      L+    V+  +L E+V+
Sbjct: 264 NETNRRRAKHAVYENHRAIKTAHMFKENNIDEIGQLMKESHLSLKDDYEVTCPELDELVF 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              +   ++ S+++G+G G C I++ K +      Q V      K
Sbjct: 324 AAWDHEGVIGSRMTGAGFGGCTISIVKDEFVDDFIQKVGDRYQEK 368


>gi|117620488|ref|YP_858529.1| galactokinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|166216969|sp|A0KQH8|GAL1_AERHH RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|114439882|gb|ABI74762.1| GalK [Aeromonas hydrophila]
 gi|117561895|gb|ABK38843.1| galactokinase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 382

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/341 (17%), Positives = 113/341 (33%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDL 66
           V APG + L+GEH   +    L  AI+    + + LR D L+++   D    +    LD 
Sbjct: 23  VRAPGRVNLIGEHTDYNDGFVLPCAIDYETCVAIGLRDDSLVHVIAADYGNQRDLFDLDQ 82

Query: 67  AMFHP----SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
            + H        +I   + +++    P  G +L V   +    GL SSA++ VAI  A  
Sbjct: 83  PIGHHADQRWSDYIRGVVKYLQERGYPLRGLNLVVSGNVPQGAGLSSSASLEVAIGQAFK 142

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL--------------ICYQM 164
                     +  L    A    V      +D   S  G                +    
Sbjct: 143 EALGLAITQAEIALNGQQAENQFVGCNCGIMDQMISASGKQDHALLLDCRSLETRLIPMP 202

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYI----------------EIEYPEINE 208
              ++  ++      L+ S Y T   Q      +                 +    E+  
Sbjct: 203 TDLAVLIVNSNVRRGLVDSEYNTRRQQCEAAARHYGVKALRDLDLAALEAGKAGLDEVCY 262

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +        +  +  AL   +L  L + M      +     ++   +  +V  ++ +
Sbjct: 263 RRARHVVGDNSRTLAAADALAQGDLVRLGELMADSHAAMRDDFEITVPAIDGLVEIIKAR 322

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL   D  +    +V+    A+
Sbjct: 323 IGTEGGVRMTGGGFGGCVVALLHPDKVAEVIAAVDAEYPAR 363


>gi|167761378|ref|ZP_02433505.1| hypothetical protein CLOSCI_03786 [Clostridium scindens ATCC 35704]
 gi|167661044|gb|EDS05174.1| hypothetical protein CLOSCI_03786 [Clostridium scindens ATCC 35704]
          Length = 393

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 64/361 (17%), Positives = 121/361 (33%), Gaps = 51/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           APG + L+GEH   +G      A+       +  R+DR +   S   +  G ++      
Sbjct: 29  APGRVNLIGEHTDYNGGHVFPCALTLGTYGIVRDREDRKLRFYSMNFESLGIIETSLDDL 88

Query: 67  -----AMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A      K + G D+ +   + S  GL SSA++ V     L  
Sbjct: 89  VPDEAANWTNYPKGVMWAFEKRGYKLAHGMDILIYGNIPSGSGLSSSASLEVLTGLMLKD 148

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKY-------- 167
               +  +  E+            G + G +D  AS  G     I               
Sbjct: 149 TFGFENLTMVEVALIGQDAENNFNGCNCGIMDQFASAMGKKDHAIFLDTNTLNYEYAPVI 208

Query: 168 ----SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
                I   +      L+ S Y     +    +  ++ E P   + E+ Q+ + L     
Sbjct: 209 LKDAKIVITNSKVKHSLVDSAYNDRRNECETALKELQAELPIHSLGELTQEEFELHKEAI 268

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIV 261
                           + +  + +ALR  ++++  + MN     L E   VS  ++  +V
Sbjct: 269 KDPVRQRRAKHAVYENQRTIRAVEALRENDVELFGRLMNESHQSLKEDYQVSCREIDILV 328

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
              +  P ++ S+I+G G G C +++ + D        +      K G +          
Sbjct: 329 DMAQAMPGVLGSRITGGGFGGCTVSIVRNDAVDGFISQIGKTYQEKVGHEAEFYVVDIGD 388

Query: 321 S 321
            
Sbjct: 389 G 389


>gi|323351729|ref|ZP_08087383.1| galactokinase [Streptococcus sanguinis VMC66]
 gi|322122215|gb|EFX93941.1| galactokinase [Streptococcus sanguinis VMC66]
          Length = 392

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEMSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  GI+SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGINSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKQSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|302501690|ref|XP_003012837.1| hypothetical protein ARB_01088 [Arthroderma benhamiae CBS 112371]
 gi|291176397|gb|EFE32197.1| hypothetical protein ARB_01088 [Arthroderma benhamiae CBS 112371]
          Length = 518

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 73/382 (19%), Positives = 133/382 (34%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 73  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 132

Query: 66  LAMF-------------------------------------------------HPSFSFI 76
           +                                                    H +  F+
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 252

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 253 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQMK 312

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              I S     TA  + K++ ++  +P + E     I+    +    ++        ++ 
Sbjct: 313 LLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLIASDDFDEHCSEK 372

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +  L +      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L K   
Sbjct: 373 IDHLGELFRINHGLLVSLGVSHPRLER-IRELVDHADIGWTKLTGAGGGGCTITLFKAKW 431

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           N    + +   +  +G D    
Sbjct: 432 NEEAIEHLEEQLDDEGYDRYET 453


>gi|157150283|ref|YP_001450223.1| galactokinase [Streptococcus gordonii str. Challis substr. CH1]
 gi|157075077|gb|ABV09760.1| galactokinase [Streptococcus gordonii str. Challis substr. CH1]
          Length = 392

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 59/345 (17%), Positives = 121/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++ + + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVPLENL 87

Query: 72  SF----------SFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHKIYRGMDVYVYGNIPNGSGLSSSASLELLTGIIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  I+ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGILGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|297529687|ref|YP_003670962.1| galactokinase [Geobacillus sp. C56-T3]
 gi|297252939|gb|ADI26385.1| galactokinase [Geobacillus sp. C56-T3]
          Length = 394

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 57/370 (15%), Positives = 115/370 (31%), Gaps = 52/370 (14%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           +G+ +      APG + L+GEH   +G   L  A+       +    +  + + S     
Sbjct: 16  LGEGIRTFF--APGRVNLIGEHTDYNGGHVLPCALEIGTYALVRQTDEPFVRLYSQNFPE 73

Query: 61  CGSL----------DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAI 109
            G +              +      I+ A   + P   G D+     + +  GL SSA+I
Sbjct: 74  TGVITVSYDDLSYRSEHGWANYPKGILAAFQALSPLETGLDILYYGTIPNGAGLSSSASI 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
            +     L  L + +     E++  +  +  K  G++ GI    ++  G           
Sbjct: 134 ELVTAVMLNEL-FRRGLDQLELVKMSQTVENKYVGVNCGIMDQFAVGMGKQDCAILLNCQ 192

Query: 160 -ICYQM-----PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--IEYPEINEINQ 211
            + Y+         SI   +      L  S Y    A     ++ ++       + E+  
Sbjct: 193 TLEYRYLPLVLNDCSIVIANTNKKRGLADSAYNERRATCEAALAKLQSVRNIASLGELTS 252

Query: 212 KIYALMGK------------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGV 252
              A                       +  + +AL   +L    + M +    L     V
Sbjct: 253 AELARYAHLLSPLEQKRARHAVTENERTLEAARALERGDLIRFGELMKQSHLSLRNDYEV 312

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
           +  +L  +V         + ++++G+G G C + + K        + V      K G + 
Sbjct: 313 TGVELDTLVEAAWSHEGTVGARMTGAGFGGCTVNIVKKACVQDFIERVGNAYAEKIGYEA 372

Query: 312 VPITPSHSTS 321
                     
Sbjct: 373 SFYVVEVGDG 382


>gi|237738926|ref|ZP_04569407.1| galactokinase [Fusobacterium sp. 2_1_31]
 gi|229424029|gb|EEO39076.1| galactokinase [Fusobacterium sp. 2_1_31]
          Length = 392

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 114/346 (32%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D+   + S   +  G+++      
Sbjct: 28  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKTFRMYSKNFKNLGTIEFNLDNL 87

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++        K   GFD+     + +  GL SSA+I V     L  
Sbjct: 88  VYNKKDNWANYPKGVVKTFLDRAYKIDSGFDVLFYGNIPNGAGLSSSASIEVLTAVILKD 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 148 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDHAILLDCNTLKFEYVPVKL 207

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--------------------IEYP 204
              SI   +      L  S Y    +   + +  +                       + 
Sbjct: 208 KNMSIVIANTNKKRGLADSKYNERRSSCEEAVKVLNDNGINIKYLGELTVAEFDKVKHFI 267

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++++ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 268 TDEEQLKRATHAVSENERAKVAVEFLKKDDIAEFGRLMNQSHISLRDDYEVTGVELDSLV 327

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 328 EAAWEEEGTVGSRMTGAGFGGCTVSIVENDHVENFIKNVGKKYKEK 373


>gi|18265738|gb|AAL67289.1|AF389474_2 galactokinase [Streptococcus salivarius]
          Length = 388

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 54/345 (15%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+++   S   +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKVLRFFSGNFEDKGIIEVPLENL 83

Query: 67  --AMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SS+++ + I      
Sbjct: 84  RFEKEHNWTNYPKGVLHFLQEAGHTIDSGMDIYVYGNIPNGSGLSSSSSLELLIGVIAEK 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++           G++SGI    +I  G                 +   
Sbjct: 144 L-FDLKLERLDLVKIGKQTENDFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +    +  ++      L  S Y    A+    +S ++ +                     
Sbjct: 203 LKDNVVVIMNTNKRRELADSKYNERRAECDTAVSELQEKLDIQTLGELELWTFDAYSYLI 262

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           +     ++        + +  + +AL   +L+   + MN     LE    V+  +L  + 
Sbjct: 263 KDENRIKRARHAVLENQRTLQARKALEAGDLEGFGRLMNASHVSLEHDYEVTGLELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 323 HTAWEQEGVLGARMTGAGFGGCAIALVNKDKVEDFKKAVGQRYEE 367


>gi|56420685|ref|YP_148003.1| galactokinase [Geobacillus kaustophilus HTA426]
 gi|56380527|dbj|BAD76435.1| galactokinase [Geobacillus kaustophilus HTA426]
          Length = 394

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 56/370 (15%), Positives = 114/370 (30%), Gaps = 52/370 (14%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           +G+ +      APG + L+GEH   +G   L  A+       +    +  + + S     
Sbjct: 16  LGEGIRTFF--APGRVNLIGEHTDYNGGHVLPCALEIGTYALVRQTDEPFVRLYSQNFPE 73

Query: 61  CGSL----------DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAI 109
            G +              +      I+ A   + P   G D+     + +  GL SSA+I
Sbjct: 74  TGVITVSYDDLSYRSEHGWANYPKGILAAFQALSPLETGLDILYYGTIPNGAGLSSSASI 133

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------- 159
            +     L  L + +     E++  +  +  +  G+  GI    ++  G           
Sbjct: 134 ELVTAVMLNEL-FRRGLDQLELVKMSQTVENEYVGVHCGIMDQFAVGMGKQDCAILLNCQ 192

Query: 160 -ICYQM-----PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--IEYPEINEINQ 211
            + Y+         SI   +      L  S Y    A     ++ ++       + E+  
Sbjct: 193 TLEYRYLPLVLNDCSIVIANTNKKRGLADSAYNERRATCEAALAKLQSVRNIASLGELTS 252

Query: 212 KIYALMGK------------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGV 252
              A                       +  + +AL   +L    + M +    L     V
Sbjct: 253 AELARYEHLLSPLEQKRARHAVTENERTLEAARALERGDLIRFGELMKQSHLSLRNDYEV 312

Query: 253 SDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
           +  +L  +V         + ++++G+G G C + + K        + V      K G + 
Sbjct: 313 TGVELDTLVEAAWSHEGTVGARMTGAGFGGCTVNIVKKACVQDFIERVGNAYAEKIGYEA 372

Query: 312 VPITPSHSTS 321
                     
Sbjct: 373 SFYVVEVGDG 382


>gi|325687947|gb|EGD29967.1| galactokinase [Streptococcus sanguinis SK72]
          Length = 392

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 58/345 (16%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G ++      
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEMSLENL 87

Query: 66  -LAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    ++ ++        G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNKRRAECEKAVEELNRKQSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+   L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGALDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|302662770|ref|XP_003023036.1| hypothetical protein TRV_02858 [Trichophyton verrucosum HKI 0517]
 gi|291187012|gb|EFE42418.1| hypothetical protein TRV_02858 [Trichophyton verrucosum HKI 0517]
          Length = 518

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 133/382 (34%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 73  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 132

Query: 66  LAMF-------------------------------------------------HPSFSFI 76
           +                                                    H +  F+
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 252

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 253 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQMK 312

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              I S     TA  + K++ ++  +P + E     I+    +    +S        ++ 
Sbjct: 313 LLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLISSDDFDEHCSEK 372

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +  L +      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L K   
Sbjct: 373 IDHLGELFRINHGLLVSLGVSHPRLER-IRELVDHADIGWTKLTGAGGGGCTITLFKAKW 431

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           N    + +   +  +G D    
Sbjct: 432 NEEAIEHLEEQLDDEGYDRYET 453


>gi|296331462|ref|ZP_06873934.1| galactokinase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305676449|ref|YP_003868121.1| galactokinase [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296151577|gb|EFG92454.1| galactokinase [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305414693|gb|ADM39812.1| galactokinase [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 390

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 62/346 (17%), Positives = 114/346 (32%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----SLD-- 65
           APG + L+GEH   +G      A+       +  R D ++ + S   +  G    SLD  
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTMGTYAAVAERNDGVVRMYSDNFKDVGIKECSLDDI 83

Query: 66  ----LAMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I        S   GFD+     + +  GL SSA+I + +   +L 
Sbjct: 84  RYQKEDDWANYPKGVIYEFQQRGYSVPHGFDIVFSGNIPNGAGLSSSASIEL-LMGVVLQ 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLIC---------------YQ 163
             +H E  P E++  A        G++ G +D  A   G                     
Sbjct: 143 SYFHPEVDPLELVKMAQHAENTFIGVNCGIMDQFAIGMGKKHHAMLLNCDTLDYEYSKLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------- 204
           +   ++   +      L  S Y T   +    +  ++                       
Sbjct: 203 VSGLALVIANTNKKRTLADSSYNTRRQECHDALLDLQKALDIASLGDIKPSDFDAHSSLI 262

Query: 205 --EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             E N    K        +  +    +  N+  + + M      L+    V+  +L E+V
Sbjct: 263 QNETNRRRAKHAVYENHRAIKTAHMFKENNIDEIGRLMKESHLSLKDDYEVTCPELDELV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +   +   ++ S+++G+G G C I++ K        Q V      K
Sbjct: 323 FAAWDHEGVIGSRMTGAGFGGCTISIVKDAFVDDFIQKVGDRYQEK 368


>gi|193671566|ref|XP_001950752.1| PREDICTED: galactokinase-like [Acyrthosiphon pisum]
          Length = 398

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 56/365 (15%), Positives = 111/365 (30%), Gaps = 57/365 (15%)

Query: 13  PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM---- 68
           PG + L+GEH   +    L  A+    I+           + ++   +  + D       
Sbjct: 37  PGRVNLIGEHTDYNDGFVLPMALPMVTIVLGRANNSDNCRVVTACNDFEETEDSNKTEFK 96

Query: 69  -------------FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
                        +      +I          GFD  ++S +    GL SSA++ VA  +
Sbjct: 97  IPSVKPLYVGTPKWANYVKGVIACFQ--SIIVGFDAVILSSVPLGGGLSSSASLEVATYS 154

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---GLICYQMPKYSIEK 171
            +  +  +K     +             G+  G +D   S+ G     +         E 
Sbjct: 155 FIEAITGNKTIQLVQKAKACQNAEHMFAGVPCGIMDQFISVMGIEGHALLIDCKSLQYEP 214

Query: 172 IDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPE------------------------IN 207
           +      ++          ++      +     E                          
Sbjct: 215 VPMTESNYVFLITNSNIHHELSSSQYQLRRYQCEEASDLLNVQSLRSATMEILNKVHLNG 274

Query: 208 EINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEI 260
           +IN+ IY     +             L+  + K   Q MN     L     VS  +L ++
Sbjct: 275 KINEIIYKRARHVITEIERTKTAADVLKRGDYKTFGQLMNASHNSLRDDFEVSCPELDQL 334

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI-DIVPITPSHS 319
           V   R+ P ++ S+++G G G C + L      +    +++     KG      ++PS  
Sbjct: 335 VELARKVPGVLGSRMTGGGFGGCTVTLVDRTAVNTVVSTISSEY--KGTPKFYTVSPSCG 392

Query: 320 TSLYR 324
             + +
Sbjct: 393 AKIVK 397


>gi|315425792|dbj|BAJ47446.1| mevalonate kinase [Candidatus Caldiarchaeum subterraneum]
          Length = 319

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 79/311 (25%), Positives = 150/311 (48%), Gaps = 13/311 (4%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCG 62
            ++ V APG ++L GEH V+ G+ A+V AI++ V +      D+ + +    ++     G
Sbjct: 3   KQVKVFAPGKVILFGEHFVVSGYPAIVTAIDRGVTVTAKKTDDKFVIVSKHSAAAWNATG 62

Query: 63  SLDLAM---FHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
               A      P ++ +         SC   +++ S L S  GLGSSAA++VA+  A ++
Sbjct: 63  ETITAKPSALAPLYNMVREMCLDHGVSCTGWVEIESDLISGGGLGSSAAVSVALAKA-VS 121

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM-PKYSIEKIDFIFPI 178
           L +  + S D+++  A     +  G  SGID   S  GG I Y+    Y+  ++     +
Sbjct: 122 LLHEIQLSKDQLINYALKAEKEFHGRPSGIDPTISTVGGTIAYRGLGNYTAIEVGKPLDL 181

Query: 179 HLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQ 238
            +++SG K  T++++  +        E  +I  ++  L   + +++ +AL   + + + +
Sbjct: 182 IIVFSGRKRKTSKMVDAVQRFAA---EKKDIFTELVKLYSHVYEMAKEALVEGDFQAVGR 238

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ 298
                  LL ++GVSD+ L EIV KLR +  +  +K++G+G G CVIA           +
Sbjct: 239 LFTLNHLLLRSVGVSDNVLEEIVRKLRNKD-VYGAKLTGAGGGGCVIA-VADGRAVEIAE 296

Query: 299 SVNCHMHAKGI 309
           ++     +  +
Sbjct: 297 AMARLYPSAWM 307


>gi|72125755|ref|XP_790690.1| PREDICTED: similar to Mevalonate kinase (MK) [Strongylocentrotus
           purpuratus]
 gi|115614665|ref|XP_001200159.1| PREDICTED: similar to Mevalonate kinase (MK) [Strongylocentrotus
           purpuratus]
          Length = 413

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 81/384 (21%), Positives = 139/384 (36%), Gaps = 67/384 (17%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
              I +SAPG ++L GEH V+HG  AL   +N R  L L  +    ++++        S 
Sbjct: 13  PVSIFISAPGKIILHGEHAVVHGKTALAAGLNLRSYLCLKEKDSGRLHLNLPDIDLERSW 72

Query: 65  DLAMFHPSFS-----------------------------------------FIIMAINHI 83
           D+      F                                          ++ + I   
Sbjct: 73  DVLELQEQFRDLLNSDVMEVKPSVEIMQRLRLFLGYSDTETTKRLAVMAFLYLYLCIAGR 132

Query: 84  KPSCGF-DLKVISQLDSQLGLGSSAAITVAITAALLTLQ-------------YHKEPSPD 129
                  D  V S L    GLGSSAA +V + A LLT                      +
Sbjct: 133 NGKFPILDTLVSSALPPGAGLGSSAAFSVCLAAGLLTWAKAIIPLSLSDNTLDWSREDME 192

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
            I T A+     + G  SGID + S+HGG I Y+    +  +      I L+ +     T
Sbjct: 193 LINTWAYEGERVIHGNPSGIDNSISVHGGAIEYRQKVITPLENMPELSILLVNTCVARST 252

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKN-------LKVLAQAMNR 242
            +++  +     +YP++          + +  + + QAL+           K L + ++ 
Sbjct: 253 KELVAGVQRRHDKYPKVYGPILDSIEEISQECKRTLQALKTGESLDKDGAFKSLGELVDI 312

Query: 243 QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC 302
            Q LL  +GVS   ++ IV       + + +K++G+G G CV AL   D+     +++  
Sbjct: 313 NQQLLYVIGVSHPAINNIVRSAA--AYKIHAKLTGAGGGGCVFALLPPDIPKDSVKALQA 370

Query: 303 HMHAKGI--DIVPITPSHSTSLYR 324
            +        I  +       ++R
Sbjct: 371 DLFRHNYESWITSLGAH-GVMMHR 393


>gi|69244856|ref|ZP_00603080.1| Galactokinase [Enterococcus faecium DO]
 gi|257879091|ref|ZP_05658744.1| galactokinase [Enterococcus faecium 1,230,933]
 gi|257882102|ref|ZP_05661755.1| galactokinase [Enterococcus faecium 1,231,502]
 gi|257883716|ref|ZP_05663369.1| galactokinase [Enterococcus faecium 1,231,501]
 gi|257889921|ref|ZP_05669574.1| galactokinase [Enterococcus faecium 1,231,410]
 gi|258615471|ref|ZP_05713241.1| galactokinase [Enterococcus faecium DO]
 gi|260562730|ref|ZP_05833225.1| galactokinase [Enterococcus faecium C68]
 gi|261208126|ref|ZP_05922801.1| galactokinase [Enterococcus faecium TC 6]
 gi|289566351|ref|ZP_06446780.1| galactokinase [Enterococcus faecium D344SRF]
 gi|293563559|ref|ZP_06678007.1| galactokinase [Enterococcus faecium E1162]
 gi|293567256|ref|ZP_06678611.1| galactokinase [Enterococcus faecium E1071]
 gi|294614583|ref|ZP_06694488.1| galactokinase [Enterococcus faecium E1636]
 gi|294617385|ref|ZP_06697021.1| galactokinase [Enterococcus faecium E1679]
 gi|294623543|ref|ZP_06702389.1| galactokinase [Enterococcus faecium U0317]
 gi|314947834|ref|ZP_07851241.1| galactokinase [Enterococcus faecium TX0082]
 gi|68196210|gb|EAN10640.1| Galactokinase [Enterococcus faecium DO]
 gi|257813319|gb|EEV42077.1| galactokinase [Enterococcus faecium 1,230,933]
 gi|257817760|gb|EEV45088.1| galactokinase [Enterococcus faecium 1,231,502]
 gi|257819554|gb|EEV46702.1| galactokinase [Enterococcus faecium 1,231,501]
 gi|257826281|gb|EEV52907.1| galactokinase [Enterococcus faecium 1,231,410]
 gi|260072889|gb|EEW61249.1| galactokinase [Enterococcus faecium C68]
 gi|260077710|gb|EEW65426.1| galactokinase [Enterococcus faecium TC 6]
 gi|289161860|gb|EFD09731.1| galactokinase [Enterococcus faecium D344SRF]
 gi|291590060|gb|EFF21853.1| galactokinase [Enterococcus faecium E1071]
 gi|291592564|gb|EFF24168.1| galactokinase [Enterococcus faecium E1636]
 gi|291596376|gb|EFF27633.1| galactokinase [Enterococcus faecium E1679]
 gi|291597025|gb|EFF28230.1| galactokinase [Enterococcus faecium U0317]
 gi|291604561|gb|EFF34047.1| galactokinase [Enterococcus faecium E1162]
 gi|313645814|gb|EFS10394.1| galactokinase [Enterococcus faecium TX0082]
          Length = 395

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 125/363 (34%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMVLKLKEAGHSIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ----------- 211
             Y+I  ++      L  S Y    ++  + ++ ++   P   + ++++           
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 212 --------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                   +      + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLIRRARHAVSENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|322696123|gb|EFY87920.1| mevalonate kinase [Metarhizium acridum CQMa 102]
          Length = 490

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/382 (19%), Positives = 141/382 (36%), Gaps = 75/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V++G  A+  AI+ R  L++T   +  R +++  +      + +
Sbjct: 44  FMVSAPGKVIVFGEHSVVYGKTAIAAAISLRSYLHVTTLSKSKRTVSLRFTDIDLVHTWN 103

Query: 66  LAMF------------------------------------------------HPSFSFII 77
           +                                                   + +F+F+ 
Sbjct: 104 IDELPWDTFQQPSKKKSYYSLVTELDPDLVAALGPHVDVSPDGPEDIRRVHRNGAFAFLY 163

Query: 78  MAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD--- 129
           + ++   PS    L  + S +    GLGSSA+I V ++AALL    TL       P    
Sbjct: 164 LFLSLGSPSFPGCLYTLRSTIPIGAGLGSSASIAVCVSAALLIQLRTLSGPHPDQPPEEA 223

Query: 130 -----EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL---- 180
                 I   A    + + G  SG+D   +  G  + +Q+  Y                 
Sbjct: 224 RLQIERINRWAFVYEMCIHGNPSGVDNTVATQGKAVVFQILDYDKPPSVKPLWDFPELPL 283

Query: 181 --IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQALRNKNL 233
             + +     TA  + K+  +   +P++     + +++   +    ++         ++L
Sbjct: 284 LLVDTKQPKSTAHEVAKVGKLNKMHPKLVASILDAMDKVASSAAELIADDDFDEEEERSL 343

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLN 293
             + + M    GLL +LGVS  +L   V +L +   I  +K++G+G G C I L + D+ 
Sbjct: 344 MKVGELMTINHGLLVSLGVSHPRLER-VRELVDHEGIGWTKLTGAGGGGCSITLLRPDVP 402

Query: 294 SLPYQSVNCHMHAKGIDIVPIT 315
                 +   +  +       T
Sbjct: 403 RAKLDKLEERLDRENYAKFEAT 424


>gi|332361413|gb|EGJ39217.1| galactokinase [Streptococcus sanguinis SK1056]
          Length = 392

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 120/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FALQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y     +  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRVECEKAVEELNRKLSIATLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|55377012|ref|YP_134862.1| mevalonate kinase [Haloarcula marismortui ATCC 43049]
 gi|55229737|gb|AAV45156.1| mevalonate kinase [Haloarcula marismortui ATCC 43049]
          Length = 327

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 71/331 (21%), Positives = 123/331 (37%), Gaps = 33/331 (9%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG---- 62
            +  SAPG + L GEH V++G  A+  AI +RV +  T   +  + I ++  Q  G    
Sbjct: 1   MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRVHVTATEIDEG-LRIHANDLQLDGFTVE 59

Query: 63  -----------SLDLAMFHPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSS 106
                       +  ++      ++  A+   +     P  GF++ V   +    GLGSS
Sbjct: 60  YSGDGESHPDVDVAESLVEAGMGYVNEAVAQARDAADAPEAGFEISVEGDIPLGAGLGSS 119

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           AA+ VA   A       +  + D              G +S  D   S  GG +  +   
Sbjct: 120 AALVVAAIDAATRELGVELSASDIADRAYQVEHAVQDGQASRADTFCSAMGGAVRVEGDD 179

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
               +     P  + Y G    T  ++  +  +  +Y    +    I    G + +    
Sbjct: 180 CRRLEGIDTLPFVIGYDGGAGDTGALVAGVRDLRGKYDFAADTVAAI----GDIVREGES 235

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
            L   + + L + M+   GLL  LGVS   L  +VW  R+      +K++G+G G C++A
Sbjct: 236 VLGTGDYERLGELMDFNHGLLSALGVSSRSLDSMVWAARD-ADAHGAKLTGAGGGGCIVA 294

Query: 287 LGKGDLNSLPY-------QSVNCHMHAKGID 310
           L + D                   +   G+ 
Sbjct: 295 LDETDDALTALKYTPGCEDVFRAELDTDGVR 325


>gi|16080871|ref|NP_391699.1| galactokinase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221311785|ref|ZP_03593632.1| galactokinase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221316111|ref|ZP_03597916.1| galactokinase [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221321023|ref|ZP_03602317.1| galactokinase [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221325307|ref|ZP_03606601.1| galactokinase [Bacillus subtilis subsp. subtilis str. SMY]
 gi|321313377|ref|YP_004205664.1| galactokinase [Bacillus subtilis BSn5]
 gi|729557|sp|P39574|GAL1_BACSU RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|413959|emb|CAA51591.1| ipa-35d galK [Bacillus subtilis subsp. subtilis str. 168]
 gi|2636355|emb|CAB15846.1| galactokinase [Bacillus subtilis subsp. subtilis str. 168]
 gi|320019651|gb|ADV94637.1| galactokinase [Bacillus subtilis BSn5]
          Length = 390

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 60/345 (17%), Positives = 112/345 (32%), Gaps = 49/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG----SLD-- 65
           APG + L+GEH   +G      A+       +  R D L+ + S   +  G    SLD  
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTMGTYAAVAERNDGLVRMYSDNFRNAGIKECSLDDI 83

Query: 66  ----LAMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I            GFD+     + +  GL SSA+I + +   L +
Sbjct: 84  RYQKEDDWANYPKGVIYEFQQRGYAVPHGFDIVFSGNIPNGAGLSSSASIELLMGVVLQS 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC----------YQMPKYSI 169
             + +  + + +    HA    +      +D  A   G              Y+  K ++
Sbjct: 144 YFHPEVDALELVKMAQHAENHFIGVNCGIMDQFAIGMGKKHHAMLLNCDTLDYEYSKLNV 203

Query: 170 EKIDF-----IFPIHLIYSGYKTPTAQVLKKISYIEIEYP-------------------- 204
             +            L  S Y T   +    +  ++                        
Sbjct: 204 SGLALVIANTNKKRTLADSSYNTRRQECNDALLDLKKGLDIAALGDIKPSDFDAHSSLIQ 263

Query: 205 -EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E N    K        +  +    +  N+  + Q M      L+    V+  +L E+V+
Sbjct: 264 NETNRRRAKHAVYENHRAIKTAHMFKENNIDEIGQLMKESHLSLKDDYEVTCPELDELVF 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              +   ++ S+++G+G G C I++ K +      Q V      K
Sbjct: 324 AAWDHEGVIGSRMTGAGFGGCTISIVKDEFVDDFIQKVGDRYQEK 368


>gi|223934071|ref|ZP_03626021.1| mevalonate kinase [Streptococcus suis 89/1591]
 gi|223897262|gb|EEF63673.1| mevalonate kinase [Streptococcus suis 89/1591]
          Length = 311

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 68/311 (21%), Positives = 138/311 (44%), Gaps = 11/311 (3%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           +   A G ++LMGEH V++G  A+    +   I+     +   + +     +        
Sbjct: 3   VVGKANGKIILMGEHAVVYGQPAIAMPFSAVEIIAQVTAQGEALTVACDFYKGLVHKMPK 62

Query: 68  MFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
           ++      I  ++  I         +++ S + ++ G+GSSAA+ VA+  AL    Y KE
Sbjct: 63  IWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGSSAAVAVAVARALFAY-YKKE 121

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLI--YS 183
            +  E+     +      G  SGID AA+  G    + +    IE  +     +L+   +
Sbjct: 122 LTDSELWDIVQSSEKIAHGNPSGID-AATTSGKSPVFFIKHQPIEPFELKLHAYLVVADT 180

Query: 184 GYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
           G    T + +  ++ +  + PE  ++ +++    G L++ + + L     ++L   MN+ 
Sbjct: 181 GVTGNTLEAISDVADLLEKKPEAIKLVEEL----GNLTRQAKEDLATGQAEILGSRMNQA 236

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
             LL+ LGVSD  L ++V  L ++   + +K++G G G C++AL +   ++     +   
Sbjct: 237 HALLQKLGVSDPSLDKLV-SLAQENGALGAKLTGGGRGGCMLALARTAQDAQKLAHILDQ 295

Query: 304 MHAKGIDIVPI 314
             A+   I  +
Sbjct: 296 AGARQTWIQYL 306


>gi|257897675|ref|ZP_05677328.1| galactokinase [Enterococcus faecium Com15]
 gi|257835587|gb|EEV60661.1| galactokinase [Enterococcus faecium Com15]
          Length = 395

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 126/363 (34%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMVLKLKEAGHPIDHGFELLVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
             Y+I  ++      L  S Y    ++  + ++ ++   P   + +++++ +        
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLIRRARHAVYENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|332976441|gb|EGK13289.1| galactokinase [Desmospora sp. 8437]
          Length = 396

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 57/343 (16%), Positives = 99/343 (28%), Gaps = 47/343 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH    G      A+       L  RKD +  + S+               
Sbjct: 25  APGRVNLIGEHTDYTGGYVFPAALTLGTWAALRPRKDGVFRLASTRFAERAEFRADEVRE 84

Query: 65  --DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
             +    +     I    +      G D+     L    GL SSA+I +    AL  L+ 
Sbjct: 85  RREEGWTNFPKGMIRELADSGAGLPGADILYHGDLPPGAGLSSSASIGLVTGVALAALED 144

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQMPKY 167
            +    D I     +    +      +D  AS  G                 +  ++  Y
Sbjct: 145 RRWRMLDLIQMVRRSENRYIGVQCGIMDPFASGMGKAGHAILLHCRRLDYRHVPLKLGDY 204

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALM---------- 217
            +  I       L  S Y     +  +    +    PE  ++                  
Sbjct: 205 RLMIIHTNKVRELAESRYNQRRRECEEGFRQLRQRLPEATDLGSVGEEAWLEAREAVESP 264

Query: 218 ------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVWKL 264
                             S QAL   +L    + M      L     V+  +L  +    
Sbjct: 265 LLRRRLAHVVTENARVLRSEQALVAGDLHRFGELMKESHRSLRENYEVTGRELDTLFEAA 324

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            + P  + ++++G+G G C + L   +      + V     A+
Sbjct: 325 IQVPGCIGARMTGAGFGGCTVNLVHREALETFRRRVGEQYIAE 367


>gi|314939314|ref|ZP_07846560.1| galactokinase [Enterococcus faecium TX0133a04]
 gi|314941284|ref|ZP_07848178.1| galactokinase [Enterococcus faecium TX0133C]
 gi|314950687|ref|ZP_07853765.1| galactokinase [Enterococcus faecium TX0133A]
 gi|314992052|ref|ZP_07857503.1| galactokinase [Enterococcus faecium TX0133B]
 gi|314995510|ref|ZP_07860608.1| galactokinase [Enterococcus faecium TX0133a01]
 gi|313590249|gb|EFR69094.1| galactokinase [Enterococcus faecium TX0133a01]
 gi|313593373|gb|EFR72218.1| galactokinase [Enterococcus faecium TX0133B]
 gi|313597109|gb|EFR75954.1| galactokinase [Enterococcus faecium TX0133A]
 gi|313599885|gb|EFR78728.1| galactokinase [Enterococcus faecium TX0133C]
 gi|313641405|gb|EFS05985.1| galactokinase [Enterococcus faecium TX0133a04]
          Length = 395

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 59/363 (16%), Positives = 125/363 (34%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      +I          R D  I + S+     G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPASITYGTQGVAAPRDDNKILVYSTNFDDIGVISFTLDEL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           +        +++   +  +K        GF+L V   + +  GL SSA++ + +   L  
Sbjct: 85  EYDKKANWANYVKGMVLKLKEAGHSIDHGFELIVEGTIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L   K    + + T        +   S  +D  A   G                ++  ++
Sbjct: 145 LFDLKTDRLELVQTGKKVENEFIGVNSGIMDQFAIGFGELDHAILLDTNTLKYEMVPVKL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ----------- 211
             Y+I  ++      L  S Y    ++  + ++ ++   P   + ++++           
Sbjct: 205 DGYAIVIMNTNKRRELADSKYNERRSECEEALARLQKTLPISSLGDLDEEEFESTIDQIG 264

Query: 212 --------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                   +      + +  +   L   NL+   Q +N     L     V+  +L  +V 
Sbjct: 265 DDTLIRRARHAVSENQRTLKAKAELEAGNLEAFGQLLNDSHHSLRYDYEVTGIELDTLVD 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++Q  ++ ++++G+G G C IAL K +       +V + +M   G             
Sbjct: 325 AAQKQEGVLGARMTGAGFGGCAIALVKEENIPAFKNNVYDEYMKVVGYAPEFYVAHIGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|116618171|ref|YP_818542.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116097018|gb|ABJ62169.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 396

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 55/362 (15%), Positives = 123/362 (33%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G   L  AI          R DR + + S      G +   +   
Sbjct: 27  SPGRINLIGEHTDYNGGHVLPAAITIGTYGAAKSRHDRFVKLYSKNFSNEGVITFDINDE 86

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ ++         GF+L ++  + +  GL SS+++ +     +  
Sbjct: 87  NHLQKGSWGNFVKGVLQSLRLYGNKFDHGFELAIVGNIPNGSGLSSSSSLELLAGIVVKK 146

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L   K P    + +   A    +   +  +D  A  +G                 +  +M
Sbjct: 147 LYDLKIPRLQLVASGQKAENDYIGVNTGIMDQFAIGYGEKNQAIYLDTNTMIYELVPVEM 206

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------Y 203
               +  ++      L  S Y     +  + +  ++ E                      
Sbjct: 207 RDNVVVIMNTNKKRELSDSKYNERVRETQEAVFDLQKELRINFLGEIDSKTFEKSKHLIN 266

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E+     K      + ++I+ + L++ ++    + +N     L+    V+  +L  +V 
Sbjct: 267 REVVARRAKHAVSENERTKIAVKLLKDNHMMEFGRLLNESHESLKTDYEVTGIELDTLVE 326

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
             ++ P ++ ++++G+G G C IAL      +   Q V      K G +           
Sbjct: 327 TAQKVPGVLGARMTGAGFGGCAIALVNKRNVAELKQIVGKAYKDKVGYEASFYVAEIGQG 386

Query: 322 LY 323
           ++
Sbjct: 387 VH 388


>gi|254302364|ref|ZP_04969722.1| galactokinase [Fusobacterium nucleatum subsp. polymorphum ATCC
           10953]
 gi|148322556|gb|EDK87806.1| galactokinase [Fusobacterium nucleatum subsp. polymorphum ATCC
           10953]
          Length = 388

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 115/346 (33%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D++  + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFENLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYEKKDDWANYPKGVVKTFLDRNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLNFEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y    +   + +  +                       Y 
Sbjct: 204 KNMSIVIANTNKKRGLADSKYNERRSSCEEAVKVLNKNGVNIKYLGELTVAEFEKVKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++++ + L+  ++    + M++    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKVAVEFLKKDDIAEFGRLMDKSHISLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|117928884|ref|YP_873435.1| galactokinase [Acidothermus cellulolyticus 11B]
 gi|117649347|gb|ABK53449.1| galactokinase [Acidothermus cellulolyticus 11B]
          Length = 400

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 66/365 (18%), Positives = 113/365 (30%), Gaps = 53/365 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS---------SLGQYC 61
           SAPG + L+GEH    G   L  AI++R  +    R D ++ I S          LG   
Sbjct: 36  SAPGRINLIGEHTDYTGGCVLPVAIDRRTYVAARPRPDGMLRIVSHAYAGQPPVFLGSAD 95

Query: 62  GSLDLAMFHPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
              + A      +++   +   +       GFD+ V S +    GL SSAA+  A+ AA+
Sbjct: 96  LHPESAAHQGWAAYVAGILWVFRNRTEIPDGFDIAVYSTVPIGAGLSSSAALECAVAAAV 155

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG----IDLAASIHGGLICYQMPKYSIEKID 173
             L     P P E+   A        G+  G    +          + + +     E I 
Sbjct: 156 ADLTATAVP-PSELARLAQYAENAYVGVPCGILDQMAACVCQAEHALFFDIGAGRYEHIP 214

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEY------------PEINEINQKIYA------ 215
           F    H +                                  P + +I            
Sbjct: 215 FAPESHGLVLLVADTGISHRHASGEYAKRRESCRQAEDILGVPRLGDIRAASLETVLAAL 274

Query: 216 -------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           +  + + + LR+  L  +   +      L     VS  +L   V
Sbjct: 275 PDETLRRRVRHVVTENERVRRTVELLRSGRLAEIGPLLLASHASLRDDYAVSTPELDAAV 334

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI--VPITPSHS 319
                    + ++++G G G  +IAL   D        +     ++G      P+ P  +
Sbjct: 335 E-AAISGGAIGARLTGGGFGGSIIALAPRDRVPQVVAQIQGAFTSRGWKPPAAPLIPRIA 393

Query: 320 TSLYR 324
             + R
Sbjct: 394 DGVRR 398


>gi|325689858|gb|EGD31862.1| galactokinase [Streptococcus sanguinis SK115]
          Length = 392

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 122/345 (35%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S   +  G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFEEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQ---------- 211
           +    +  ++      L  S Y    A+  K +  +  +     + E+++          
Sbjct: 207 LQDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWSFDEYSYLI 266

Query: 212 ---------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    +   L  + +  +  AL+  +L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENCLKRARHAVLENQRTLQARAALQAGDLDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      +++      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVGKDAVESFKENIGRKYQE 371


>gi|326482092|gb|EGE06102.1| mevalonate kinase [Trichophyton equinum CBS 127.97]
          Length = 518

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 73/382 (19%), Positives = 133/382 (34%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 73  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 132

Query: 66  LAMF-------------------------------------------------HPSFSFI 76
           +                                                    H +  F+
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 252

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 253 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQMK 312

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              I S     TA  + K++ ++  +P + E     I+    +    ++        ++ 
Sbjct: 313 LLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLIASDDFDEHCSEK 372

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +  L +      GLL +LGVS  +L   + +L +   I  +K++G+G G C I L K   
Sbjct: 373 IDHLGELFRINHGLLVSLGVSHPRLER-IRELVDHADIGWTKLTGAGGGGCTITLFKAKW 431

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           N    + +   +  +G D    
Sbjct: 432 NEEAIEHLEEQLDDEGYDRYET 453


>gi|127514199|ref|YP_001095396.1| galactokinase [Shewanella loihica PV-4]
 gi|126639494|gb|ABO25137.1| galactokinase [Shewanella loihica PV-4]
          Length = 388

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 65/340 (19%), Positives = 111/340 (32%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS----------LGQYC 61
           APG + L+GEH   +    L  AIN R ++ +  R D      S            GQ  
Sbjct: 26  APGRVNLIGEHTDYNDGFVLPAAINFRTVIAVKQRDDDKFRAVSDAFPGKIYTWHFGQEG 85

Query: 62  GSLDLAMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                  +         A++    P+ G DL V+  +    GL SSAA+ +A   AL   
Sbjct: 86  EMDPNDSWINYLKGFTAAVSASGLPAKGMDLAVVGSVPLGAGLSSSAALEIAFGTALNDC 145

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKIDFIF 176
                 SP  +   A     +  G + GI              +         E +    
Sbjct: 146 S-QLRLSPLAVAQMAQRGENQYVGCACGIMDQMISAMAQEEHALLIDCEDLDCEPVPIPE 204

Query: 177 -----------PIHLIYSGYKTPTAQVLKKISYI----------------EIEYPEINEI 209
                      P  L+ S Y     Q  +   +                 + E PE+   
Sbjct: 205 SLSLIIVNSNVPRGLVDSEYNLRREQCEQVAEHFGIESLRHLELRTLEGAKDELPEVCYR 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
             +      + +Q +  AL   N+  L++ M +    +     ++  ++ ++V  +    
Sbjct: 265 RARHVLSENRRTQNAAHALEAGNIAKLSELMAQSHQSMRDDFEITVPEIDKLVEIIDAVV 324

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G CV+AL   DL     ++V     A 
Sbjct: 325 GDRGGVRMTGGGFGGCVVALVDHDLTDAVVEAVERQYQAA 364


>gi|43565|emb|CAA46731.1| galactokinase [Haemophilus influenzae]
 gi|301169538|emb|CBW29139.1| galactokinase [Haemophilus influenzae 10810]
          Length = 384

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 58/351 (16%), Positives = 119/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +  T R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L  +   S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GNLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGTRMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|56964983|ref|YP_176714.1| galactokinase [Bacillus clausii KSM-K16]
 gi|56911226|dbj|BAD65753.1| galactokinase [Bacillus clausii KSM-K16]
          Length = 392

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/348 (15%), Positives = 103/348 (29%), Gaps = 48/348 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      A+     L +         + S       +        
Sbjct: 24  APGRVNLIGEHTDYNGGFVFPAALTMGTYLAVRRTNTNEFRLASQNFSQRVAFPNKELSY 83

Query: 66  --LAMFHPSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                +      +I    H      G DL     + +  GL SSA+I +     + +L  
Sbjct: 84  NKEDDWGNYPKGVIAYFQHHGFDLGGADLYFFGNIPNGAGLSSSASIEMVTAYMISSLTG 143

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQMPKY 167
                 D +    H     +   S  +D  A   G                 +   +  Y
Sbjct: 144 ANWDRLDLVKACQHVENNFIGVNSGIMDQFAVGMGKADHALFLQTDSLQYELVPLTLGNY 203

Query: 168 SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------- 211
            I   +      L  S Y    A+  + ++ ++    +I  ++                 
Sbjct: 204 DIVITNSNKRRGLADSKYNERRAECEQALADLQAAGLDIRTLSDVTPALLAKHHHAFSTA 263

Query: 212 ------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVWKL 264
                        +    +  AL+  NL+   Q MN     L     V+  +L  +    
Sbjct: 264 TVAKRASHVVSENQRVLEAVTALKAGNLRDFGQLMNESHQSLANDYEVTGLELDALYQLQ 323

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI 311
              P  + ++++G+G G C ++L + D        V     ++ G   
Sbjct: 324 HRAPGCIGTRMTGAGFGGCTVSLVQTDKMEAFQAHVKKGYESEFGFQP 371


>gi|260495344|ref|ZP_05815471.1| galactokinase [Fusobacterium sp. 3_1_33]
 gi|260197122|gb|EEW94642.1| galactokinase [Fusobacterium sp. 3_1_33]
          Length = 390

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 114/346 (32%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D++  + S   Q  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFQNLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYDKKDNWANYPKGVIKTFLDKNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKFEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y        + +  +                       + 
Sbjct: 204 MNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNKNGINIKYLGELTVAEFEKVKHFL 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGRLMNKSHISLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|156934753|ref|YP_001438669.1| galactokinase [Cronobacter sakazakii ATCC BAA-894]
 gi|166216972|sp|A7MIX5|GAL1_ENTS8 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|156533007|gb|ABU77833.1| hypothetical protein ESA_02588 [Cronobacter sakazakii ATCC BAA-894]
          Length = 382

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 59/358 (16%), Positives = 114/358 (31%), Gaps = 48/358 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDLAM 68
           APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD  +
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAKRDDRRVRVVAADYDNETDEFSLDEPI 84

Query: 69  FHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                    +++   + H++       G DL +   +    GL SSA++ VA+      L
Sbjct: 85  LTHDSQQWSNYVRGVVKHLQQRDPGFGGADLVISGNVPQGAGLSSSASLEVAVGTVFRHL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDFIF 176
            YH      +I         +  G + G +D   S  G     +         + +    
Sbjct: 145 -YHLSLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVPMPQ 203

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ------------------------- 211
            + ++          V  + +    +                                  
Sbjct: 204 GVAVVIINSNFKRTLVGSEYNTRREQCETGARFFTQKALRDVSLDQFNAVAHELDPIVAK 263

Query: 212 --KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
             +        +  +  AL   NL  + + M      +     ++  ++  +V  ++   
Sbjct: 264 RVRHVLTENARTVEAADALAKGNLTRMGELMAESHASMRDDFEITVPQIDTLVEIVKSVI 323

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTSL 322
                 +++G G G CV+AL    L      +V     A+ GI +   +  PS    L
Sbjct: 324 GDKGGVRMTGGGFGGCVVALVPEALVPEVQAAVEAQYEARTGIKETFYVCKPSEGAGL 381


>gi|270290280|ref|ZP_06196505.1| mevalonate kinase [Pediococcus acidilactici 7_4]
 gi|270281061|gb|EFA26894.1| mevalonate kinase [Pediococcus acidilactici 7_4]
          Length = 306

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 73/317 (23%), Positives = 133/317 (41%), Gaps = 18/317 (5%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGS 63
           + ++  ++   ++LMGEH V++   A+   I N +  + +       I I S        
Sbjct: 1   MKEVIKTSNAKIILMGEHSVVYNQPAIALPIRNVKTTVKIQSIPGD-IQIRSRYFNG--- 56

Query: 64  LDLAMFHPSFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
             L   H +   I   IN       KP  G  L + SQ+ ++ G+GSSA+  VAI  A+ 
Sbjct: 57  -FLNDIHSNLLGIKQLINQTLTTLGKPHYGLLLDIDSQIPAERGMGSSASTAVAIVRAMY 115

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFP 177
              + +  + +++L   +     + G  SG+D A +     I ++         I+F   
Sbjct: 116 AF-FDRPLTKNKLLKAVNISEKIIHGNPSGLDSATASADRPIWFKRDGTIKALPINFNGY 174

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           + +  SG K  T + +     I      I+  ++ +   +G+L+  +  AL++ +   L 
Sbjct: 175 LVISDSGIKGKTGEAV----DIVKNKLRIDNDSRLLIEKLGELTSQTATALKDNDSLALG 230

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
             MN  Q  L  LGVS   + +++     Q   + SK++G GLG CVI+L      +   
Sbjct: 231 DIMNNAQACLRQLGVSHPAVEKLIQ-AANQSGALGSKLTGGGLGGCVISLVSDAQAAENV 289

Query: 298 QSVNCHMHAKGIDIVPI 314
            +      A    I  +
Sbjct: 290 SAQLRKAGATATWIEKL 306


>gi|148976638|ref|ZP_01813325.1| galactokinase [Vibrionales bacterium SWAT-3]
 gi|145963989|gb|EDK29247.1| galactokinase [Vibrionales bacterium SWAT-3]
          Length = 386

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 61/342 (17%), Positives = 111/342 (32%), Gaps = 43/342 (12%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQYCGSLDL- 66
            V APG + L+GEH   +    L  AIN + ++    R D ++ + S          D+ 
Sbjct: 23  IVQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKRDDNMVRVVSVDYDNAVDEFDIT 82

Query: 67  --------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    M+       +   +       G D+ V   +    GL SSAA+ V I    
Sbjct: 83  QEITFQQDKMWANYIRGVVKCLLARGYQFKGADISVSGNVPQGAGLSSSAALEVVIGQTF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQ 163
             L   +    +  L    A    V      +D   S  G                    
Sbjct: 143 KVLYNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGQANHAMLLDCRSLETQAVSM 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEYPEINEI- 209
               ++  I+      L+ S Y T   Q  +              I   + +  E++E+ 
Sbjct: 203 PEDMAVVIINSNKKRGLVDSEYNTRREQCEEAARLFGVPALRDVTIEQFKAKESELDEMV 262

Query: 210 --NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
               +        +  + QALR  ++K + + M      +     ++  ++  +V  ++E
Sbjct: 263 AKRARHVITENDRTVEAAQALRTHDMKRMGELMAESHASMRDDFEITVKEIDVLVEMVKE 322

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                   +++G G G C++AL    L      +V     A 
Sbjct: 323 VIGDQGGVRMTGGGFGGCIVALVPPTLVDEIKAAVEQKYQAA 364


>gi|326472664|gb|EGD96673.1| mevalonate kinase [Trichophyton tonsurans CBS 112818]
          Length = 518

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 73/382 (19%), Positives = 132/382 (34%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R + ++        + D
Sbjct: 73  FMVSAPGKVIVFGEHAVVHGRKAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDFTWD 132

Query: 66  LAMF-------------------------------------------------HPSFSFI 76
           +                                                    H +  F+
Sbjct: 133 IDSLPWDVFHHPSKKKFYYDSVTELDPELLEALKPHVAMVSSDKPEEVRKIHQHSANQFL 192

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+++V ++ A                   
Sbjct: 193 YLFLSLGSPKTHAAIYTLRSTIPVGAGLGSSASVSVCLSTALLLQVRILAGPHQDQPPDE 252

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
            E   + I   A    L + G  SG+D   S  G  + ++   YS               
Sbjct: 253 AEVQLERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRRGDYSKPPTVTPMLDFPQMK 312

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              I S     TA  + K++ ++  +P + E     I+    +    ++        ++ 
Sbjct: 313 LLLINSRQPRSTAVEVAKVAALKKAHPVVTESILDSIDHTTESAYRLIASDDFDEHCSEK 372

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +  L +      GLL +LGVS   L   + +L +   I  +K++G+G G C I L K   
Sbjct: 373 IDHLGELFRINHGLLVSLGVSHPHLER-IRELVDHADIGWTKLTGAGGGGCTITLFKAKW 431

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           N    + +   +  +G D    
Sbjct: 432 NEEAIEHLEEQLDDEGYDRYET 453


>gi|237743176|ref|ZP_04573657.1| galactokinase [Fusobacterium sp. 7_1]
 gi|229433472|gb|EEO43684.1| galactokinase [Fusobacterium sp. 7_1]
          Length = 390

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 56/364 (15%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  ++D++  + S   Q  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKKEDKIFRMYSKNFQNLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  VYDKKDNWANYPKGVIKTFLDKNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKYEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y    A   + +  +                       + 
Sbjct: 204 KNMSIVIANTNKKRGLADSKYNARRADCQEAVKTLNKNGINIKYLGELTVAEFEKVKHFL 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGRLMNKSHVSLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSHST 320
               E+   + S+++G+G G C +++ + D      ++V        G++      +   
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEKTGLEASFYIANIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GAGR 387


>gi|182419082|ref|ZP_02950336.1| galactokinase [Clostridium butyricum 5521]
 gi|237669322|ref|ZP_04529304.1| galactokinase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377037|gb|EDT74607.1| galactokinase [Clostridium butyricum 5521]
 gi|237655209|gb|EEP52767.1| galactokinase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 389

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 61/363 (16%), Positives = 121/363 (33%), Gaps = 54/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A+       +  R D    ++S   +  G+++      
Sbjct: 25  SPGRVNLIGEHTDYNGGNVFPCALTIGTYGLIAKRDDNKCFVNSLNFEDLGTIEFDLKDL 84

Query: 66  -LAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I          S GFD+     + +  GL SSA+I   +   +L 
Sbjct: 85  VNDKIHDWANYPKGVIKTFGDHGFKTSHGFDILFFGNIPNGSGLSSSASIE-VLMGCILN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLIC---------------YQ 163
             +       EI+        K  G++ G +D  A   G   C                 
Sbjct: 144 ESFGFNIDMVEIVKMCQEAENKFIGVNCGIMDQFAIGMGKENCAILLDCNTLNYSYSKLD 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--IEYPEINEINQKIYAL----- 216
           M    I   +      L  S Y    ++    +  I+       + E+ ++ +       
Sbjct: 204 MDGCKIVIGNTNKKRGLADSKYNERRSECEAALKEIQAVKNISSLGELTEEEFEAVKSNI 263

Query: 217 --------------MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL N +L +  Q MN     L     V+  +L  +V
Sbjct: 264 SDPIKIKRAKHAVYENQRTLKAVNALENNDLALFGQLMNASHVSLRDDYEVTGIELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVN-CHMHAKGIDI--VPITPSH 318
               E   ++ ++++G+G G C +++ K +       ++   +    G +     ++ S 
Sbjct: 324 SLAWECEGVIGARMTGAGFGGCTVSIVKEECVDNFISTITPKYAEKIGYEPSFYIVSISD 383

Query: 319 STS 321
            T 
Sbjct: 384 GTR 386


>gi|326693396|ref|ZP_08230401.1| galactokinase [Leuconostoc argentinum KCTC 3773]
          Length = 396

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 58/362 (16%), Positives = 118/362 (32%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL----------GQYC 61
           +PG + L+GEH   +G      AI          R D+L+ + S+               
Sbjct: 26  SPGRINLIGEHTDYNGGHVFPAAITLGTYGVAGKRTDKLVKLYSTNMPEAGVITFEIDDE 85

Query: 62  GSLDLAMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
             L    +      ++ A+         GF+L +   + +  GL SS+++ + I      
Sbjct: 86  SKLPHGSWGNFVKGVLQALRGYGNKFETGFELVISGNIPNGSGLSSSSSLELLIGVVAKK 145

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---------------GLICYQM 164
           L   K P    + +   A    V   +  +D  +   G                +I   +
Sbjct: 146 LYDLKVPRLQLVASGQRAENDFVGVNTGIMDQFSIGFGEADHAIYLDTNTMIYEMIPTHL 205

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--------------------- 203
             + I  ++      L  S Y     +    +  ++ +                      
Sbjct: 206 GDHVIVIMNTNKRRELADSKYNERVRETQAAVVDLQQKLNIQFLGQLDIATFDQNAALIT 265

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E      +      + +Q + +AL+  +L    Q MN     L+    V+  +L  +  
Sbjct: 266 DETVRRRARHAVYENERTQEAVKALQANHLVEFGQLMNASHQSLKADYEVTGLELDTLAE 325

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA-KGIDIVPITPSHSTS 321
             ++ P ++ ++++G+G G C IAL   D  +   ++V        G        +  T 
Sbjct: 326 TAQQVPGVLGARMTGAGFGGCAIALVHRDAVATLEKTVGERYETVVGYAPSFYAANIGTG 385

Query: 322 LY 323
            +
Sbjct: 386 AH 387


>gi|228949457|ref|ZP_04111711.1| Galactokinase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228810180|gb|EEM56547.1| Galactokinase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1]
          Length = 389

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 57/359 (15%), Positives = 134/359 (37%), Gaps = 52/359 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           +PG + L+GEH   +G      +I          R+D  + + S+  +  G +       
Sbjct: 25  SPGRINLIGEHTDYNGGYVFPASITYGTYGVARRREDDRVFVYSTNFKEVGVIRFKLNEL 84

Query: 65  ---DLAMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +++ +     K   GF+L V   + +  GL SSA++ + +   +L 
Sbjct: 85  GYDKNDNWANYVKGVLLTLKEAGHKIDSGFELLVEGTIPNGAGLSSSASLELLV-GVVLE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
             ++ + +  E++     +  +  G++SG +D  A   G                ++   
Sbjct: 144 HLFNLDVTRLELVKMGKKVENEFIGVNSGIMDQFAIGFGEEDKAILLDTNTLKYEMVPVV 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +  Y+I  ++      L  S Y    A+  + ++ ++ +     + E+++  +       
Sbjct: 204 LNDYAIVIMNTNKRRELADSKYNERRAECEEALARLQTKLEITALGELSETEFDANQDLI 263

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + ++ + +AL   +L+   + +N     L     V+  +L  +V
Sbjct: 264 GDEVLIRRAKHAVYENERTKKAKEALTANDLEEFGKLLNASHASLRDDYEVTGVELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHS 319
              ++Q  ++ ++++G+G G C IAL K          V + ++   G   V       
Sbjct: 324 AAAQKQEGVLGARMTGAGFGGCAIALVKESEIRAFKNKVYDEYLKVIGYAPVFYVAHIG 382


>gi|242808537|ref|XP_002485185.1| mevalonate kinase [Talaromyces stipitatus ATCC 10500]
 gi|218715810|gb|EED15232.1| mevalonate kinase [Talaromyces stipitatus ATCC 10500]
          Length = 547

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 79/383 (20%), Positives = 137/383 (35%), Gaps = 85/383 (22%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK---------------DRLIN 52
             VSAPG +++ GEH V+HG AA+  AI+ R  L +T                  D   +
Sbjct: 106 FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLSKSHRTVTLNFRDIGLDHTWD 165

Query: 53  IDSS-------------LGQYCGSLDLAMFHP-----------------------SFSFI 76
           IDS                     LD  +                          +  F+
Sbjct: 166 IDSLPWNVFKHPSKKKMYYDLVTELDPDLVEAVQPHAAAVSTDKPDDIRKIHQGSAAQFL 225

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S +    GLGSSA+++V ++AALL    TL       P   
Sbjct: 226 YLFLSLGSPESHAAIYTLRSTIPISAGLGSSASVSVCLSAALLLQIRTLAGPHPDQPPEE 285

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    + + G  SG+D   S  G  + ++   YS               
Sbjct: 286 AEVQIERINRWAFVGEMCIHGNPSGVDNTVSAGGKAVLFRRSDYSKPPTVTPLNKFPELP 345

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              + +     TA  + K+  +   +PE+ E     I++   +    + +   +A  +++
Sbjct: 346 LLLVNTRQSRSTAVEVAKVGRLRETHPEVTEAMLDAIDKVTMSASEMIKENDFEADDDED 405

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+          GLL +LGVS  +L  I            +K++G+G G C I L K + 
Sbjct: 406 LEQFGALFRINHGLLVSLGVSHPRLERIR----------WTKLTGAGGGGCAITLIKPNT 455

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    Q +   + ++  +    T
Sbjct: 456 SQQTLQDLEEKLTSENFEKFETT 478


>gi|258566616|ref|XP_002584052.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237905498|gb|EEP79899.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 494

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 91/383 (23%), Positives = 140/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKDRLI------NIDSSLGQY 60
             VSAPG +++ GEH V+HG  A+   I+ R  L +T L K R        +I+      
Sbjct: 49  FMVSAPGKVIVFGEHAVVHGKQAMAAVISLRSYLLVTTLSKSRRTVTLNFRDINLDHTWD 108

Query: 61  CGSLDLAMFHPSFS--------------------------------------------FI 76
             SL   +FH                                                F+
Sbjct: 109 IDSLPWDLFHHPSKKKFYYDRVTCLDPDLLEALQPHISNVSPDQPPDVRKVHQGSANAFL 168

Query: 77  IMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P S G    + S +    GLGSSA++ V ++AALL     L       P   
Sbjct: 169 YLYLSLGSPQSHGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRALAGPHPDQPFDE 228

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI------DFIFP 177
                  I   A    L + G  SG+D   S  G  + ++   YS              P
Sbjct: 229 SEVQIERINRWAFVGELCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVVPILDFPELP 288

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     TA  + K+  ++  +P I E     I+Q   +    LS        ++ 
Sbjct: 289 LLLVNSRQPRSTATEVAKVGALKEAHPAITEALLDGIDQVTSSAYEFLSSKRFSKDSSEA 348

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L  L        GLL +LGVS  +L   V +L +   I  SK++G+G G C I L   + 
Sbjct: 349 LDYLGTLFRINHGLLVSLGVSHPRLER-VRELVDHNGIGWSKLTGAGGGGCTITLVGANR 407

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            S   + +   +  +G D+   T
Sbjct: 408 QSAALKRLEAQLAEEGYDLFETT 430


>gi|310794260|gb|EFQ29721.1| mevalonate kinase [Glomerella graminicola M1.001]
          Length = 499

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 82/389 (21%), Positives = 137/389 (35%), Gaps = 76/389 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT-LRKDRLI------NID 54
              +    VSAPG +++ GEH V+H  AA+  AI+ R  L +T L K R        +ID
Sbjct: 46  SPMMPAFMVSAPGKVIVFGEHAVVHRKAAIAAAISLRSYLLVTSLSKSRRTVTLRFPDID 105

Query: 55  SSLGQYCGSLDLAMFHPS--FSFIIMAINHIKPS---------CGFDLK----------- 92
                    L    F       +    +  + P           G  L            
Sbjct: 106 LQHTWNIDELPWETFQRPDKKKYYYDLVTELDPELVEAIQPHLTGVSLHKSEEVRKVHHN 165

Query: 93  -----------------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKE 125
                                  + S +    GLGSSA+I V + AALL    TL     
Sbjct: 166 SASAFLYIFLSLGSQSFTGCLYTLRSTIPIGAGLGSSASIAVCLAAALLLQLRTLSGPHP 225

Query: 126 PSPD--------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFP 177
             P          I   A    + + G  SG+D   +  G  + +Q   Y+         
Sbjct: 226 DQPPDEARLQVERINRWAFVCEMCIHGNPSGVDNTVATQGKAVVFQRTDYNKPPAVRPLW 285

Query: 178 IHL------IYSGYKTPTAQVLKKISYIEIEYPEI-----NEINQKIYALMGKLSQISCQ 226
                    + +     TA  + K++ ++  +PE+     + I++   A    +      
Sbjct: 286 DFPELPLLLVDTKQAKSTAFEVAKVAKLKKTHPELVGCILDAIDKVTDAADKLIGGEEFD 345

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIA 286
               ++L+ + + M    GLL +LGVS  +L   + +L +   I  +K++G+G G C I 
Sbjct: 346 NEEAESLRKVGELMTINHGLLVSLGVSHPRLER-IRELVDHEGIGWTKLTGAGGGGCSIT 404

Query: 287 LGKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           L K D+       +   +  +G +    T
Sbjct: 405 LLKPDVEKEKLMKLETQLADEGYEKFETT 433


>gi|146318015|ref|YP_001197727.1| galactokinase [Streptococcus suis 05ZYH33]
 gi|253751225|ref|YP_003024366.1| galactokinase [Streptococcus suis SC84]
 gi|253753126|ref|YP_003026266.1| galactokinase [Streptococcus suis P1/7]
 gi|253754949|ref|YP_003028089.1| galactokinase [Streptococcus suis BM407]
 gi|166216976|sp|A4VT88|GAL1_STRSY RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|145688821|gb|ABP89327.1| Galactokinase [Streptococcus suis 05ZYH33]
 gi|251815514|emb|CAZ51094.1| galactokinase [Streptococcus suis SC84]
 gi|251817413|emb|CAZ55151.1| galactokinase [Streptococcus suis BM407]
 gi|251819371|emb|CAR44777.1| galactokinase [Streptococcus suis P1/7]
 gi|292557790|gb|ADE30791.1| Galactokinase [Streptococcus suis GZ1]
 gi|319757500|gb|ADV69442.1| galactokinase [Streptococcus suis JS14]
          Length = 390

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/344 (15%), Positives = 116/344 (33%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI          R D+++   S+  +  G +++ + + 
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNL 83

Query: 72  SF-------SFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F       ++    +  +K        G ++ V   + +  GL SSA++ + I      
Sbjct: 84  VFDKADNWTNYAKGVLKFLKEAGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L   +    D +          +   S  +D  A   G                 +   +
Sbjct: 144 LYGLELTRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM----- 217
             + I  ++      L  S Y    A+  K +  +        + E+++  +        
Sbjct: 204 GDHVIVIMNTNKRRELADSKYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIK 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + +AL   +L    + +N     LE    V+  +L  +  
Sbjct: 264 DENRIKRARHAVLENQRTLQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAH 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              EQ  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 324 TAWEQEGVLGARMTGAGFGGCGIAIVHKDKVEAFKENVGKTYTE 367


>gi|331092595|ref|ZP_08341414.1| galactokinase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330400606|gb|EGG80220.1| galactokinase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 388

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/360 (15%), Positives = 115/360 (31%), Gaps = 50/360 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           APG + L+GEH   +G      A+       +  R D ++   S+     G ++  +   
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTIGTYAIVKKRTDNVLRFYSANFSSLGIIESDLNDL 83

Query: 69  -------FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++ A      K + G D+ +   + +  GL SSA++ V     L  
Sbjct: 84  VPSEAAGWTNYPKGVMWAFEKRGYKLTGGMDILIYGNIPNGSGLSSSASLEVLTGVVLKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------ICYQMPKY-- 167
           L        D  L   ++           +D  AS  G            + Y+      
Sbjct: 144 LFGFDVSMVDIALIGQYSENNFNGCNCGIMDQFASAMGKKDNAIFLDTNTLHYEYAPVVL 203

Query: 168 ---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM----- 217
               I  ++      L+ S Y     +    +  ++       + +++++ +        
Sbjct: 204 EDAKIVIVNSKVKHSLVDSAYNDRRNECETALKELQEVTDIKTLGDLSEEEFEAHKDAIK 263

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  +  AL+  +++   + MN     L     VS  ++  +V 
Sbjct: 264 SPVRQKRAKHAVYENQRTIKAVAALKANDIETFGKLMNASHTSLRNDYEVSCEEIDILVD 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
                  ++ S+I+G G G C +++ K D      +++      K G             
Sbjct: 324 LAWATEGVIGSRITGGGFGGCTVSIVKNDAVDNFIETIGQKYEEKVGHKAEFYVVDIGDG 383


>gi|304384906|ref|ZP_07367252.1| mevalonate kinase [Pediococcus acidilactici DSM 20284]
 gi|304329100|gb|EFL96320.1| mevalonate kinase [Pediococcus acidilactici DSM 20284]
          Length = 306

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 74/317 (23%), Positives = 134/317 (42%), Gaps = 18/317 (5%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYCGS 63
           + ++  ++   ++LMGEH V++   A+   I N +  + +       I I S        
Sbjct: 1   MKEVIKTSNAKIILMGEHSVVYNQPAIALPIRNVKTTVKIQSIPGD-IQIRSRYFNG--- 56

Query: 64  LDLAMFHPSFSFIIMAINH-----IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
             L   H +   I   IN       KP  G  L + SQ+ ++ G+GSSA+  VAI  A+ 
Sbjct: 57  -FLNDIHSNLLGIKQLINQTLTTLGKPHYGLLLDIDSQIPAERGMGSSASTAVAIVRAMY 115

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP-KYSIEKIDFIFP 177
              + +  + +++L T +     + G  SG+D A +     I ++         I+F   
Sbjct: 116 AF-FDRPLTKNKLLKTVNISEKIIHGNPSGLDSATASADRPIWFKRDGTIKALPINFNGY 174

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           + +  SG K  T + +     I      I+  ++ +   +G+L+  +  AL++ +   L 
Sbjct: 175 LVISDSGIKGKTGEAV----NIVKNKLRIDNDSRLLIEKLGELTSQTATALKDDDSLALG 230

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
             MN  Q  L  LGVS   + +++     Q   + SK++G GLG CVI+L      +   
Sbjct: 231 DIMNNAQACLRQLGVSHPAVEKLIQ-AANQSGALGSKLTGGGLGGCVISLVSDAQAAENV 289

Query: 298 QSVNCHMHAKGIDIVPI 314
            +      A    I  +
Sbjct: 290 SAQLRKAGATATWIEKL 306


>gi|237730732|ref|ZP_04561213.1| galactokinase [Citrobacter sp. 30_2]
 gi|226906271|gb|EEH92189.1| galactokinase [Citrobacter sp. 30_2]
          Length = 382

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 62/360 (17%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAARDDRKVRVIAADYDNQVDGFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIIAHDSQQWSNYVRGVVKHLQKRNNAFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPEGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNTVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  + QAL   +L  + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVITENARTVEAAQALEKGDLLRMGQLMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCIVALIPQDLVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|19705397|ref|NP_602892.1| galactokinase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|24211716|sp|Q8RHD0|GAL1_FUSNN RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|19713388|gb|AAL94191.1| Galactokinase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 389

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 113/346 (32%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D+   + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKTFKMYSKNFENLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  IYDKKDDWANYPKGVIKTFLDRNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDIIEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKYEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--------------------IEYP 204
              SI   +      L  S Y        + +  +                       Y 
Sbjct: 204 VNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNNNEVNIKYLGELTVTEFEKVKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGKLMNKSHTSLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|159900828|ref|YP_001547075.1| mevalonate kinase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893867|gb|ABX06947.1| mevalonate kinase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 313

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/316 (20%), Positives = 116/316 (36%), Gaps = 10/316 (3%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDR-LINIDSSLGQYCGSLDLAM 68
           SAPG L+L GEH V++G  AL   I   R  + +        + + +        L    
Sbjct: 3   SAPGKLILAGEHAVVYGQPALAMPIAALRASVAVEPAPRGAGMTVHAPDLGLVWRLR--A 60

Query: 69  FHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPS 127
             P        +++++ P     L + S +    G+GS AA+  A+  AL      +  S
Sbjct: 61  TAPLSDLAQRTLDYLQLPEPDLRLTISSSIPIASGMGSGAAVGAALVRALAEQAGQQ-LS 119

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI--FPIHLIYSGY 185
              I    +       G  SGID     +   I +Q        I  +            
Sbjct: 120 AQVISDLVYQSEKAFHGTPSGIDNTVVAYEQPILFQRQTQGEPLIAPLAVGNQWHFVVAD 179

Query: 186 KTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQG 245
               ++    +  +   +    E+  + +  +G L +    AL   + ++  Q +++   
Sbjct: 180 SGIASETKAVVGDLRQRWLADPELYNRQFVAVGNLVRQIQTALAGNDAELFGQLLSQNHQ 239

Query: 246 LLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMH 305
           LL+TLGVS  KL  +V           +K+SG+G G  ++AL   +  S   Q +     
Sbjct: 240 LLQTLGVSAEKLDYLVQTA-LAAGAWGAKMSGAGWGGIMLALVPAERASYIQQQLRAA-G 297

Query: 306 AKGIDIVPITPSHSTS 321
           A       + P+ S  
Sbjct: 298 AVQTWQTSLLPTDSKR 313


>gi|148273703|ref|YP_001223264.1| hypothetical protein CMM_2519 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831633|emb|CAN02601.1| galK [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
          Length = 386

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 60/361 (16%), Positives = 118/361 (32%), Gaps = 52/361 (14%)

Query: 11  SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS------- 63
           S+PG + L+GEH   +      FAI++R ++ L  R D  I + SS              
Sbjct: 25  SSPGRVNLIGEHTDYNEGFVFPFAIDRRTVIALAPRDDDRIRLASSFSDELVEARLADLT 84

Query: 64  -LDLAMFHPSFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
              +  +      +  A+           GFD+ + S +    GL SSAA+  +I  AL 
Sbjct: 85  GERIDGWQAYPLGVAWALGQRGADLAAVPGFDVFIDSDVPVGAGLSSSAALEGSIALALD 144

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDF 174
            + +        +         ++ G  +G +D +AS+ G     +         E I  
Sbjct: 145 DI-WRLGLDRPTLAAVGQLAENEIVGAPTGIMDQSASLLGQQDAGVFLDCRSLDAEVIPL 203

Query: 175 --------------IFPIHLIYSGYKTPTAQVLKKISYI--------------EIEYPEI 206
                                  GY+       +    +                     
Sbjct: 204 GLEAAGLTIAVIDTHVAHAHADGGYRARRESCEQGARLMGVASLRDLAVDDLVRAREVLD 263

Query: 207 NEINQKIYA--LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
           +E  +++       +    + +ALR +  + + + ++     +     +S  +L   V  
Sbjct: 264 DETFRRVRHIVTENQRVLDTVRALREEGPRAIGELLDASHRSMRDDFEISVPELDLAVEV 323

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI---DIVPITPSHST 320
             +    + ++++G G G   IAL   D  S    +++      G     +  +TPS   
Sbjct: 324 A-QNEGAIGARMTGGGFGGSAIALIDVDSLSRLQVAIDGAFAEHGYTGPTVFTVTPSDGA 382

Query: 321 S 321
            
Sbjct: 383 K 383


>gi|296328348|ref|ZP_06870875.1| galactokinase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296154527|gb|EFG95317.1| galactokinase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 389

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 113/346 (32%), Gaps = 50/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D+   + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKTFKMYSKNFENLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I      + K   GFD+     + +  GL SSA+I V     L  
Sbjct: 84  IYDKKDDWANYPKGVIKTFLDRNYKIDSGFDVLFFGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDIIEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKYEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--------------------IEYP 204
              SI   +      L  S Y        + +  +                       Y 
Sbjct: 204 MNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNNNGVNIKYLGELTVAEFEKVKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGKLMNKSHTSLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               E+   + S+++G+G G C +++ + D      ++V      K
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIKNVGKKYKEK 369


>gi|215485772|ref|YP_002328203.1| galactokinase [Escherichia coli O127:H6 str. E2348/69]
 gi|312965186|ref|ZP_07779423.1| galactokinase [Escherichia coli 2362-75]
 gi|254790361|sp|B7ULN0|GAL1_ECO27 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|215263844|emb|CAS08182.1| galactokinase [Escherichia coli O127:H6 str. E2348/69]
 gi|312290277|gb|EFR18160.1| galactokinase [Escherichia coli 2362-75]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|218688541|ref|YP_002396753.1| galactokinase [Escherichia coli ED1a]
 gi|254790363|sp|B7MPP1|GAL1_ECO81 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|218426105|emb|CAR06923.1| galactokinase [Escherichia coli ED1a]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  TPIIAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|331656769|ref|ZP_08357731.1| galactokinase [Escherichia coli TA206]
 gi|331055017|gb|EGI27026.1| galactokinase [Escherichia coli TA206]
          Length = 401

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 56/343 (16%), Positives = 113/343 (32%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G C++AL   +L     Q+V     AK
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAK 363


>gi|260900416|ref|ZP_05908811.1| galactokinase [Vibrio parahaemolyticus AQ4037]
 gi|308109131|gb|EFO46671.1| galactokinase [Vibrio parahaemolyticus AQ4037]
          Length = 386

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 58/350 (16%), Positives = 113/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++  T R+D ++ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAATKREDNIVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AMDEFDITQAITFEQDKMWANYIRGVVKCLLARGYQFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIDQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L      +V     A 
Sbjct: 315 TLVEIVKEVIGEQGGVRMTGGGFGGCIVALVPPALVDDVKAAVEAKYQAA 364


>gi|323170871|gb|EFZ56521.1| galactokinase [Escherichia coli LT-68]
          Length = 382

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 127/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
           + +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  VPIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|297579173|ref|ZP_06941101.1| galactokinase [Vibrio cholerae RC385]
 gi|297536767|gb|EFH75600.1| galactokinase [Vibrio cholerae RC385]
          Length = 405

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/341 (17%), Positives = 102/341 (29%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D  +    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDSRVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSG-----------YKTPTAQVLKKISYI----------------EIEYPEINE 208
             + ++              Y     Q                        + E   +  
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNIRRQQCEAAAKAFGVKALRDVTLAQLTAKQAELDPVVA 282

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMTRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V     A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPSQVEAVQQAVAEQYEAA 383


>gi|332994921|gb|AEF04976.1| galactokinase [Alteromonas sp. SN2]
          Length = 379

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 67/359 (18%), Positives = 112/359 (31%), Gaps = 47/359 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSL 64
           +   APG + L+GEH   +       AIN    +  + R D  I +   D    Q   SL
Sbjct: 20  LIAHAPGRVNLIGEHTDYNEGFVFPAAINFGTWVAASKRDDNDIVVTALDYENQQNQFSL 79

Query: 65  ------DLAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                 D   +      ++  +    P   G +L V   +    GL SSA+  +AI  AL
Sbjct: 80  NDIQYDDNQGWANYVRGVVKVLKDALPDFSGANLVVTGNVPQGAGLSSSASFEIAILKAL 139

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQ------------- 163
             L Y       +             G S G +D   S  G                   
Sbjct: 140 SAL-YELPLDGVQAALLGQKAENTFVGCSCGIMDQLVSAMGHEGSAMLLDCQSLAIEHSP 198

Query: 164 -MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK-----ISYIEIEYPEINEINQKIYALM 217
               + I  I+      L+ S Y     Q  +      +  +     E+ E  +     +
Sbjct: 199 LPSSHQIVIINSNVKRGLVDSEYNLRREQCEQGASLLSVPSLREATIEMLETAKPHMPEV 258

Query: 218 GKLSQISC-----------QALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                              +AL+  ++  +++AM      +     ++   +  +V  + 
Sbjct: 259 VYRRARHIITENARTLSASEALKVGDITTVSEAMAESHVSMRDDFEITVPPIDYLVEIIG 318

Query: 266 EQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVN-CHMHAKGI--DIVPITPSHST 320
           E        +++G G G CV+AL   D      Q V   +    G   DI   T +   
Sbjct: 319 EVLGETGGVRMTGGGFGGCVVALVPTDSVDAVKQVVADKYFDETGYKADIYVCTATQGA 377


>gi|315179443|gb|ADT86357.1| galactokinase [Vibrio furnissii NCTC 11218]
          Length = 387

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/342 (18%), Positives = 111/342 (32%), Gaps = 43/342 (12%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AIN + ++  + R D  + I   D +  Q   SLD
Sbjct: 23  VIQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAASKRDDNRVRIIAVDYANAQDEFSLD 82

Query: 66  -------LAMFHPSFSFIIM-AINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    M+      ++   +       G ++ V   +    GL SSAA+ V I    
Sbjct: 83  APIEFQADKMWANYIRGVVKFLLERGYTLGGANIAVSGNVPQGAGLSSSAALEVVIGQTF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQ 163
             L        +  L    A    V      +D   S  G                    
Sbjct: 143 KALFSLAISQAEIALNGQQAENQFVGCNCGIMDQLISAEGQANHALLIDCRSLETQAVSM 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYPEIN 207
               +I  I+      L+ S Y T   Q  +                     + E PE+ 
Sbjct: 203 PEDMAIVIINSNKKRGLVDSEYNTRRQQCEEAAQIFGVKALRDVTIETFERRQAELPELV 262

Query: 208 EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
               +        +  + QALR  ++  L Q M      +     ++  ++  +V  +++
Sbjct: 263 AKRARHVITENDRTLAAAQALRANDMTTLGQLMAASHASMRDDFEITVKEIDTLVDIVKQ 322

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                   +++G G G CV+AL    L +    ++     A 
Sbjct: 323 VIGDQGGVRMTGGGFGGCVVALMPPALVAPVTAAIEQQYQAA 364


>gi|28899172|ref|NP_798777.1| galactokinase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836778|ref|ZP_01989445.1| galactokinase [Vibrio parahaemolyticus AQ3810]
 gi|260361588|ref|ZP_05774615.1| galactokinase [Vibrio parahaemolyticus K5030]
 gi|260876745|ref|ZP_05889100.1| galactokinase [Vibrio parahaemolyticus AN-5034]
 gi|260898177|ref|ZP_05906673.1| galactokinase [Vibrio parahaemolyticus Peru-466]
 gi|33301163|sp|Q87M60|GAL1_VIBPA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|28807396|dbj|BAC60661.1| galactokinase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749924|gb|EDM60669.1| galactokinase [Vibrio parahaemolyticus AQ3810]
 gi|308089040|gb|EFO38735.1| galactokinase [Vibrio parahaemolyticus Peru-466]
 gi|308091377|gb|EFO41072.1| galactokinase [Vibrio parahaemolyticus AN-5034]
 gi|308114043|gb|EFO51583.1| galactokinase [Vibrio parahaemolyticus K5030]
          Length = 386

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 57/350 (16%), Positives = 111/350 (31%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D ++ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNIVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYQFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L       V     A 
Sbjct: 315 TLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKAEVEAKYQAA 364


>gi|154502586|ref|ZP_02039646.1| hypothetical protein RUMGNA_00399 [Ruminococcus gnavus ATCC 29149]
 gi|153796778|gb|EDN79198.1| hypothetical protein RUMGNA_00399 [Ruminococcus gnavus ATCC 29149]
          Length = 391

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/364 (17%), Positives = 122/364 (33%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      A+          R DR++ + S    + G        L
Sbjct: 24  SPGRVNLIGEHTDYNGGHVFPCALTLGTYGIAKKRSDRILRLYSMNLDHLGVITATLDDL 83

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                +   ++ +  +  +K       CG DL +   + +  GL SSA++ V        
Sbjct: 84  TNKPEYNWANYPLGVLWALKEKGYSVDCGMDLVIYGNIPNGSGLSSSASLEVLTGVIAKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG----------GLICYQMPKY- 167
           L      S  +I            G + G +D  A   G          G + Y+     
Sbjct: 144 LCGFDALSMTDIALIGQYSENNFNGCNCGIMDQFAVAMGKKDCAIFLDTGTLSYEYAPVE 203

Query: 168 ----SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE-------------YPEINEI- 209
                I   +      L+ S Y     +    +S ++ E             + +  E+ 
Sbjct: 204 LEDAKIIITNSKVKHSLVDSQYNQRRQECSHALSLLQEELDINALGDLDIDTFEKFKEVI 263

Query: 210 -------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                    K      + +  +  AL+  N++   + MN+    L     VS  ++  +V
Sbjct: 264 TDPVEQKRAKHAVYENQRTIEAVSALKAGNIERFGELMNQSHISLRDDYAVSCEEIDILV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               + P ++ S+I+G G G C +++ K D       ++      K G +    T    +
Sbjct: 324 DLAWQIPGVVGSRITGGGFGGCTVSIVKNDAVDTFINTIGPAYKEKVGHEAEFYTVDIGS 383

Query: 321 SLYR 324
              +
Sbjct: 384 GAQK 387


>gi|32450782|gb|AAO26322.1| galactokinase [Lactococcus raffinolactis]
          Length = 392

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 59/352 (16%), Positives = 121/352 (34%), Gaps = 53/352 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      AI+         R D L+ + S   +  G ++      
Sbjct: 28  SPGRINLIGEHTDYNGGYVFPAAISIGTFGVARKRTDSLVKVYSLNFETVGVIEFSLEDE 87

Query: 66  -----LAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                 A +       ++ +         GF+L +   + +  GL SSA++ + +   + 
Sbjct: 88  LVNTPEANWGNFVKGYLLKLKEAGHAIQTGFELVIEGTIPNGSGLSSSASLELLVGTVVN 147

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI----HGGLICY------------ 162
            L YH       ++     +  +  G++SGI    +I     G  I              
Sbjct: 148 DL-YHLGLDKLTLVQLGQKVENEFIGVNSGIMDQFAIGFGEIGKAILLDTNTLKYELVPA 206

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY------------------- 203
           +   Y I  ++      L  S Y    A+  + +  ++ +                    
Sbjct: 207 EFGDYKIVIMNTNKRRELADSKYNERRAECEEALKRLQTKLEITALGQLTPTEFEENRAL 266

Query: 204 --PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
                 E   K      + ++++   L    L+   Q +N     L+    V+  +L  +
Sbjct: 267 IGDVTLEKRAKHAVYENERTKLAKTCLEAGELQAFGQLLNASHESLKNDYEVTGIELDTL 326

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNC-HMHAKGIDI 311
               +  P ++ ++++G+G G C IAL K          ++  ++   G D 
Sbjct: 327 TETAQGLPGVLGARMTGAGFGGCGIALVKTSDIEAFISKMSATYLEKIGYDA 378


>gi|312891694|ref|ZP_07751204.1| galactokinase [Mucilaginibacter paludis DSM 18603]
 gi|311295878|gb|EFQ73037.1| galactokinase [Mucilaginibacter paludis DSM 18603]
          Length = 390

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/342 (18%), Positives = 116/342 (33%), Gaps = 46/342 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G   +  AI     +      D++    S        + +     
Sbjct: 23  SPGRVNLIGEHIDYNGGLVMPCAITLGTYMLTAPNDDQVFRFKSVNFNETLEIPIQNSYQ 82

Query: 67  AMFHPSFSFIIMAINHI----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
                 F++ +  I++     +P  G D+     +    GL SSA+I V    A   L  
Sbjct: 83  KNGDSWFNYPLGVIHYFVKGSQPLQGLDMLYYGDIPIGSGLSSSASIEVVTAFAFNELFK 142

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIE--------- 170
                 + +L         +   S  +D  A   G     +         E         
Sbjct: 143 GGFSKLELVLMAKKVENEFIGVNSGIMDQFAVAFGEENKALMLDCDTLDYEAVDCNLGDY 202

Query: 171 ---KIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMGK------ 219
               I+   P  L  S Y     +    +  +++E     + EI+ + + L         
Sbjct: 203 LLAIINTNKPRKLAESKYNERVKECQTALKKLQLELDINNLCEIDVQTFDLHKHLITDAT 262

Query: 220 -------------LSQISCQALRNKNLKVLAQAMNRQQGLLETLG-VSDSKLSEIVWKLR 265
                          +++ +AL   NLK   + M      L+ L  VS ++L  +V    
Sbjct: 263 VLNRATHVVAENERVKLAAKALAGNNLKEFGRLMYASHDSLKNLYEVSGAELDAVVEYAA 322

Query: 266 EQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              ++  ++++G+G G C IAL K D      Q +  +  AK
Sbjct: 323 TDKNVTGARMTGAGFGGCAIALVKKDSLDSFTQGLTEYYTAK 364


>gi|241668623|ref|ZP_04756201.1| galactokinase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254877157|ref|ZP_05249867.1| galactokinase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254843178|gb|EET21592.1| galactokinase [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 383

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 65/346 (18%), Positives = 116/346 (33%), Gaps = 45/346 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +    + FAINK   + +  R D ++N+ S       S ++     
Sbjct: 26  SPGRVNLIGEHTDYNNGYVMPFAINKGTFISIATRSDNIVNVYSENLDDSTSFNINEIQQ 85

Query: 69  -----FHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
                +      +I  I     K   G D+ + S L    GL SSA++  A+  A   + 
Sbjct: 86  VVSNTWQNYIKGVINIIKLDFYKDIKGADIYIFSDLPFGAGLSSSASLNTALAYAYNEI- 144

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---------------ICYQMP 165
           Y    S  E+   A  +  +  G   G +D  A +                   I +++ 
Sbjct: 145 YELNISKLELAKIAQKVEHEYIGTKCGIMDQMACLFSKQNAATMIDCNDNHCDNIPFELD 204

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLK-----KISYIEIEYPEINEINQKIYALMGK- 219
             S+   D     +L  S Y               I  +     E  E  +  +      
Sbjct: 205 NLSVLICDTNIKHNLADSAYNKRRQVCEDIAKFNNIKSLRELNIEKLEHTKANFNEEEYK 264

Query: 220 ----------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                         +  A+  K+   L + M +    L+    VS ++L  +V   +   
Sbjct: 265 LALHVYTENQRVIDATSAMTTKDWSNLGKLMYQSHNSLKNNYKVSCNELDYLVELSQSFA 324

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI 314
            +  ++++G G G   I L    L       +  +   K  +I P 
Sbjct: 325 GVYGARMTGGGFGGSTIHLLPTKLLKDYTDYLEKNYSKK-FNIKPT 369


>gi|145630567|ref|ZP_01786347.1| galactokinase [Haemophilus influenzae R3021]
 gi|144983957|gb|EDJ91399.1| galactokinase [Haemophilus influenzae R3021]
          Length = 384

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 117/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +   +R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAISGAIRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L  +   S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GNLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +       
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFRKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V   +        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELAQLVIGKNGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|323976469|gb|EGB71558.1| galactokinase [Escherichia coli TW10509]
          Length = 382

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNNFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|170679731|ref|YP_001742860.1| galactokinase [Escherichia coli SMS-3-5]
 gi|226709563|sp|B1LM48|GAL1_ECOSM RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|170517449|gb|ACB15627.1| galactokinase [Escherichia coli SMS-3-5]
          Length = 382

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHESYQWANYVRGVVKHLQLRNNNFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|86516614|gb|ABC97999.1| GalK [Shigella boydii]
          Length = 382

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                +I  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAIVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|150019230|ref|YP_001311484.1| galactokinase [Clostridium beijerinckii NCIMB 8052]
 gi|189045135|sp|A6M1P8|GAL1_CLOB8 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|149905695|gb|ABR36528.1| galactokinase [Clostridium beijerinckii NCIMB 8052]
          Length = 389

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 63/363 (17%), Positives = 126/363 (34%), Gaps = 54/363 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF-- 69
           +PG + L+GEH   +G      A+       +  R+D+ + ++S   +  G L+ ++   
Sbjct: 25  SPGRVNLIGEHTDYNGGNVFPCALTIGTYALVRQREDKNVLVNSLNFKELGILEFSLENM 84

Query: 70  -----HPSFSFIIMAINHIK-----PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                H   ++    I   +        GF++     + +  GL SSA+I V +   L  
Sbjct: 85  IYEKQHDWANYPKGVIKTFENHGYNIPNGFEILFYGNIPNGSGLSSSASIEVLMGTILND 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLIC---------------YQ 163
           L ++   +  +I+        K  G++ G +D  A   G   C                 
Sbjct: 145 L-FNLNINMVDIVKMCQEAENKFIGVNCGIMDQFAIGMGKENCAILLDCNTLKYSYSTIA 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-------------------- 203
           M  Y I   +      L  S Y    ++    ++ I+                       
Sbjct: 204 MDGYKIVIANTNKKRGLADSKYNERRSECETALAEIQKVKNINALGELTEEEFEEVKSCI 263

Query: 204 -PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              I     K      + +  + +AL   +L +  + MN     L     V+  +L  +V
Sbjct: 264 SDPIKAKRAKHAVYENRRTLKAVKALEENDLTLFGKLMNDSHISLRDDYEVTGIELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDI--VPITPSH 318
               +   ++ ++++G+G G C + + K D      + V     +K G +     ++ S 
Sbjct: 324 SLAWKSEGVIGARMTGAGFGGCTVNIVKEDCIDSFVEKVKAEYTSKIGYEPSFYVVSISD 383

Query: 319 STS 321
            T 
Sbjct: 384 GTR 386


>gi|86516642|gb|ABC98013.1| GalK [Shigella boydii]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 70/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VAI   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAIGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|301020772|ref|ZP_07184838.1| galactokinase [Escherichia coli MS 69-1]
 gi|300398497|gb|EFJ82035.1| galactokinase [Escherichia coli MS 69-1]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHESYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|15830039|ref|NP_308812.1| galactokinase [Escherichia coli O157:H7 str. Sakai]
 gi|16128725|ref|NP_415278.1| galactokinase [Escherichia coli str. K-12 substr. MG1655]
 gi|89107608|ref|AP_001388.1| galactokinase [Escherichia coli str. K-12 substr. W3110]
 gi|157158993|ref|YP_001461911.1| galactokinase [Escherichia coli E24377A]
 gi|168750249|ref|ZP_02775271.1| galactokinase [Escherichia coli O157:H7 str. EC4113]
 gi|168757046|ref|ZP_02782053.1| galactokinase [Escherichia coli O157:H7 str. EC4401]
 gi|168763347|ref|ZP_02788354.1| galactokinase [Escherichia coli O157:H7 str. EC4501]
 gi|168767202|ref|ZP_02792209.1| galactokinase [Escherichia coli O157:H7 str. EC4486]
 gi|168776498|ref|ZP_02801505.1| galactokinase [Escherichia coli O157:H7 str. EC4196]
 gi|168779245|ref|ZP_02804252.1| galactokinase [Escherichia coli O157:H7 str. EC4076]
 gi|168786916|ref|ZP_02811923.1| galactokinase [Escherichia coli O157:H7 str. EC869]
 gi|168800811|ref|ZP_02825818.1| galactokinase [Escherichia coli O157:H7 str. EC508]
 gi|170020905|ref|YP_001725859.1| galactokinase [Escherichia coli ATCC 8739]
 gi|188493829|ref|ZP_03001099.1| galactokinase [Escherichia coli 53638]
 gi|193065587|ref|ZP_03046654.1| galactokinase [Escherichia coli E22]
 gi|193069539|ref|ZP_03050492.1| galactokinase [Escherichia coli E110019]
 gi|194435024|ref|ZP_03067264.1| galactokinase [Shigella dysenteriae 1012]
 gi|194439764|ref|ZP_03071832.1| galactokinase [Escherichia coli 101-1]
 gi|195936745|ref|ZP_03082127.1| galactokinase [Escherichia coli O157:H7 str. EC4024]
 gi|208807643|ref|ZP_03249980.1| galactokinase [Escherichia coli O157:H7 str. EC4206]
 gi|208814785|ref|ZP_03255964.1| galactokinase [Escherichia coli O157:H7 str. EC4045]
 gi|208822459|ref|ZP_03262778.1| galactokinase [Escherichia coli O157:H7 str. EC4042]
 gi|209398960|ref|YP_002269385.1| galactokinase [Escherichia coli O157:H7 str. EC4115]
 gi|209918001|ref|YP_002292085.1| galactokinase [Escherichia coli SE11]
 gi|217325535|ref|ZP_03441619.1| galactokinase [Escherichia coli O157:H7 str. TW14588]
 gi|218553277|ref|YP_002386190.1| galactokinase [Escherichia coli IAI1]
 gi|218694174|ref|YP_002401841.1| galactokinase [Escherichia coli 55989]
 gi|238900015|ref|YP_002925811.1| galactokinase [Escherichia coli BW2952]
 gi|254160820|ref|YP_003043928.1| galactokinase [Escherichia coli B str. REL606]
 gi|254791908|ref|YP_003076745.1| galactokinase [Escherichia coli O157:H7 str. TW14359]
 gi|256023647|ref|ZP_05437512.1| galactokinase [Escherichia sp. 4_1_40B]
 gi|260842956|ref|YP_003220734.1| galactokinase [Escherichia coli O103:H2 str. 12009]
 gi|261224461|ref|ZP_05938742.1| galactokinase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254547|ref|ZP_05947080.1| galactokinase [Escherichia coli O157:H7 str. FRIK966]
 gi|291281693|ref|YP_003498511.1| Galactokinase [Escherichia coli O55:H7 str. CB9615]
 gi|293433018|ref|ZP_06661446.1| galactokinase [Escherichia coli B088]
 gi|297517758|ref|ZP_06936144.1| galactokinase [Escherichia coli OP50]
 gi|300816400|ref|ZP_07096622.1| galactokinase [Escherichia coli MS 107-1]
 gi|300822960|ref|ZP_07103095.1| galactokinase [Escherichia coli MS 119-7]
 gi|300929442|ref|ZP_07144911.1| galactokinase [Escherichia coli MS 187-1]
 gi|300947164|ref|ZP_07161378.1| galactokinase [Escherichia coli MS 116-1]
 gi|300957701|ref|ZP_07169889.1| galactokinase [Escherichia coli MS 175-1]
 gi|301029154|ref|ZP_07192278.1| galactokinase [Escherichia coli MS 196-1]
 gi|301646183|ref|ZP_07246080.1| galactokinase [Escherichia coli MS 146-1]
 gi|307137363|ref|ZP_07496719.1| galactokinase [Escherichia coli H736]
 gi|307313833|ref|ZP_07593450.1| galactokinase [Escherichia coli W]
 gi|312970829|ref|ZP_07785008.1| galactokinase [Escherichia coli 1827-70]
 gi|331641252|ref|ZP_08342387.1| galactokinase [Escherichia coli H736]
 gi|331651759|ref|ZP_08352778.1| galactokinase [Escherichia coli M718]
 gi|331662110|ref|ZP_08363033.1| galactokinase [Escherichia coli TA143]
 gi|331667117|ref|ZP_08367982.1| galactokinase [Escherichia coli TA271]
 gi|331676432|ref|ZP_08377129.1| galactokinase [Escherichia coli H591]
 gi|62288105|sp|P0A6T3|GAL1_ECOLI RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|62288106|sp|P0A6T4|GAL1_ECO57 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|166989669|sp|A7ZJD2|GAL1_ECO24 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|189045136|sp|B1IXX9|GAL1_ECOLC RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|226709561|sp|B7M6C0|GAL1_ECO8A RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229874587|sp|B6I7R1|GAL1_ECOSE RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229874590|sp|B5YRF5|GAL1_ECO5E RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|254790362|sp|B7LAF8|GAL1_ECO55 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|259647201|sp|C4ZXS8|GAL1_ECOBW RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|41532|emb|CAA26172.1| unnamed protein product [Escherichia coli]
 gi|58030|emb|CAA47408.1| galK [synthetic construct]
 gi|58033|emb|CAA47410.1| galK gene from E.coli [synthetic construct]
 gi|595700|gb|AAA57082.1| galactokinase [unidentified cloning vector]
 gi|1651342|dbj|BAA35419.1| galactokinase [Escherichia coli str. K12 substr. W3110]
 gi|1786972|gb|AAC73844.1| galactokinase [Escherichia coli str. K-12 substr. MG1655]
 gi|13360244|dbj|BAB34208.1| galactokinase [Escherichia coli O157:H7 str. Sakai]
 gi|86516622|gb|ABC98003.1| GalK [Shigella boydii]
 gi|86516624|gb|ABC98004.1| GalK [Shigella boydii]
 gi|86516626|gb|ABC98005.1| GalK [Shigella boydii]
 gi|86516634|gb|ABC98009.1| GalK [Shigella boydii]
 gi|86516638|gb|ABC98011.1| GalK [Shigella boydii]
 gi|86516664|gb|ABC98024.1| GalK [Shigella dysenteriae]
 gi|86516688|gb|ABC98036.1| GalK [Escherichia coli]
 gi|86516690|gb|ABC98037.1| GalK [Escherichia coli]
 gi|157081023|gb|ABV20731.1| galactokinase [Escherichia coli E24377A]
 gi|169755833|gb|ACA78532.1| galactokinase [Escherichia coli ATCC 8739]
 gi|187768179|gb|EDU32023.1| galactokinase [Escherichia coli O157:H7 str. EC4196]
 gi|188015487|gb|EDU53609.1| galactokinase [Escherichia coli O157:H7 str. EC4113]
 gi|188489028|gb|EDU64131.1| galactokinase [Escherichia coli 53638]
 gi|189003027|gb|EDU72013.1| galactokinase [Escherichia coli O157:H7 str. EC4076]
 gi|189355897|gb|EDU74316.1| galactokinase [Escherichia coli O157:H7 str. EC4401]
 gi|189363413|gb|EDU81832.1| galactokinase [Escherichia coli O157:H7 str. EC4486]
 gi|189366430|gb|EDU84846.1| galactokinase [Escherichia coli O157:H7 str. EC4501]
 gi|189373137|gb|EDU91553.1| galactokinase [Escherichia coli O157:H7 str. EC869]
 gi|189376968|gb|EDU95384.1| galactokinase [Escherichia coli O157:H7 str. EC508]
 gi|192926772|gb|EDV81399.1| galactokinase [Escherichia coli E22]
 gi|192957086|gb|EDV87536.1| galactokinase [Escherichia coli E110019]
 gi|194416720|gb|EDX32849.1| galactokinase [Shigella dysenteriae 1012]
 gi|194421316|gb|EDX37335.1| galactokinase [Escherichia coli 101-1]
 gi|208727444|gb|EDZ77045.1| galactokinase [Escherichia coli O157:H7 str. EC4206]
 gi|208731433|gb|EDZ80121.1| galactokinase [Escherichia coli O157:H7 str. EC4045]
 gi|208737944|gb|EDZ85627.1| galactokinase [Escherichia coli O157:H7 str. EC4042]
 gi|209160360|gb|ACI37793.1| galactokinase [Escherichia coli O157:H7 str. EC4115]
 gi|209776298|gb|ACI86461.1| galactokinase [Escherichia coli]
 gi|209776300|gb|ACI86462.1| galactokinase [Escherichia coli]
 gi|209776302|gb|ACI86463.1| galactokinase [Escherichia coli]
 gi|209776304|gb|ACI86464.1| galactokinase [Escherichia coli]
 gi|209776306|gb|ACI86465.1| galactokinase [Escherichia coli]
 gi|209911260|dbj|BAG76334.1| galactokinase [Escherichia coli SE11]
 gi|217321756|gb|EEC30180.1| galactokinase [Escherichia coli O157:H7 str. TW14588]
 gi|218350906|emb|CAU96604.1| galactokinase [Escherichia coli 55989]
 gi|218360045|emb|CAQ97592.1| galactokinase [Escherichia coli IAI1]
 gi|222032486|emb|CAP75225.1| Galactokinase [Escherichia coli LF82]
 gi|238861269|gb|ACR63267.1| galactokinase [Escherichia coli BW2952]
 gi|253972721|gb|ACT38392.1| galactokinase [Escherichia coli B str. REL606]
 gi|254591308|gb|ACT70669.1| galactokinase [Escherichia coli O157:H7 str. TW14359]
 gi|257758103|dbj|BAI29600.1| galactokinase [Escherichia coli O103:H2 str. 12009]
 gi|260450096|gb|ACX40518.1| galactokinase [Escherichia coli DH1]
 gi|281177893|dbj|BAI54223.1| galactokinase [Escherichia coli SE15]
 gi|290761566|gb|ADD55527.1| Galactokinase [Escherichia coli O55:H7 str. CB9615]
 gi|291323837|gb|EFE63259.1| galactokinase [Escherichia coli B088]
 gi|299877909|gb|EFI86120.1| galactokinase [Escherichia coli MS 196-1]
 gi|300315569|gb|EFJ65353.1| galactokinase [Escherichia coli MS 175-1]
 gi|300453242|gb|EFK16862.1| galactokinase [Escherichia coli MS 116-1]
 gi|300462642|gb|EFK26135.1| galactokinase [Escherichia coli MS 187-1]
 gi|300524501|gb|EFK45570.1| galactokinase [Escherichia coli MS 119-7]
 gi|300531090|gb|EFK52152.1| galactokinase [Escherichia coli MS 107-1]
 gi|301075573|gb|EFK90379.1| galactokinase [Escherichia coli MS 146-1]
 gi|306906473|gb|EFN36987.1| galactokinase [Escherichia coli W]
 gi|309700972|emb|CBJ00269.1| galactokinase [Escherichia coli ETEC H10407]
 gi|310336590|gb|EFQ01757.1| galactokinase [Escherichia coli 1827-70]
 gi|312945274|gb|ADR26101.1| galactokinase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315059993|gb|ADT74320.1| galactokinase [Escherichia coli W]
 gi|315135407|dbj|BAJ42566.1| galactokinase [Escherichia coli DH1]
 gi|315299315|gb|EFU58567.1| galactokinase [Escherichia coli MS 16-3]
 gi|315614626|gb|EFU95268.1| galactokinase [Escherichia coli 3431]
 gi|320179410|gb|EFW54367.1| Galactokinase [Shigella boydii ATCC 9905]
 gi|320193156|gb|EFW67796.1| Galactokinase [Escherichia coli O157:H7 str. EC1212]
 gi|320198130|gb|EFW72734.1| Galactokinase [Escherichia coli EC4100B]
 gi|320637924|gb|EFX07697.1| galactokinase [Escherichia coli O157:H7 str. G5101]
 gi|320643322|gb|EFX12508.1| galactokinase [Escherichia coli O157:H- str. 493-89]
 gi|320648665|gb|EFX17303.1| galactokinase [Escherichia coli O157:H- str. H 2687]
 gi|320654258|gb|EFX22313.1| galactokinase [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320659968|gb|EFX27510.1| galactokinase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664794|gb|EFX31932.1| galactokinase [Escherichia coli O157:H7 str. LSU-61]
 gi|323158802|gb|EFZ44815.1| galactokinase [Escherichia coli E128010]
 gi|323185089|gb|EFZ70455.1| galactokinase [Escherichia coli 1357]
 gi|323191095|gb|EFZ76360.1| galactokinase [Escherichia coli RN587/1]
 gi|323379447|gb|ADX51715.1| galactokinase [Escherichia coli KO11]
 gi|323938245|gb|EGB34504.1| galactokinase [Escherichia coli E1520]
 gi|323942630|gb|EGB38795.1| galactokinase [Escherichia coli E482]
 gi|323963004|gb|EGB58575.1| galactokinase [Escherichia coli H489]
 gi|323971920|gb|EGB67141.1| galactokinase [Escherichia coli TA007]
 gi|324018534|gb|EGB87753.1| galactokinase [Escherichia coli MS 117-3]
 gi|324116180|gb|EGC10102.1| galactokinase [Escherichia coli E1167]
 gi|325650938|emb|CCA29759.1| galactokinase [Cloning vector pgalK-Kn]
 gi|326341767|gb|EGD65551.1| Galactokinase [Escherichia coli O157:H7 str. 1044]
 gi|326345719|gb|EGD69458.1| Galactokinase [Escherichia coli O157:H7 str. 1125]
 gi|331038050|gb|EGI10270.1| galactokinase [Escherichia coli H736]
 gi|331050037|gb|EGI22095.1| galactokinase [Escherichia coli M718]
 gi|331060532|gb|EGI32496.1| galactokinase [Escherichia coli TA143]
 gi|331065473|gb|EGI37366.1| galactokinase [Escherichia coli TA271]
 gi|331075925|gb|EGI47222.1| galactokinase [Escherichia coli H591]
 gi|332093812|gb|EGI98866.1| galactokinase [Shigella boydii 5216-82]
 gi|332096476|gb|EGJ01472.1| galactokinase [Shigella dysenteriae 155-74]
 gi|332342088|gb|AEE55422.1| galactokinase GalK [Escherichia coli UMNK88]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|327393181|dbj|BAK10603.1| galactokinase GalK [Pantoea ananatis AJ13355]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 53/340 (15%), Positives = 108/340 (31%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSLD--- 65
           APG + L+GEH   +    L  AI+ + ++    R DR +    +D    Q   SLD   
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAKRDDRQVRVVAVDYDQAQDIFSLDAPI 84

Query: 66  ----LAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                 M+      ++  +    P   G D+ +   +    GL SSA++ VA+      +
Sbjct: 85  TSVKEPMWANYVRGVVKHLQQRAPDFGGVDMVISGNVPQGAGLSSSASLEVAVGTVFQQM 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIFP 177
                      +    A    V      +D   S  G     +           +     
Sbjct: 145 FNLALDGAAIAVNGQEAENQFVGCNCGIMDQLISALGQKDHAMLLDCRTLGTTPVSMPDD 204

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIE----------------------------YPEINEI 209
           I ++        + V  + +    +                             P++ + 
Sbjct: 205 IAVVIINSNFRRSLVGSEYNVRREQCETGARFFNKKALRDVDLAEFSAAESQLDPQVAKR 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
            + +       +  + +AL   +L  + + M      +     ++   +  +V  ++ + 
Sbjct: 265 VRHVITENA-RTLEAAEALSRGDLARMGELMAESHASMRDDFEITVPPVDTLVEIVKAEI 323

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G C++AL   DL      +V     AK
Sbjct: 324 GDRGGVRMTGGGFGGCIVALMPLDLVDRVQAAVASQYEAK 363


>gi|311266781|ref|XP_003131241.1| PREDICTED: galactokinase-like [Sus scrofa]
          Length = 392

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/348 (18%), Positives = 108/348 (31%), Gaps = 48/348 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI--DSSLGQYCGSL 64
           ++ VSAPG + L+GEH   +    L  A+    +L  + R D L+++   S        L
Sbjct: 29  ELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVLVGSPRTDGLVSLLTTSEDADEPRRL 88

Query: 65  ------DLAMFHP----SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
                 D     P      +++   I H    P  GF   V+S +    GL SSA++ VA
Sbjct: 89  QFPLPTDKRPLEPGTPHWANYVKGVIQHYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVA 148

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS 168
               L  L                       G+  GI           G  +        
Sbjct: 149 TYTFLQQLCPDSGTIAAR-AQVCQRAEHSFAGVPCGIMDQLIALLGQKGHALLIDCRSLE 207

Query: 169 IEKIDFIFPIHLIYSG------------YKTPTAQVLKKISYI---------EIEYPEIN 207
              +    P   +               Y     Q  +    +           E     
Sbjct: 208 TSLVPLSDPKLAVLITNSNVRHSLGSSEYPLRRRQCEEVARALGKESLREVQREELEAGR 267

Query: 208 EI-----NQKIYALMG--KLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSE 259
           E+      ++   ++G  + +  +  AL   + +   + M      L     VS  +L +
Sbjct: 268 ELVSGEAFRRARHVVGEIQRTAQAAAALSRGDYRAFGRLMVESHHSLRDDYEVSCPELDQ 327

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +V      P +  S+++G G G C + L +    SL  Q +       
Sbjct: 328 LVEAALSAPGVYGSRMTGGGFGGCTVTLLEASAASLVMQHIQEQYSGA 375


>gi|262195906|ref|YP_003267115.1| galactokinase [Haliangium ochraceum DSM 14365]
 gi|262079253|gb|ACY15222.1| galactokinase [Haliangium ochraceum DSM 14365]
          Length = 392

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/359 (15%), Positives = 126/359 (35%), Gaps = 42/359 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           ++ V APG + L+GEH   +    L  AI++ V + LT      + + S   +      L
Sbjct: 24  RVVVRAPGRVNLIGEHTDYNDGFVLPMAIDRAVWIALTPELQPRLIVKSLDKKNVARCSL 83

Query: 67  AMFHP-------SFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
               P           +   +    + + G+   V+S++   +GL SS+A+ +A   A +
Sbjct: 84  KQMTPGTSDWFEYIKGVAWVLGREGRSTPGWQGLVVSEVPMGVGLASSSALALAAMRAFV 143

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH---GGLICYQMPKYSIEKIDFI 175
           +L      +         A    V      +D  AS     G ++      + +E +   
Sbjct: 144 SLAAGDWNAHQMAALVQRAEREWVGVSCGILDPLASAAGRRGHVMLVDCRSHELEYLPMP 203

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEI--------------EYPEINEINQ---------- 211
             + ++    ++    +                           I+++ +          
Sbjct: 204 EELAVVVLDTQSRRGLLDGSPHERRAQCQNAARTLGVPALRDATISDLERRGGMLDDTTL 263

Query: 212 ---KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +        ++ + +ALR+   + L + ++     L     VS++ L  +V   R  
Sbjct: 264 RRARHVITENARTKEAAEALRSGAYERLGELLDSSHESLRNDFEVSNAALDAMVRHARRH 323

Query: 268 PHIMASKISGSGLGDCVIALGKGDLNSLPYQS-VNCHMHAKGIDI--VPITPSHSTSLY 323
                ++++G+G G CV+AL + +  +    +  + ++   G      P  P+    + 
Sbjct: 324 AACYGARLTGAGFGGCVVALVRREALAAFIDATCSAYLAETGRRPHAYPCAPADGAGVA 382


>gi|261341341|ref|ZP_05969199.1| galactokinase [Enterobacter cancerogenus ATCC 35316]
 gi|288316648|gb|EFC55586.1| galactokinase [Enterobacter cancerogenus ATCC 35316]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/343 (18%), Positives = 121/343 (35%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCATRDDRTVRVIAADYDNEIDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APVVTHDTQQWSNYVRGVVKHLQQRNKNFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS----- 168
             L YH      +I         +  G + G +D   S  G     +             
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKEHALLIDCRSLGTKAVP 200

Query: 169 ------IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                 +  I+  F   L+ S Y T   Q      + +        ++E N+  + L   
Sbjct: 201 LPKGAAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLDEFNKVAHELDPT 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAACALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G C++AL   DL  +   +V     AK
Sbjct: 321 AAIGDNGGVRMTGGGFGGCIVALIPEDLVPVVQDAVAKQYEAK 363


>gi|218699122|ref|YP_002406751.1| galactokinase [Escherichia coli IAI39]
 gi|300939788|ref|ZP_07154426.1| galactokinase [Escherichia coli MS 21-1]
 gi|226709560|sp|B7NNH9|GAL1_ECO7I RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|218369108|emb|CAR16862.1| galactokinase [Escherichia coli IAI39]
 gi|300455320|gb|EFK18813.1| galactokinase [Escherichia coli MS 21-1]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIIAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|312793148|ref|YP_004026071.1| galactokinase [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180288|gb|ADQ40458.1| galactokinase [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 389

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/341 (16%), Positives = 116/341 (34%), Gaps = 47/341 (13%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G + L+GEH   +G      A+N    + +  R D  I + ++  +     D+       
Sbjct: 28  GRVNLIGEHTDYNGGYVFPAALNVGTTVLVRKRNDNKIRLYATDLKELIEADIDRIDEYK 87

Query: 74  SF---------IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
           +          +           G D+     +    GL SSAAI  A   A+ +L   K
Sbjct: 88  NIRWGNYQLGVVKELKEEGYEVGGVDMLFHDTVPHGAGLSSSAAIECATGIAVYSLFNSK 147

Query: 125 EPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQMPKYS 168
                ++         +  G++ G +D  AS  G                 +  ++  Y 
Sbjct: 148 PIDKLKLSFICQRAENRFVGVNCGIMDQFASSLGKKDHAIFLNTRTMEYRYVPLKLGDYK 207

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------------EYPEINE---I 209
           I   +      L  S Y    +Q  K +  ++                 +Y ++ +   I
Sbjct: 208 IVISNTNKKRSLADSKYNERRSQCEKGLELLKKELNISCLGELDVETFEKYKDLIDDEII 267

Query: 210 NQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
            +++  +         S   L+  +L+   + M +    L     V+  +L  +  +  +
Sbjct: 268 LKRVRHVVYEDDRVLKSIDVLQKGDLEAFGKLMIQSHISLRDDYEVTGLELDTLFDEALK 327

Query: 267 QPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              ++ S+++G+G G C +++   D      + V  +  AK
Sbjct: 328 IEGVIGSRMTGAGFGGCTVSIVHKDAIEEFVRKVGENYRAK 368


>gi|145297310|ref|YP_001140151.1| galactokinase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850082|gb|ABO88403.1| galactokinase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/341 (15%), Positives = 106/341 (31%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDL 66
           V APG + L+GEH   +    L  AI+    + + LR D  + +   D    +    L  
Sbjct: 23  VRAPGRVNLIGEHTDYNDGFVLPCAIDYETCVAIGLRNDSQVQVIAADYDNQRDRFDLHQ 82

Query: 67  AMFHP----SFSFIIMAINHIKPS----CGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
            + H        ++   + +++       G +L V   +    GL SSA++ VAI  A  
Sbjct: 83  PIEHHPSQRWSDYVRGVVKYLQERGQALHGLNLVVSGNVPQGAGLSSSASLEVAIGQAFK 142

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---ICYQMPKYSIEKIDFI 175
                     +  L    A    V      +D   S  G     +           I   
Sbjct: 143 EALGLHISQAEIALNGQQAENQFVGCNCGIMDQMISASGKQDHALLIDCRSLETRLIPMP 202

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                             E+  
Sbjct: 203 SDLAVLIVNSNVRRGLVDSEYNTRRQQCETAARHYGVKALRDLDLTALEAGKAGLDEVCY 262

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +        +  +  AL + +L  L Q M      +     ++   +  +V  ++ +
Sbjct: 263 RRARHVVGDNTRTLAAADALESGDLVRLGQLMAESHAAMRDDFEITVPPIDGLVEIIKAR 322

Query: 268 PH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL +    +    +V+    A+
Sbjct: 323 LGREGGVRMTGGGFGGCVVALLRPAQVAEVIAAVDAEYPAR 363


>gi|241896117|ref|ZP_04783413.1| mevalonate kinase [Weissella paramesenteroides ATCC 33313]
 gi|241870631|gb|EER74382.1| mevalonate kinase [Weissella paramesenteroides ATCC 33313]
          Length = 312

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 67/318 (21%), Positives = 131/318 (41%), Gaps = 12/318 (3%)

Query: 5   LHK--ICVSAPGSLVLMGEHGVLHGHAALVFAI-NKRVILYLTLRKDRLINIDSSLGQYC 61
           + K  I VS    ++L+GEH V++G  A+   + +  + + +  R+   + +  S     
Sbjct: 1   MKKPGIGVS-HAKVILLGEHAVVYGQPAIALPLTDLAMTVKIESREAGQVVLSQSYQGPL 59

Query: 62  GSLDLAMFHPSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
            ++   ++      I   + H K     F + + S +  + G+GSSAA  +AI  A    
Sbjct: 60  VAM-AEVYEGIRQLINRLLQHFKSDEMPFTMTITSNIPQERGMGSSAATAIAIVRAFFDF 118

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY-QMPKYSIEKIDFIFPIH 179
            + +  S  E+   A        G  SG+D A + H   + + +  +     +     + 
Sbjct: 119 -FDESLSKQELQRWASIEEAITHGSPSGLDTATAAHDEAVWFIKGQQPEKIDMSLDGTLI 177

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           L  +G +  T   +  +       P   E+ Q+    +G++ + + +A+   NL  +   
Sbjct: 178 LADTGIQGQTGLAISVVREHLTNDP---EVGQQHIDKIGEIVKATREAIAENNLAKIGHF 234

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQS 299
           MN  Q  L  LG+S  KL E++   R     + +K++G G+G  +IA+ K D  +     
Sbjct: 235 MNEAQKHLSALGISHPKLDELIMAAR-HAGALGAKLTGGGVGGTMIAITKDDEQTARVIK 293

Query: 300 VNCHMHAKGIDIVPITPS 317
                 A+ +     T  
Sbjct: 294 ALEDAGAQEVWTQNYTND 311


>gi|208230|gb|AAA72509.1| galK [unidentified cloning vector]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|331645901|ref|ZP_08347004.1| galactokinase [Escherichia coli M605]
 gi|330910501|gb|EGH39011.1| galactokinase [Escherichia coli AA86]
 gi|331044653|gb|EGI16780.1| galactokinase [Escherichia coli M605]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQVRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAAIALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|260773819|ref|ZP_05882734.1| galactokinase [Vibrio metschnikovii CIP 69.14]
 gi|260610780|gb|EEX35984.1| galactokinase [Vibrio metschnikovii CIP 69.14]
          Length = 386

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/342 (17%), Positives = 111/342 (32%), Gaps = 43/342 (12%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQYCGSLDL- 66
            V APG + L+GEH   +    L  AIN + ++    R D L+ + S   G      D+ 
Sbjct: 23  IVQAPGRVNLIGEHTDYNDGFVLPCAINYQTMVAAAKRTDNLVRVVSVDYGNEVDEFDIT 82

Query: 67  --------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    M+       +   +       G D+ V   +    GL SSAA+ V I    
Sbjct: 83  EDILFQQDKMWANYIRGVVKCLLARGYQFTGADISVSGNVPQGAGLSSSAALEVVIGQTF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDF 174
             L   +    D  L    A    V      +D   S  G     +         E +  
Sbjct: 143 KVLFNLEISQADIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRSLDTEAVSM 202

Query: 175 IFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPEINEINQKI 213
              + ++          V  + +    +                       ++ E+++ I
Sbjct: 203 PEDMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVTALRDVTIEQFNEKVVELDEMI 262

Query: 214 YALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
                 +   +       QALR  ++K++ + M      +     ++  ++  +V  +++
Sbjct: 263 AKRARHVITENDRTLAAAQALRAHDMKLMGELMAESHASMRDDFEITVQEIDTLVEMVKD 322

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              I    +++G G G CV+AL    L      +V     A 
Sbjct: 323 VIGIQGGVRMTGGGFGGCVVALVPPALVDAVKATVEAKYQAA 364


>gi|146310906|ref|YP_001175980.1| galactokinase [Enterobacter sp. 638]
 gi|166989671|sp|A4W899|GAL1_ENT38 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|145317782|gb|ABP59929.1| galactokinase [Enterobacter sp. 638]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/357 (19%), Positives = 126/357 (35%), Gaps = 48/357 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDLAM 68
           APG + L+GEH   +    L  AI+ + ++    R DR++ +   D        SLD  +
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAKRDDRIVRVIAADYDNQTDEFSLDEPI 84

Query: 69  FHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                    +++   + H++       G DL +   +    GL SSA++ VA+      L
Sbjct: 85  VAHDTQQWSNYVRGVVKHLQMRNKGFGGADLVIAGNVPQGAGLSSSASLEVAVGTVFQQL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS-------- 168
            YH      +I         +  G + G +D   S  G     +                
Sbjct: 145 -YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKEHALLIDCRSLGTKAVPLPK 203

Query: 169 ---IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGKLSQ 222
              +  I+  F   L+ S Y T   Q      + +        +NE N+  + L   +++
Sbjct: 204 GAAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLNEFNKVAHELDPVVTK 263

Query: 223 ISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                            AL   +LK + + M      +     ++  ++  +V  ++   
Sbjct: 264 RVRHVLTENARTVEAASALAQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVKATI 323

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                 +++G G G CV+AL   +       +V+    AK GI +   +  PS    
Sbjct: 324 GDKGGVRMTGGGFGGCVVALIPEEWVPAVQDAVSQQYEAKTGIKETFYVCKPSQGAG 380


>gi|260881482|ref|ZP_05404506.2| galactokinase [Mitsuokella multacida DSM 20544]
 gi|260848541|gb|EEX68548.1| galactokinase [Mitsuokella multacida DSM 20544]
          Length = 396

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 67/364 (18%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      AI+      +  RKD    I S      G ++      
Sbjct: 30  SPGRVNLIGEHTDYNGGHVFPCAISLGTYAVVADRKDMTTRIYSMNLADKGIIEFPMTGL 89

Query: 66  ----LAMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++            GFD+ +   L +  GL SSA++ V  +  L  
Sbjct: 90  SYDAAKDWANYPMGVVDVFEKAGHKATHGFDILIYGTLPAGAGLSSSASLEVLTSVILNE 149

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLIC---------------YQM 164
                    + +  +  A    V      +D  A   G   C                 +
Sbjct: 150 AFGFGLDMIEMVKLSQKAENQFVGVNCGIMDQFAVGMGKKDCAILLDCNTLAYRYSKIAL 209

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP------------------EI 206
              SI   +   P  L  S Y    AQ    ++ ++   P                   I
Sbjct: 210 EDASIVITNTNKPHSLASSAYNVRRAQCEHALNELKEVKPGLKALGELGNDEFNQIAGHI 269

Query: 207 NEINQKIYALM----GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
            E+ ++  A         +  + +AL N ++K   + MN     L     V+  +L  + 
Sbjct: 270 EEVLERHRARHAVYENNRTLDAVKALENNDVKEFGRLMNESHFSLRDDYEVTGKELDTLA 329

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ S+++G+G G   ++L K D      ++V      K G     +  S S 
Sbjct: 330 EIAWQQDGVIGSRMTGAGFGGSTVSLVKNDAIEAFKKNVGEQYTKKIGYAPSFVVASISD 389

Query: 321 SLYR 324
             +R
Sbjct: 390 GTHR 393


>gi|261418018|ref|YP_003251700.1| galactokinase [Geobacillus sp. Y412MC61]
 gi|319767168|ref|YP_004132669.1| galactokinase [Geobacillus sp. Y412MC52]
 gi|261374475|gb|ACX77218.1| galactokinase [Geobacillus sp. Y412MC61]
 gi|317112034|gb|ADU94526.1| galactokinase [Geobacillus sp. Y412MC52]
          Length = 396

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/359 (15%), Positives = 111/359 (30%), Gaps = 50/359 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG + L+GEH   +G   L  A+       +    +  + + S      G +       
Sbjct: 27  APGRVNLIGEHTDYNGGHVLPCALEIGTYALVRQTDEPFVRLYSQNFSETGVITVSYDDL 86

Query: 65  ---DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                  +      I+ A   + P   G D+     + +  GL SSA+I +     L  L
Sbjct: 87  SYRSEHGWANYPKGILAAFQALSPLETGLDILYYGTIPNGAGLSSSASIELVTAVMLNEL 146

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL-----------ICYQM----- 164
            + +     E++  +  +  K  G++ GI    ++  G            + Y+      
Sbjct: 147 -FRRGLDQLELVKMSQTVENKYVGVNCGIMDQFAVGMGKQDCAILLNCQTLEYRYLPLVL 205

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIE--IEYPEINEINQKIYALMGK--- 219
              SI   +      L  S Y    A     ++ ++       + E+     A       
Sbjct: 206 NDCSIVIANTNKKRGLADSAYNERRATCEAALAKLQSVRNIASLGELTSAELARYAHLLS 265

Query: 220 ---------------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                           +  + +AL   +L    + M +    L     V+  +L  +V  
Sbjct: 266 PLEQKRARHAVMENERTLEAARALERGDLIHFGELMKQSHLSLRNDYEVTGVELDTLVEA 325

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
                  + ++++G+G G C + + K        + V      K G +           
Sbjct: 326 AWSHEGTVGARMTGAGFGGCTVNIVKKACVQDFIERVGNAYAEKIGYEASFYVVEVGDG 384


>gi|228993546|ref|ZP_04153454.1| Galactokinase [Bacillus pseudomycoides DSM 12442]
 gi|228766137|gb|EEM14783.1| Galactokinase [Bacillus pseudomycoides DSM 12442]
          Length = 393

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 122/361 (33%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      AI        + R D LI   S      G        L
Sbjct: 24  APGRINLIGEHTDYNGGNVFPCAITFGTYALASKRDDALICAYSLNFPEKGVISFSLQEL 83

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D    H   ++    I ++         G ++     + +  GL SSA+I +     +  
Sbjct: 84  DYKQEHDWANYPKGMIRYLIEAGYSIDSGINIMFYGNIPNGAGLSSSASIELVTGVTMEG 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY----------------Q 163
           L +  E    E++     +     G++SGI    +I  G   Y                Q
Sbjct: 144 L-FQFELDRIELVKIGKKVENYFIGVNSGIMDQFAIGMGKARYGMLLNCQTLNFTYAPLQ 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM---- 217
           +  Y+I  ++      L  S Y     +  + ++ ++   +   + E+ +K++       
Sbjct: 203 LDNYNIIIMNTNKRRELTASKYNERRMECEQALAKLQEVIDISSLGELTEKMFEQYKHVI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  S + L+  N+K   + MN     L     V+  +L  +V
Sbjct: 263 KEDSLRKRAKHVVYENCRTLQSVKELKENNIKEFGRLMNESHCSLRDDYEVTGRELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C I + + +       +V        G +          
Sbjct: 323 ESAWKQEGVIGARMTGAGFGGCAIVIVEKEYTDQFICNVGQKYRDTIGYEATFYVAEIGD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|228999581|ref|ZP_04159158.1| Galactokinase [Bacillus mycoides Rock3-17]
 gi|228760107|gb|EEM09076.1| Galactokinase [Bacillus mycoides Rock3-17]
          Length = 387

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 122/361 (33%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      AI        + R D LI   S      G        L
Sbjct: 18  APGRINLIGEHTDYNGGNVFPCAITFGTYALASKRDDALICAYSLNFPEKGVISFSLHEL 77

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D    H   ++    I ++         G ++     + +  GL SSA+I +     +  
Sbjct: 78  DYKQEHDWANYPKGMIRYLIEAGYSIDSGINIMFYGNIPNGAGLSSSASIELVTGVTMEG 137

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY----------------Q 163
           L +  E    E++     +     G++SGI    +I  G   Y                Q
Sbjct: 138 L-FQFELDRIELVKIGKKVENYFIGVNSGIMDQFAIGMGKARYGMLLNCQTLNFTYAPLQ 196

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM---- 217
           +  Y+I  ++      L  S Y     +  + ++ ++   +   + E+ +K++       
Sbjct: 197 LDNYNIIIMNTNKRRELTASKYNERRMECEQALAKLQEVIDISSLGELTEKMFEQYKHVI 256

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  S + L+  N+K   + MN     L     V+  +L  +V
Sbjct: 257 KEDSLRKRAKHVVYENCRTLQSVKELKENNIKEFGRLMNESHCSLRDDYEVTGRELDTLV 316

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C I + + +       +V        G +          
Sbjct: 317 ESAWKQEGVIGARMTGAGFGGCAIVIVEKEYTDQFICNVGQKYRDTIGYEATFYVAEIGD 376

Query: 321 S 321
            
Sbjct: 377 G 377


>gi|50424525|ref|XP_460851.1| DEHA2F11176p [Debaryomyces hansenii CBS767]
 gi|49656520|emb|CAG89196.1| DEHA2F11176p [Debaryomyces hansenii]
          Length = 433

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 77/377 (20%), Positives = 132/377 (35%), Gaps = 70/377 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQYCGSLDL 66
             VSAPG +++ GEH  ++G  A+  A++ R  L +T  +D   I +D        S + 
Sbjct: 6   FLVSAPGKVIIYGEHSAVYGKPAIAAALSLRAYLLVTPCEDVNDIRLDFPDIGLSHSWNK 65

Query: 67  AM-------------------------------------------FHPSFSFIIMAINHI 83
                                                        +     F+ +  N  
Sbjct: 66  ENIPWEDIRKFVTFKDEKPVVTEELVPEIVDLLSTVLADVESKLHYTACLCFLYLYANLS 125

Query: 84  KPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH---------------KEPS 127
                G    V S L    GLGSSA   V + +AL  L  H               +   
Sbjct: 126 NKDVPGMRFIVKSTLPIGAGLGSSACTAVCLASALARLGKHVSAACHTSTEKVYKKENSD 185

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI-------DFIFPIHL 180
            D I + +        G  SGID A + +GG + +Q      +              + L
Sbjct: 186 LDFIDSWSLMGEKCFHGNPSGIDNAVATYGGAVMFQRTTIPSKPSVRTTMRNFPPIKLIL 245

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQ-ALRNKNLKVLAQ 238
           I +     TA ++  ++ +   YP+    I   +  L+ +  QI  + +   +    L +
Sbjct: 246 INTKVPRSTAALVGNVAQVNRTYPKCAGSILDAMEHLVFEAYQIMIRPSFGKEEKDQLRE 305

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ 298
            +N   GLL  LGVS   L + +  + +   I ++K++G+G G C I+L   D+     Q
Sbjct: 306 LVNINHGLLVALGVSHPALEK-IKIIGDTHGIGSTKLTGAGGGGCAISLVHDDVEEEVIQ 364

Query: 299 SVNCHMHAKGIDIVPIT 315
                   +G +    +
Sbjct: 365 KAIKEFENEGYETFETS 381


>gi|312877981|ref|ZP_07737922.1| galactokinase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795255|gb|EFR11643.1| galactokinase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 389

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/341 (16%), Positives = 115/341 (33%), Gaps = 47/341 (13%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G + L+GEH   +G      A+N    +    R D  I + ++  +     D+       
Sbjct: 28  GRVNLIGEHTDYNGGYVFPAALNVGTTVLARKRNDNKIRLYATDLKELIEADIDRIDEYK 87

Query: 74  SF---------IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
           +          +           G D+     +    GL SSAAI  A   A+ +L   K
Sbjct: 88  NIRWGNYQLGVVKELKEEGYEVGGVDMLFHDTVPHGAGLSSSAAIECATGIAVYSLFNSK 147

Query: 125 EPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQMPKYS 168
                ++         +  G++ G +D  AS  G                 +  ++  Y 
Sbjct: 148 PIDKLKLSFICQRAENRFVGVNCGIMDQFASSLGKKDHAIFLNTRTMEYRYVPLKLGDYK 207

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------------EYPEINE---I 209
           I   +      L  S Y    +Q  K +  ++                 +Y ++ +   I
Sbjct: 208 IVISNTNKKRSLADSKYNERRSQCEKGLELLKKELNISCLGELDVETFEKYKDLIDDEII 267

Query: 210 NQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
            +++  +         S   L+  +L+   + M +    L     V+  +L  +  +  +
Sbjct: 268 LKRVRHVVYEDDRVLKSIDVLQKGDLEGFGKLMIQSHISLRDDYEVTGLELDTLFDEALK 327

Query: 267 QPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              ++ S+++G+G G C +++   D      + V  +  AK
Sbjct: 328 VEGVIGSRMTGAGFGGCTVSIVHKDAVEEFVRKVGENYRAK 368


>gi|295096548|emb|CBK85638.1| galactokinase [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/343 (18%), Positives = 120/343 (34%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAKRDDRQVRVMAADYGNEIDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQKRNKNFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS----- 168
             L YH      +I         +  G + G +D   S  G     +             
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKEHALLIDCRSLGTKAVP 200

Query: 169 ------IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                 +  I+  F   L+ S Y T   Q      + +        ++E N+  + L   
Sbjct: 201 LPKGAAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLDEFNKVAHELDPV 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VTKRVRHILTENARTVEAASALAKGDLKRMGELMAESHSSMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G CV+AL   +L      +V     AK
Sbjct: 321 ATIGDKGGVRMTGGGFGGCVVALVPEELVPAIQDAVAKQYEAK 363


>gi|240281233|gb|EER44736.1| mevalonate kinase [Ajellomyces capsulatus H143]
          Length = 552

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 137/382 (35%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQY----- 60
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I ++    +      
Sbjct: 106 FMVSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD 165

Query: 61  CGSLDLAMFHPSFS--------------------------------------------FI 76
             SL   +FH                                                F+
Sbjct: 166 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDEVRKIHQSSATAFL 225

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+I V ++AA               L   
Sbjct: 226 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQLPEE 285

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
            E   + I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 286 AETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 345

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     T+  + K++     +P ++E     I+Q   +    +         ++ 
Sbjct: 346 LLLVNSRQPRSTSVEVAKVANFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSEA 405

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +      +K++G+G G C I L + ++
Sbjct: 406 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHTGSGWTKLTGAGGGGCAITLLRTNI 464

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           +    + +   +  +G +    
Sbjct: 465 DPAALKRLEKTLDDEGFERYET 486


>gi|157146617|ref|YP_001453936.1| galactokinase [Citrobacter koseri ATCC BAA-895]
 gi|166216970|sp|A8AJ37|GAL1_CITK8 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|157083822|gb|ABV13500.1| hypothetical protein CKO_02378 [Citrobacter koseri ATCC BAA-895]
          Length = 382

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 120/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCATRDDRKVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQKRNNAFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEI 206
                ++  I+  F   L+ S Y T   Q                 L   + +  E   I
Sbjct: 201 MPEGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLAAFNAVASELDPI 260

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G CV+AL    L     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCVVALLPEALVPAVQQAVATQYEAKTGIKETFYVCKPSQGAG 380


>gi|145636621|ref|ZP_01792288.1| galactokinase [Haemophilus influenzae PittHH]
 gi|145270147|gb|EDK10083.1| galactokinase [Haemophilus influenzae PittHH]
          Length = 384

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 119/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +   +R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGAIRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L  +   S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GNLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|325475074|gb|EGC78260.1| galactokinase [Treponema denticola F0402]
          Length = 399

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/363 (17%), Positives = 128/363 (35%), Gaps = 53/363 (14%)

Query: 2   GQCLHKICVSA-PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G    KI  +A P  + ++GEH   +G   L  A+N  + + L  RKD+ I   S   + 
Sbjct: 21  GNSEEKIIFAASPARINIIGEHIDYNGGLVLPAAVNLYLRIALRKRKDKKILYRSMKAEK 80

Query: 61  CGSLDLA---------MFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAI 109
               +L           F    + + + +    +K   GF+L + S +    G+ SSAA+
Sbjct: 81  VFEFELDGNLGFDKENDFANYLNGMFLFLKERGLKADTGFELLITSDIPQGSGISSSAAL 140

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------- 158
            +     +      +    +            +   S  +D  A   G            
Sbjct: 141 ELCFGKIISHAFGFELDGIEFAKIGRRVENEFLGLKSGIMDQFAIAMGKKNQALLLDTSS 200

Query: 159 ----LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE------------ 202
                I  +   Y I  ++   P  L  S Y     +  K +++++ +            
Sbjct: 201 LDYEYIPLETEPYRIVIMNSNKPRKLTESKYNERKEECEKALAFLQKKTDIDFLCDLSVS 260

Query: 203 ------YPEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-T 249
                    I+ + +KI+  +              +AL+NK+LK+L  ++N+    L+  
Sbjct: 261 DFEKLEEDLISNLGEKIFRRVRHCVTEMDRVRRSAEALKNKDLKLLGASLNQSHLSLKDD 320

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKG 308
             V+  +L  + +   ++   + ++++G+G   C IA+   D      + V        G
Sbjct: 321 YEVTGKELDALFFAAIKEKSCIGARMTGAGFSGCAIAIVHKDGFEEFAERVGKAYTENTG 380

Query: 309 IDI 311
              
Sbjct: 381 FTA 383


>gi|146320198|ref|YP_001199909.1| galactokinase [Streptococcus suis 98HAH33]
 gi|145691004|gb|ABP91509.1| Galactokinase [Streptococcus suis 98HAH33]
          Length = 378

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/344 (15%), Positives = 116/344 (33%), Gaps = 49/344 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI          R D+++   S+  +  G +++ + + 
Sbjct: 12  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNL 71

Query: 72  SF-------SFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F       ++    +  +K        G ++ V   + +  GL SSA++ + I      
Sbjct: 72  VFDKADNWTNYAKGVLKFLKEAGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEE 131

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L   +    D +          +   S  +D  A   G                 +   +
Sbjct: 132 LYGLELTRLDLVKIGKQTENHFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDL 191

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM----- 217
             + I  ++      L  S Y    A+  K +  +        + E+++  +        
Sbjct: 192 GDHVIVIMNTNKRRELADSKYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIK 251

Query: 218 --------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
                          + +  + +AL   +L    + +N     LE    V+  +L  +  
Sbjct: 252 DENRIKRARHAVLENQRTLQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAH 311

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
              EQ  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 312 TAWEQEGVLGARMTGAGFGGCGIAIVHKDKVEAFKENVGKTYTE 355


>gi|77406174|ref|ZP_00783245.1| galactokinase [Streptococcus agalactiae H36B]
 gi|77175214|gb|EAO78012.1| galactokinase [Streptococcus agalactiae H36B]
          Length = 390

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/357 (16%), Positives = 128/357 (35%), Gaps = 55/357 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+L+   SS  +  G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRNDQLLRFYSSNFEDIGVIEVNLNNL 83

Query: 67  -----AMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      ++  +         G D+ V   + +  GL SSA++ + I      
Sbjct: 84  VYNKADNWANYAKGVLKFLQEAGHTIDTGMDIYVSGNIPNGSGLSSSASLELLIGIMAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           + ++ +    +++        K  G++SGI    +I  G                 +  +
Sbjct: 144 I-FNLKLDRLDLVKIGKQTENKFIGVNSGIMDQFAIGMGADKQAIYLDTNSLAYDLVPLE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  ++I      + ++++  +       
Sbjct: 203 LGDNIVVIMNTNKRRELADSKYNERRAECEKAVEELQIALDIKTLGDLDEATFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL + +L    + +N     LE    V+  +L  +V
Sbjct: 263 KDANRLKRARHAVSENQRTLKAKEALISGDLLRFGRLINASHVSLEHDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
               EQ  ++ ++++G+G G C IA+   D       +V         +I+  +PS 
Sbjct: 323 HTAWEQDGVLGARMTGAGFGGCAIAIVAKDNVKQFTANVGKIYS----EIIGYSPSF 375


>gi|257468985|ref|ZP_05633079.1| galactokinase [Fusobacterium ulcerans ATCC 49185]
 gi|317063233|ref|ZP_07927718.1| galactokinase [Fusobacterium ulcerans ATCC 49185]
 gi|313688909|gb|EFS25744.1| galactokinase [Fusobacterium ulcerans ATCC 49185]
          Length = 391

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/347 (16%), Positives = 119/347 (34%), Gaps = 52/347 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--------- 62
           +PG + L+GEH   +G      A++      +  R D +  + S   +  G         
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKRRDDNIFRMYSKNFEKLGTKEFSLDKL 83

Query: 63  -SLDLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            +     +      +I        K   GFD+     + +  GL SSA+I + +T+ +L 
Sbjct: 84  INTPSDNWANYPKGVIKTFIDAGYKIDKGFDVMFFGNIPNGAGLSSSASIEL-LTSVILK 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
             +  +    E++  +     +  G++ G +D  A   G                    +
Sbjct: 143 EIFKLDIDMVEMVKLSQKAENEFIGVNCGIMDQFAIGMGKKDNAILLDCNTLEYHYATVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE-----------YPEINEINQK 212
           +   SI   +      L  S Y          +  +                + NE+   
Sbjct: 203 LDGASIVIANTNKKRGLADSKYNERRNSCEAAVKVLNENGINIKNLGELSVEKFNEVKHF 262

Query: 213 IYAL-----------MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
           I                + ++ + + L + +++   + MN+    L     V+  +L  +
Sbjct: 263 ITDEEQLKRATHAVTENERTKTAVEKLNSGDVEAFGKLMNQSHISLRDDYEVTGFELDSL 322

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V    E   ++ ++++G+G G C +++ K +      +SV     AK
Sbjct: 323 VEAAWEAKGVIGARMTGAGFGGCTVSIVKDEFIDEFIKSVGEKYKAK 369


>gi|320196749|gb|EFW71372.1| Galactokinase [Escherichia coli WV_060327]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRSVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALFPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|86516644|gb|ABC98014.1| GalK [Shigella dysenteriae]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 124/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHESYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALSKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|15800466|ref|NP_286478.1| galactokinase [Escherichia coli O157:H7 EDL933]
 gi|25287398|pir||B85578 galactokinase [imported] - Escherichia coli (strain O157:H7,
           substrain EDL933)
 gi|12513686|gb|AAG55086.1|AE005253_8 galactokinase [Escherichia coli O157:H7 str. EDL933]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|284920538|emb|CBG33600.1| galactokinase [Escherichia coli 042]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAACALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|260597149|ref|YP_003209720.1| galactokinase [Cronobacter turicensis z3032]
 gi|260216326|emb|CBA29322.1| Galactokinase [Cronobacter turicensis z3032]
          Length = 373

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/358 (15%), Positives = 114/358 (31%), Gaps = 48/358 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLDLAM 68
           APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD  +
Sbjct: 16  APGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAKRDDRRVRVIAADYDNETDEFSLDEPI 75

Query: 69  FHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                    +++   + H++       G DL +   +    GL SSA++ VA+      L
Sbjct: 76  LTHDSQQWSNYVRGVVKHLQQRDPGFGGADLVISGNVPQGAGLSSSASLEVAVGTVFRHL 135

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKIDFIF 176
            Y       +I         +  G + G +D   S  G     +         + +    
Sbjct: 136 -YRLSLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVPMPQ 194

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ------------------------- 211
            + ++          V  + +    +                                  
Sbjct: 195 GVAVVIINSNFKRTLVGSEYNTRREQCETGARFFTQKALRDVSLDQFNAVAHELDPIVAK 254

Query: 212 --KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
             +        +  +  AL   +L  + + M +    +     ++  ++  +V  ++   
Sbjct: 255 RVRHVLTENARTVEAADALAKGDLTRMGELMAQSHASMRDDFEITVPQIDTLVEIVKSVI 314

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTSL 322
                 +++G G G CV+AL    +      +V     A+ GI +   +  PS    L
Sbjct: 315 GDKGGVRMTGGGFGGCVVALVPEAIVPEVQAAVEAQYEARTGIKETFYVCKPSEGAGL 372


>gi|224075148|ref|XP_002190125.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 454

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/358 (17%), Positives = 116/358 (32%), Gaps = 51/358 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           APG + L+GEH   +G   L  A+    +L  +  +D  I+I ++  +      +    P
Sbjct: 96  APGRVNLIGEHTDYNGGFVLPMALQLGTVLVGSPTQDGTISIVTTSAEADEPRRVQFLAP 155

Query: 72  ------------SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                         +++   I H    P  GF   + S +    GL SSAA+ VA    L
Sbjct: 156 RAGSSLSPGLPRWANYVKGVIQHYRGGPVPGFSAVMASDIPLGGGLSSSAALEVATYTFL 215

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIH---GGLICYQMPKYSIEKID 173
             L    +                  G+  G +D   S+    G  +           + 
Sbjct: 216 QQLC-PDDGDLVAKALACQKAEHTFAGMPCGIMDQFISVMGREGHALLIDCRSLETVLVP 274

Query: 174 F------------IFPIHLIYSGYKTPTAQVLKKISYIEI--------------EYPEIN 207
                             L  S Y     Q  +  + +                     +
Sbjct: 275 LSDASLAVLITNSNVRHTLTGSEYPARRRQCEEAAAALGKASLRDATLAELEEARSRLGD 334

Query: 208 EINQKIYALMGK--LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           E+ ++   ++G+   +  + QAL++++ +   + M      L     VS  +L E+V   
Sbjct: 335 EVFRRARHVIGEIARTAQAAQALQHRDYRTFGRLMVESHNSLRDDYEVSCPELDELVAAA 394

Query: 265 REQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPIT-PSHSTS 321
            E   +  S+++G G G C + L +        Q +       G     +T PS    
Sbjct: 395 LEVDGVYGSRMTGGGFGGCTVTLLEAGAADRAQQHIQEKYS--GTATFYLTKPSGGAK 450


>gi|154321109|ref|XP_001559870.1| hypothetical protein BC1G_01429 [Botryotinia fuckeliana B05.10]
 gi|150851967|gb|EDN27159.1| hypothetical protein BC1G_01429 [Botryotinia fuckeliana B05.10]
          Length = 498

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 76/387 (19%), Positives = 140/387 (36%), Gaps = 74/387 (19%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQ 59
              +    VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I++      
Sbjct: 48  SPMMPPFMVSAPGKVIVFGEHAVVHGKPAIAAAISLRSYLLVTSLSKSKRTISLRFPDIN 107

Query: 60  YCGSLDLAMF------HPS----------------FSFIIMAINHIKPS----------- 86
              + ++         HPS                 + +   + +I P            
Sbjct: 108 LSHTWNIDDLPWSTFSHPSKKKHYYDEVTSLDPELVAAMKPHLENISPDESPAIRKIHQS 167

Query: 87  -----------------CGFDLKVISQLDSQLGLGSSAAITVAITAA------------L 117
                             G    + S +    GLGSSA+I+V +++A             
Sbjct: 168 SASSFLYIFLSLGSQSFPGCLYTLRSTIPIGAGLGSSASISVCLSSALLLQIRTLSGPHP 227

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK--YSIEKI--D 173
                      + I   A    + + G  SG+D   S  G  + YQ      +++ +   
Sbjct: 228 DQPSNEASLQLERINRWAFVGEMCIHGNPSGVDNTVSTQGKAVIYQKSPDGPTVKPLRNF 287

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN--- 230
              P+ L+ +     TA  + K+  ++ ++P I +       ++G+ + +          
Sbjct: 288 PELPLLLVDTQQAKSTAHEVAKVDLLKQKHPAIVDSILNAIDMVGQSAAVMISDPEYDSE 347

Query: 231 --KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALG 288
             K ++ L + M    GLL +LGVS  +L   + +L +   I  +K++G+G G C I L 
Sbjct: 348 DLKCVEDLGKLMTVNHGLLVSLGVSHPRLER-IRELVDHEGIGWTKLTGAGGGGCSITLL 406

Query: 289 KGDLNSLPYQSVNCHMHAKGIDIVPIT 315
           K          +   +  +G      T
Sbjct: 407 KPGTTHDRMTRLEETLETEGYKKFETT 433


>gi|153802410|ref|ZP_01956996.1| galactokinase [Vibrio cholerae MZO-3]
 gi|124122074|gb|EAY40817.1| galactokinase [Vibrio cholerae MZO-3]
          Length = 405

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/341 (17%), Positives = 103/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D  +    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDSQVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEIN------------------------- 210
             + ++          V  + +    +     +                           
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVT 282

Query: 211 --QKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMPRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPKQVEAVQQAVAEHYEAA 383


>gi|268316061|ref|YP_003289780.1| galactokinase [Rhodothermus marinus DSM 4252]
 gi|262333595|gb|ACY47392.1| galactokinase [Rhodothermus marinus DSM 4252]
          Length = 414

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/338 (17%), Positives = 107/338 (31%), Gaps = 45/338 (13%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL------- 66
           G + L+G+H   +    L   +++ V L +  R DR + + S         ++       
Sbjct: 34  GRVNLIGDHTDYNDGFVLPMTLDRAVYLAVRPRPDREVRLLSLNFDETIRFEIGTPPTET 93

Query: 67  AMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE 125
             +      ++  +        GF+  +   +    GL SSAA+ VA    L  L     
Sbjct: 94  PRWAAYVQGVVTELHRRALLPNGFEGVLYGDVPLGSGLSSSAALEVATLVTLQHLFGFAM 153

Query: 126 PSPDEILTTAHAIVLKVQGISSGIDLAASIHG--GLICY---QMPKYSIEKIDFIFPIHL 180
              +      +     V      +D  A+  G  G   +   +   Y    +     + +
Sbjct: 154 SGEEAARLCQYVEHTYVGVQCGIMDQFAARLGRRGHALFLDCRSLAYRHVPVHLKDWLFV 213

Query: 181 IYS----------GYKTPTAQVLKKISYIEIEYPEINEINQK---------------IYA 215
           I             Y    A+    +++     PEI  +                  I+ 
Sbjct: 214 IIDSRAPRELAASRYNERRAECEAGVAFFRRFDPEIRALRDVSPELLWAHPDQPTPTIWR 273

Query: 216 LMGKLSQISCQA------LRNKNLKVLAQAMNRQQGLLETLG-VSDSKLSEIVWKLREQP 268
               + + + +       L    L+   Q MN     L  L  VS   L  IV   R+  
Sbjct: 274 RCRHVVEENRRVQEAVVDLEQDRLEAFGQRMNASHDSLRDLYEVSSPALDLIVDTARQVE 333

Query: 269 HIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
            ++ ++++G+G G C + L   D      Q V     A
Sbjct: 334 GVLGARLTGAGFGGCTVVLLHRDALPELEQRVARAYEA 371


>gi|293409135|ref|ZP_06652711.1| galactokinase [Escherichia coli B354]
 gi|291469603|gb|EFF12087.1| galactokinase [Escherichia coli B354]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRNDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHESYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|291616755|ref|YP_003519497.1| GalK [Pantoea ananatis LMG 20103]
 gi|291151785|gb|ADD76369.1| GalK [Pantoea ananatis LMG 20103]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 54/340 (15%), Positives = 108/340 (31%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSLD--- 65
           APG + L+GEH   +    L  AI+ + ++    R DR +    +D    Q   SLD   
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAKRDDRQVRVVAVDYDQAQDIFSLDAPI 84

Query: 66  ----LAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                 M+      ++  +    P   G D+ +   +    GL SSA++ VA+      L
Sbjct: 85  TSVKEPMWANYVRGVVKHLQQRAPDFGGVDMVISGNVPQGAGLSSSASLEVAVGTVFQQL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFIFP 177
                      +    A    V      +D   S  G     +           +     
Sbjct: 145 FNLALDGAAIAVNGQEAENQFVGCNCGIMDQLISALGQKDHAMLLDCRTLGTTPVSMPDD 204

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIE----------------------------YPEINEI 209
           I ++        + V  + +    +                             P++ + 
Sbjct: 205 IAVVIINSNFRRSLVGSEYNVRREQCETGARFFNKKALRDVDLAEFNAAESQLDPQVAKR 264

Query: 210 NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
            + +       +  + +AL   +L  + + M      +     ++   +  +V  ++ + 
Sbjct: 265 VRHVITENA-RTLEAAKALSRGDLARMGELMAESHASMRDDFEITVPPVDTLVEIVKAEI 323

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G C++AL   DL      +V     AK
Sbjct: 324 GDRGGVRMTGGGFGGCIVALMPLDLVDRVQAAVASQYEAK 363


>gi|146296524|ref|YP_001180295.1| galactokinase [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410100|gb|ABP67104.1| galactokinase [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 389

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/352 (16%), Positives = 111/352 (31%), Gaps = 51/352 (14%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSF 73
           G + L+GEH   +G      A+N    + +  R D  I + ++  +     D+       
Sbjct: 28  GRVNLIGEHTDYNGGYVFPAALNVGTTILIRKRDDSKIRLYATDLKELVEADIENIDSYK 87

Query: 74  SF---------IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
           S          I   +N      G D+     +    GL SSAAI  A   A+ ++   K
Sbjct: 88  SIKWGNYQLGVIKELMNSGYNVGGADMLFHDTVPHGAGLSSSAAIECATGIAIYSIFNEK 147

Query: 125 EPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQMPKYS 168
                 +         +  G++ G +D  AS  G                 +  ++  Y 
Sbjct: 148 PIDKVALSFICQRAENRFVGVNCGIMDQFASSLGKKDHAIFLNTRTMEYKYVPLKLGDYK 207

Query: 169 IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--PEINEINQKIYALM--------- 217
           I   +      L  S Y     +  K +  ++ +     + E+++  +            
Sbjct: 208 IVVSNTNKKRSLASSKYNERREECEKGLKMLQKKLTISCLGELDRDTFEKYKNLIENETI 267

Query: 218 ----------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
                           S + L   NL    + M      L     V+  +L  +  +  E
Sbjct: 268 LKRVRHVVYENDRVLKSVEVLEKGNLVSFGKLMIDSHISLRDDYEVTGFELDTLFEEALE 327

Query: 267 QPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
              ++ S+++G+G G C +++   D      + V  +          + P  
Sbjct: 328 IDGVIGSRMTGAGFGGCTVSIVHKDAIDEFIKKVGENY----YQKTSLKPDF 375


>gi|59713538|ref|YP_206313.1| galactokinase [Vibrio fischeri ES114]
 gi|71648676|sp|Q5E0M1|GAL1_VIBF1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|59481786|gb|AAW87425.1| galactokinase [Vibrio fischeri ES114]
          Length = 384

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/343 (18%), Positives = 112/343 (32%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQYCGSLDL- 66
            V APG + L+GEH   +    L  AIN + ++    R D ++ + S   G      D+ 
Sbjct: 23  IVQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKRDDNIVRVVSVDYGNETDEFDIT 82

Query: 67  --------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    M+       +   I+      G D+ V   +    GL SSAA+ V I    
Sbjct: 83  QEITFQENKMWSNYIRGVVKCLIDRGYEFKGADISVSGNVPQGAGLSSSAALEVVIGQTF 142

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICY 162
             L Y+   S  EI         +  G + GI        G                   
Sbjct: 143 KEL-YNLNISQAEIALNGQQAENEFVGCNCGIMDQMISAEGNENHAMLLDCRSLETTAVS 201

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYPEI 206
                S+  I+      L+ S Y T   Q  +                  +    E  E+
Sbjct: 202 MPEDMSVVIINSNKKRGLVDSEYNTRREQCEEAARIFGVKALRDVTIEEFNAKAHELDEM 261

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        ++ + + L + ++K +A  M      +     ++ S++  +V  ++
Sbjct: 262 VAKRARHVITENDRTEEAAKVLASGDMKRMAVLMAESHASMRDDFEITVSEVDTLVDIVK 321

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G C++AL    L      +V     AK
Sbjct: 322 NVIGAEGGVRMTGGGFGGCIVALVPPMLVDEVKAAVEELYEAK 364


>gi|186680748|ref|YP_001863944.1| galactokinase [Nostoc punctiforme PCC 73102]
 gi|186463200|gb|ACC79001.1| galactokinase [Nostoc punctiforme PCC 73102]
          Length = 360

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/350 (18%), Positives = 115/350 (32%), Gaps = 35/350 (10%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
             +   SAPG + L+GEH   +    L  AI +   + L L  D   +  S       S+
Sbjct: 10  PPETQASAPGRVNLLGEHTDYNDGFVLPTAIPQSTTVQLGLSSDSHHHFYSENLNEQVSI 69

Query: 65  DLAMFHPS--FSFIIMAINHIKPSCGFDL-----KVISQLDSQLGLGSSAAITVAITAAL 117
                 PS   S+I   I  ++   G+ +      V S +    GL SSAA+ VA   A+
Sbjct: 70  LDINHSPSGFASYIFGCIEVLQ-KAGYKIPSLCVYVKSSVPMGSGLSSSAALEVATLRAV 128

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEKID 173
             L         EI   A    +   G+  GI    +        ++           + 
Sbjct: 129 RQLLNF-PIDDVEIAQFAQQAEIHYAGVQCGIMDQMASSLADTEHILFLDTRTLKRRVMP 187

Query: 174 FIFPIHLIYS-----------GYKTPTAQVLKKISYIEIE----------YPEINEINQK 212
                 ++             GY    A+  +    + ++            ++ E  ++
Sbjct: 188 LPDNAEILVIDSGVPRTLATSGYNQRRAECEEAARSLGVKALRDITDVEVTEKLPEPLRR 247

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQPHIM 271
               +        + L+  + +   + MN     L     VS   L  +V  L++ P + 
Sbjct: 248 RARHVVTEDNRVLEVLQGVSSERFGELMNASHASLRDDYEVSVPALDTLVELLQKTPGVF 307

Query: 272 ASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTS 321
            ++++G+G G   +AL            V       G +   + PS   S
Sbjct: 308 GARLTGAGFGGASVALVVAGEARSIATHVLEQYKQAGYNGQILVPSLELS 357


>gi|199596971|ref|ZP_03210404.1| Galactokinase [Lactobacillus rhamnosus HN001]
 gi|229553676|ref|ZP_04442401.1| galactokinase [Lactobacillus rhamnosus LMS2-1]
 gi|258538816|ref|YP_003173315.1| galactokinase [Lactobacillus rhamnosus Lc 705]
 gi|56790850|gb|AAW30157.1| GalK [Lactobacillus rhamnosus]
 gi|199592104|gb|EDZ00178.1| Galactokinase [Lactobacillus rhamnosus HN001]
 gi|229312953|gb|EEN78926.1| galactokinase [Lactobacillus rhamnosus LMS2-1]
 gi|257150492|emb|CAR89464.1| Galactokinase [Lactobacillus rhamnosus Lc 705]
          Length = 388

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/361 (16%), Positives = 126/361 (34%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI+      +    D    + S+     G +D+     
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAISLGTYAAVGANDDNAFRLYSANFPKVGIIDIPFPDL 83

Query: 68  ------MFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                 ++   F  +   +     +   G ++ +   L    GL SSA++ + +   L  
Sbjct: 84  FQDKRGLWTDYFQGMARVMKTAGINYTHGLNVYINGNLPDGAGLSSSASLEMLVGTILNN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L +    +P +++     +     G++SGI    +I  G                 +  +
Sbjct: 144 L-FDGGFAPLDLVKFGVKVENDYIGVNSGIMDQFAIEMGRANQATLLDTNTMKYEYLPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINE----- 208
           M    I  ++      L  S Y    ++  K ++ ++              E +E     
Sbjct: 203 MGDNVIVIMNTNKRRELTDSKYNERRSECEKALAMLQKGIDVKSLGQLTEDEFDENTYLI 262

Query: 209 ----INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
               + ++        + +  + +AL++ +LK   + ++     L     V+  +L  +V
Sbjct: 263 YDETLIKRARHAVFENQRTLTAAKALQSGDLKTFGKLVSASGVSLAFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+           +V      K G D        + 
Sbjct: 323 TNALKQRGVLGARMTGAGFGGCAIAIVNSADVEDFISNVGKAYTEKIGYDAHFYVADIAD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|258507648|ref|YP_003170399.1| galactokinase [Lactobacillus rhamnosus GG]
 gi|257147575|emb|CAR86548.1| Galactokinase [Lactobacillus rhamnosus GG]
 gi|259648997|dbj|BAI41159.1| galactokinase [Lactobacillus rhamnosus GG]
          Length = 388

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 58/361 (16%), Positives = 126/361 (34%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI+      +    D    + S+     G +D+     
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAISLGTYAAVGANDDNAFRLYSANFPKVGIIDIPFPDL 83

Query: 68  ------MFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                 ++   F  +   +     +   G ++ +   L    GL SSA++ + +   L  
Sbjct: 84  FQDKRGLWTDYFQGMARVMKTAGINYTHGLNVYINGNLPDGAGLSSSASLEMLVGTILNN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L +    +P +++     +     G++SGI    +I  G                 +  +
Sbjct: 144 L-FDGSFAPLDLVKFGVKVENDYIGVNSGIMDQFAIEMGRANQATLLDTNTMKYEYLPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINE----- 208
           M    I  ++      L  S Y    ++  K ++ ++              E +E     
Sbjct: 203 MGDNVIVIMNTNKRRELTDSKYNERRSECEKALAMLQKGIDVKSLGQLTEDEFDENTYLI 262

Query: 209 ----INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
               + ++        + +  + +AL++ +LK   + ++     L     V+  +L  +V
Sbjct: 263 YDETLIKRARHAVFENQRTLTAAKALQSGDLKTFGKLVSASGVSLAFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+           +V      K G D        + 
Sbjct: 323 TNALKQRGVLGARMTGAGFGGCAIAIVNSADVEDFISNVGKAYTEKIGYDAHFYVADIAD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|86516652|gb|ABC98018.1| GalK [Shigella dysenteriae]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSRGAG 380


>gi|26246723|ref|NP_752763.1| galactokinase [Escherichia coli CFT073]
 gi|91209785|ref|YP_539771.1| galactokinase [Escherichia coli UTI89]
 gi|110640958|ref|YP_668686.1| galactokinase [Escherichia coli 536]
 gi|117622941|ref|YP_851854.1| galactokinase [Escherichia coli APEC O1]
 gi|191174194|ref|ZP_03035706.1| galactokinase [Escherichia coli F11]
 gi|218557663|ref|YP_002390576.1| galactokinase [Escherichia coli S88]
 gi|227884282|ref|ZP_04002087.1| galactokinase [Escherichia coli 83972]
 gi|237707287|ref|ZP_04537768.1| galactokinase [Escherichia sp. 3_2_53FAA]
 gi|300992235|ref|ZP_07179844.1| galactokinase [Escherichia coli MS 200-1]
 gi|300993231|ref|ZP_07180278.1| galactokinase [Escherichia coli MS 45-1]
 gi|301051328|ref|ZP_07198153.1| galactokinase [Escherichia coli MS 185-1]
 gi|306812843|ref|ZP_07447036.1| galactokinase [Escherichia coli NC101]
 gi|34222579|sp|Q8FJS1|GAL1_ECOL6 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|122424538|sp|Q1REH4|GAL1_ECOUT RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|123148270|sp|Q0TJU4|GAL1_ECOL5 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|166216971|sp|A1A900|GAL1_ECOK1 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|226709559|sp|B7MGL4|GAL1_ECO45 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|26107122|gb|AAN79306.1|AE016757_210 Galactokinase [Escherichia coli CFT073]
 gi|91071359|gb|ABE06240.1| galactokinase [Escherichia coli UTI89]
 gi|110342550|gb|ABG68787.1| galactokinase [Escherichia coli 536]
 gi|115512065|gb|ABJ00140.1| galactokinase [Escherichia coli APEC O1]
 gi|190905539|gb|EDV65166.1| galactokinase [Escherichia coli F11]
 gi|218364432|emb|CAR02112.1| galactokinase [Escherichia coli S88]
 gi|226898497|gb|EEH84756.1| galactokinase [Escherichia sp. 3_2_53FAA]
 gi|227839034|gb|EEJ49500.1| galactokinase [Escherichia coli 83972]
 gi|294489764|gb|ADE88520.1| galactokinase [Escherichia coli IHE3034]
 gi|300297035|gb|EFJ53420.1| galactokinase [Escherichia coli MS 185-1]
 gi|300305398|gb|EFJ59918.1| galactokinase [Escherichia coli MS 200-1]
 gi|300406639|gb|EFJ90177.1| galactokinase [Escherichia coli MS 45-1]
 gi|305853606|gb|EFM54045.1| galactokinase [Escherichia coli NC101]
 gi|307552601|gb|ADN45376.1| galactokinase [Escherichia coli ABU 83972]
 gi|307627835|gb|ADN72139.1| galactokinase [Escherichia coli UM146]
 gi|315287221|gb|EFU46633.1| galactokinase [Escherichia coli MS 110-3]
 gi|315292613|gb|EFU51965.1| galactokinase [Escherichia coli MS 153-1]
 gi|323953581|gb|EGB49447.1| galactokinase [Escherichia coli H252]
 gi|323958295|gb|EGB54003.1| galactokinase [Escherichia coli H263]
 gi|324009659|gb|EGB78878.1| galactokinase [Escherichia coli MS 57-2]
 gi|324011099|gb|EGB80318.1| galactokinase [Escherichia coli MS 60-1]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALFPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|260767725|ref|ZP_05876660.1| galactokinase [Vibrio furnissii CIP 102972]
 gi|260617234|gb|EEX42418.1| galactokinase [Vibrio furnissii CIP 102972]
          Length = 400

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/342 (18%), Positives = 111/342 (32%), Gaps = 43/342 (12%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AIN + ++  + R D  + I   D +  Q   SLD
Sbjct: 36  VIQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAASKRDDNRVRIIAVDYANAQDEFSLD 95

Query: 66  -------LAMFHPSFSFIIM-AINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
                    M+      ++   +       G ++ V   +    GL SSAA+ V I    
Sbjct: 96  APIEFQADKMWANYIRGVVKFLLERGYTLGGANIAVSGNVPQGAGLSSSAALEVVIGQTF 155

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQ 163
             L        +  L    A    V      +D   S  G                    
Sbjct: 156 KALFSLAISQAEIALNGQQAENQFVGCNCGIMDQLISAEGQANHALLIDCRSLETQAVSM 215

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKK----------------ISYIEIEYPEIN 207
               +I  I+      L+ S Y T   Q  +                     + E PE+ 
Sbjct: 216 PEDMAIVIINSNKKRGLVDSEYNTRRQQCEEAAQIFGVKALRDVTIETFERRQAELPELV 275

Query: 208 EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
               +        +  + QALR  ++  L Q M      +     ++  ++  +V  +++
Sbjct: 276 AKRARHVITENDRTLAAAQALRANDMTTLGQLMAASHASMRDDFEITVKEIDTLVDIVKQ 335

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                   +++G G G CV+AL    L +    ++     A 
Sbjct: 336 VIGDQGGVRMTGGGFGGCVVALMPPALVAPVTAAIEQQYQAA 377


>gi|86516692|gb|ABC98038.1| GalK [Escherichia coli]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGEKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|116618411|ref|YP_818782.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
 gi|116097258|gb|ABJ62409.1| galactokinase [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 390

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/363 (17%), Positives = 118/363 (32%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI          R D  I + S      G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPAAITYGTYGVARKRDDDRILVYSVNFDEKGVVQLDYKKL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D        +++   I  +         GFDL V   + +  GL SSA++ + +   L  
Sbjct: 85  DFDENDGWTNYVKGVIVKLIEQGYVLDTGFDLLVEGNIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L          +              +  +D  A   G                 +   +
Sbjct: 145 LFDLDVSRLSLVKIGQKVENEYFGLNTGIMDQFAIGFGQEQKAILLDTNTLTYELVPIVL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------Y 203
            +Y+I  ++      L  S Y    AQ    +  ++ E                     +
Sbjct: 205 GEYAIVIMNTNKRRELGDSKYNERRAQCETALKLLQTELNINSLGELTDEEFDDNVALIH 264

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E      +      + +  + +AL + +L+   Q MN     L+    V+  +L  +V 
Sbjct: 265 DETLVKRARHAVYENQRTLKAKKALSDGDLQTFGQLMNDSHASLKADYEVTGLELDTLVQ 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++QP ++ ++++G+G G C IAL K    S     V + +M+  G             
Sbjct: 325 SAQKQPGVLGARMTGAGFGGCAIALVKETAISNFENKVYDDYMNVVGYAPEFYVAHVGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|228918508|ref|ZP_04081951.1| Galactokinase [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228841124|gb|EEM86323.1| Galactokinase [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 389

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 55/357 (15%), Positives = 136/357 (38%), Gaps = 55/357 (15%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           +PG + L+GEH   +G      +I          R+D  + + S+  +  G +       
Sbjct: 25  SPGRINLIGEHTDYNGGYVFPASITYGTYGVARRREDDRVFVYSTNFKEVGVIRFKLNEL 84

Query: 65  ---DLAMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +++ +     K   GF+L V   + +  GL SSA++ + +   +L 
Sbjct: 85  GYDKNDNWANYVKGVLLTLKEAGHKIDSGFELLVEGTIPNGAGLSSSASLELLV-GVVLE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
             ++ + +  E++     +  +  G++SG +D  A   G                ++   
Sbjct: 144 HLFNLDVTRLELVKMGKKVENEFIGVNSGIMDQFAIGFGEEDKAILLDTNTLKYEMVSVV 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +  Y+I  ++      L  S Y    A+  + ++ ++ +     + E+++  +       
Sbjct: 204 LNDYAIVIMNTNKRRELADSKYNERRAECEEALARLQTKLEITALGELSETEFDANQDLI 263

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + ++ + +AL   +L+   + +N     L     V+  +L  +V
Sbjct: 264 GDEILIRRAKHAVYENERTKKAKEALTANDLEEFGKLLNTSHASLRDDYEVTGLELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSH 318
              ++Q  ++ ++++G+G G C IAL K         +    ++ + + ++   P  
Sbjct: 324 AAAQKQEGVLGARMTGAGFGGCAIALVKESE----IHAFKNKVYDEYLKVIGYAPDF 376


>gi|145640923|ref|ZP_01796505.1| galactokinase [Haemophilus influenzae R3021]
 gi|145274437|gb|EDK14301.1| galactokinase [Haemophilus influenzae 22.4-21]
          Length = 384

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +   +R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAISGAIRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPDFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|115398019|ref|XP_001214601.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192792|gb|EAU34492.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 541

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 81/383 (21%), Positives = 138/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLG-----QY 60
             VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R + ++           
Sbjct: 96  FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLTKSQRTVTLNFRDIGLAHTWN 155

Query: 61  CGSLDLAMFH-----------------PSFSFIIMAINHIKPSCGFD------------- 90
              L   +FH                      I   ++ + P    D             
Sbjct: 156 IDDLPWDVFHQPAKKKYYYDLVTSLDPELVDAIQPYVDQVSPDLPEDQRKIHRRSASAFL 215

Query: 91  ---------------LKVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S +    GLGSSA++ V ++AALL    TL       P   
Sbjct: 216 YLLLSLGSPQHPGAIYTLRSTIPIGAGLGSSASVCVCLSAALLLQIRTLAGPHPDQPPDE 275

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    +   G  SG+D   S  G  + ++   YS        P      
Sbjct: 276 AEVQIERINRWAFVGEMCTHGNPSGVDNTVSAGGKAVIFRRTDYSKPPSVRSLPTFPELP 335

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              + +     TA  + K+  ++ E+P + E     I++   +    L       +  + 
Sbjct: 336 LLLVDTRQPRSTAVEVAKVGKLKEEHPVVTESILDAIDKLTLSAEELLDGCEKTGVTEEV 395

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ L   +    G L +LGVS  +L   + +L +  +I  +K++G+G G C I L + D 
Sbjct: 396 LERLGTLVRINHGFLVSLGVSHPRLER-IRELVDFANIGWTKLTGAGGGGCAITLLRPDA 454

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   + A+G      T
Sbjct: 455 DKNAVRDLEAKLAAEGFAKYETT 477


>gi|307195155|gb|EFN77148.1| Galactokinase [Harpegnathos saltator]
          Length = 393

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 63/348 (18%), Positives = 119/348 (34%), Gaps = 49/348 (14%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
              +CV APG + L+GEH   +    L  A+    ++       + + I S L    G  
Sbjct: 26  PATVCVYAPGRVNLIGEHTDYNDGFVLPMALPMVTVIAGKSHDGQRMKIVS-LSDTVGET 84

Query: 65  DLAMFHP------------SFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITV 111
           +   F                +++   I N +     F   + S + +  GL SSAA+ V
Sbjct: 85  NEVEFEASSRADLKPGDPKWANYVKGCIANFVCDVPAFKAVIASTVPAGAGLSSSAALEV 144

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKY 167
           A    L  L   K   P+E             G+  G +D   S+ G     +       
Sbjct: 145 ATYTFLEALSGKKAEKPEEKALACQKAEHDFAGVPCGIMDQFISVMGKEGCALLLDCRDL 204

Query: 168 SIEKIDFIFPIHLI----------------YSGYKTPTAQVLKKISYIEIEYPEINEINQ 211
           +I++I  +     +                Y   +    +  + ++   +   ++N+I  
Sbjct: 205 AIKQIPMLHMDDYVFLITNSNAPHKLSSSAYCERRDCCYEAARMLNKKSLRDADMNDIRA 264

Query: 212 --------------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
                         +      + +  + +AL   +LK   + MN     L     VS  +
Sbjct: 265 LTLQNAPDRGVKRARHIVTEIQRTLDAAEALERGDLKRFGRLMNDSHDSLRDDYEVSSKE 324

Query: 257 LSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
           L  +V   RE   ++ S+++G+G G C + L + +      Q +    
Sbjct: 325 LDSLVSAAREVDGVLGSRLTGAGFGGCTVTLLRKNAVDRAIQHMTAKY 372


>gi|82776031|ref|YP_402378.1| galactokinase [Shigella dysenteriae Sd197]
 gi|309786433|ref|ZP_07681059.1| galactokinase [Shigella dysenteriae 1617]
 gi|123563165|sp|Q32IG8|GAL1_SHIDS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|81240179|gb|ABB60889.1| galactokinase [Shigella dysenteriae Sd197]
 gi|308925827|gb|EFP71308.1| galactokinase [Shigella dysenteriae 1617]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/360 (16%), Positives = 119/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKHVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|269119205|ref|YP_003307382.1| galactokinase [Sebaldella termitidis ATCC 33386]
 gi|268613083|gb|ACZ07451.1| galactokinase [Sebaldella termitidis ATCC 33386]
          Length = 388

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/346 (16%), Positives = 116/346 (33%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      AI +          +  + + S   +  G       +L
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCAITQGTYALTRKISEPKLRLFSLNFENTGIIEIDLSNL 83

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D        ++     +H+K        G ++     + +  GL SSA+I +        
Sbjct: 84  DFNPEDNWANYPKGVFHHLKQSGAAFDTGLEILFYGNIPNGAGLSSSASIELVSCILAKN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           + Y+      E++  +  +  +  G++SGI     I  G                 +   
Sbjct: 144 I-YNLNFDMIELIKLSQKVENEYIGVNSGIMDQFIIGMGKQDTAVILDCNTLKYRYVPLI 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY-------------------- 203
           +  YSI   +      L  S Y    +Q    +  ++                       
Sbjct: 203 LDGYSIIISNTNKKRTLADSKYNERRSQCEAALHDLQKVLNIKSLGDLTEKEFEKYKHLI 262

Query: 204 -PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
             + NE   +        +  + + L N +L+   + M      L     V+ ++L  +V
Sbjct: 263 TDKTNEKRARHAVYENLRTLEAVEYLTNNDLENFGKLMIASHDSLRDDYDVAGAELDALV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
               +Q  ++ S+++G+G G C +++ K +      ++       K
Sbjct: 323 QAALKQKGVIGSRMTGAGFGGCTVSIVKNENIDDFIKNTGKEYQEK 368


>gi|325498067|gb|EGC95926.1| galactokinase [Escherichia fergusonii ECD227]
          Length = 382

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRNVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNNFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|156975595|ref|YP_001446502.1| galactokinase [Vibrio harveyi ATCC BAA-1116]
 gi|166216978|sp|A7MV01|GAL1_VIBHB RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|156527189|gb|ABU72275.1| hypothetical protein VIBHAR_03327 [Vibrio harveyi ATCC BAA-1116]
          Length = 386

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/350 (16%), Positives = 113/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D L+ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNLVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQEITFQQDKMWANYIRGVVKCLLARGYQFSGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRREQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           ++E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VSELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++A+    L      +V     A 
Sbjct: 315 TLVEMVKEVIGEQGGVRMTGGGFGGCIVAIVPPALVDEVKATVEAKYQAA 364


>gi|295398887|ref|ZP_06808869.1| galactokinase [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978353|gb|EFG53949.1| galactokinase [Geobacillus thermoglucosidasius C56-YS93]
          Length = 394

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/359 (15%), Positives = 110/359 (30%), Gaps = 50/359 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL------- 64
           APG +  +GEH   +G   L  A+       +    +  I   S      G +       
Sbjct: 25  APGRVNFIGEHTDYNGGHVLPCALEIGTYALVRKTANPFIRFYSKNFPETGIITVAYDDL 84

Query: 65  ---DLAMFHPSFSFIIMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
              D   +      +I A     P   G D+     + +  GL SSA+I +     L  L
Sbjct: 85  SYQDKHGWANYPKGVIAAFQSFCPIETGLDILYYGMIPNGAGLSSSASIELVTAVMLNEL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQM 164
            + +     E++  +  +  +  G++ GI    ++  G                 I   M
Sbjct: 145 -FAQHLDMLELVKLSQKVENEYVGVNCGIMDQFAVGMGKRNYAMLLNCQTLECRYIPVAM 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------YPEINEINQKIYA 215
              SI   +      L  S Y    A     ++ ++             E  E  + + +
Sbjct: 204 NDCSIVIANTNKKRGLAASVYNERRATCEAALAKLQKHINIASLGDLTSEQLEKYKHLLS 263

Query: 216 -----------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                         + +  +  AL   +L    + M +    L     V+  +L  +V  
Sbjct: 264 PLEQKRARHAVTENERTIEAAAALEKGDLLCFGELMKQSHISLRDDYEVTGEELDTLVEA 323

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
             +    + ++++G+G G C + + K        + V      K G +           
Sbjct: 324 AWKHEGTIGARMTGAGFGGCTVNIVKDAHIPDFIERVGKEYAEKIGYEASFYVVKIGDG 382


>gi|325694333|gb|EGD36246.1| galactokinase [Streptococcus sanguinis SK150]
          Length = 392

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 119/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           +PG + L+GEH   +G      AI+         R D+L+   S      G +++++ + 
Sbjct: 28  SPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQLLRFFSGNFVEKGIIEVSLENL 87

Query: 72  SF----------SFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            F            ++  +         G D+ V   + +  GL SSA++ +        
Sbjct: 88  HFEPEHNWTNYPKGVLHFLQEAGHTIDRGMDVYVYGNIPNGSGLSSSASLELLTGVIAEK 147

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  +    +++        +  G++SGI    +I  G                 +   
Sbjct: 148 L-FDLQLERLDLVKIGKLTENEFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLD 206

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    +  ++      L  S Y    A+  K +  +  +     + E+++  +       
Sbjct: 207 LKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELNRKLSIATLGELDEWAFDEYSYLI 266

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  +  AL+   L    + MN     LE    V+  +L  +V
Sbjct: 267 EDENRLKRARHAVLENQRTLKARAALQAGALDKFGRLMNASHVSLEHDYEVTGLELDTLV 326

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               EQ  ++ ++++G+G G C IAL   D      ++V      
Sbjct: 327 HTAWEQEGVLGARMTGAGFGGCAIALVAKDAVESFKENVGRKYQE 371


>gi|42527714|ref|NP_972812.1| galactokinase [Treponema denticola ATCC 35405]
 gi|41818542|gb|AAS12731.1| galactokinase [Treponema denticola ATCC 35405]
          Length = 399

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 63/363 (17%), Positives = 128/363 (35%), Gaps = 53/363 (14%)

Query: 2   GQCLHKICVSA-PGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           G    KI  +A P  + ++GEH   +G   L  A+N  + + L  RKD+ I   S   + 
Sbjct: 21  GNSEEKIIFAASPARINIIGEHIDYNGGLVLPAAVNLYLRIALRKRKDKKILYRSMKTEK 80

Query: 61  CGSLDLA---------MFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAI 109
               +L           F    + + + +    +K   GF+L + S +    G+ SSAA+
Sbjct: 81  IFEFELDGNLGFDKENDFANYLNGMFLFLKERGLKADTGFELLITSDIPQGSGISSSAAL 140

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------- 158
            +     +      +    +            +   S  +D  A   G            
Sbjct: 141 ELCFGKIISHAFGFELDGIEFAKIGRRVENEFLGLKSGIMDQFAIAMGKKNQAILLDTSS 200

Query: 159 ----LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE------------ 202
                I  +   Y I  ++   P  L  S Y     +  K +++++ +            
Sbjct: 201 LNYEYIPLETEPYRIVIMNSNKPRKLTESKYNERKEECEKALAFLQKKTDIDFLCDLSVS 260

Query: 203 ------YPEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLE-T 249
                    I+ + +K++  +              +AL+NK+LK+L  ++N+    L+  
Sbjct: 261 DFEKLEEDLISNLGEKLFRRVRHCVTEMDRVRRSAEALKNKDLKLLGASLNQSHLSLKDD 320

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKG 308
             V+  +L  + +   ++   + ++++G+G   C IA+   D      + V        G
Sbjct: 321 YEVTGKELDALFFAAIKEKSCIGARMTGAGFSGCAIAIVHKDGFEEFAERVGKAYTENTG 380

Query: 309 IDI 311
              
Sbjct: 381 FTA 383


>gi|320155511|ref|YP_004187890.1| galactokinase [Vibrio vulnificus MO6-24/O]
 gi|319930823|gb|ADV85687.1| galactokinase [Vibrio vulnificus MO6-24/O]
          Length = 386

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/350 (16%), Positives = 112/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D L+ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNLVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYAFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETESVSMPEEMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L      +V     A 
Sbjct: 315 TLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKATVAAKYQAA 364


>gi|296110279|ref|YP_003620660.1| galactokinase [Leuconostoc kimchii IMSNU 11154]
 gi|295831810|gb|ADG39691.1| galactokinase [Leuconostoc kimchii IMSNU 11154]
          Length = 390

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/373 (15%), Positives = 128/373 (34%), Gaps = 52/373 (13%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           M +   +    +PG + L+GEH   +G      AI         LR D ++ + S+    
Sbjct: 17  MHKPTDRFF--SPGRINLIGEHTDYNGGHVFPAAITLGTYGVARLRDDAIVKLYSTNFSD 74

Query: 61  CGSLDLAM----------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAA 108
            G +  ++          +      ++ A+       + GF+L V   + +  GL SS++
Sbjct: 75  AGIISFSIENEDKLAHGSWGNFVKGVLQAMRGYGNQFTKGFELVVTGNIPNASGLSSSSS 134

Query: 109 ITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG----------- 157
           + + +   L  L   K P    + +   +    V   +  +D  A   G           
Sbjct: 135 LELLVGVTLQKLYDLKIPRLQLVASGQRSENDFVGVNTGIMDQFAIGFGEKNQAIYLDTN 194

Query: 158 ----GLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--------- 204
                ++   + ++ I  ++      L  S Y     +  + +  ++ +           
Sbjct: 195 TMIYEMVPVNLGQHVIVIMNTNKRRELADSKYNDRVRETQEAVFDLQKKLKIQYLGELDS 254

Query: 205 ----------EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLG 251
                       + I ++        + +Q++ +AL+  +L    Q +N     L+    
Sbjct: 255 HTFEENQQLIRSDTIRRRARHAVTENERTQLAVKALKANDLNYFGQLLNASHESLKCDYE 314

Query: 252 VSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID 310
           V+  +L  +    ++ P ++ ++++G+G G C IAL   D        V      + G +
Sbjct: 315 VTGIELDTLAETAQKVPGVLGARMTGAGFGGCAIALVDRDHVEDLKTIVGRAYSEQIGYE 374

Query: 311 IVPITPSHSTSLY 323
                       +
Sbjct: 375 ASFYVAEIGQGAH 387


>gi|322792014|gb|EFZ16119.1| hypothetical protein SINV_06008 [Solenopsis invicta]
          Length = 393

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 65/345 (18%), Positives = 116/345 (33%), Gaps = 49/345 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           ICV APG + L+GEH   +    L  A+    ++       +   I S L    G+++  
Sbjct: 29  ICVYAPGRVNLIGEHTDYNDGFVLPMALPMVTVIVGKSHPGKKTRIFS-LSDVVGTVNEF 87

Query: 68  MFHP------------SFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
            F                ++I   I N I     F+  ++S + +  GL SSAA+ VA  
Sbjct: 88  EFEAGCRTDIKPGEPKWANYIKGCIANFICDVSAFNAVIVSTVPAGSGLSSSAALEVATY 147

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIE 170
             L  L   K   P++             G+  G +D   S  G     +         +
Sbjct: 148 TFLEILSGKKPEKPEQKALACQKAEHDFAGVPCGIMDQFISAMGKKGCALLLDCRNLVTK 207

Query: 171 KIDFIFPIHLI----------------YSGYKTPTAQVLKKISYIEIEYPEINEI----- 209
           +I  +   + +                Y   +    +  K +    +    IN+I     
Sbjct: 208 QIPMLHIDNYVFLITNSNAPHKLSSSAYCERRDCCYEAAKLLGKKSLRDANINDILALTS 267

Query: 210 ---------NQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSE 259
                      +      + +  +  AL   + +   + MN     L     VS  +L  
Sbjct: 268 RNASDRVVKRARHVITEIQRTLDAAVALEKGDFQQFGRLMNESHDSLRDDYEVSSKELDS 327

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
           +V   RE   ++ S+++G+G G C + L + D      Q +    
Sbjct: 328 LVSAAREVDGVLGSRLTGAGFGGCTVTLLRKDTVDKTIQHIKAKY 372


>gi|296411929|ref|XP_002835681.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629469|emb|CAZ79838.1| unnamed protein product [Tuber melanosporum]
          Length = 442

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 70/375 (18%), Positives = 137/375 (36%), Gaps = 70/375 (18%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLDLA 67
           VSAPG +++ GEH V++G AA+  A++ R  L +T   +  R ++++ S      S D+ 
Sbjct: 2   VSAPGKVIVYGEHAVVYGKAAIAAALSLRSYLLVTPLPKTSRTLSLNFSDISLNHSWDID 61

Query: 68  MF------------------------------------------HPSFSFIIMAINHIKP 85
                                                         + +F+ + +     
Sbjct: 62  SLPWAIFSKPGKKRYYFDTVERLDKELLETVKPLVAAIPGKVQQGAASAFLYLYLMLGSK 121

Query: 86  SCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYHKEPSPDEIL 132
                +  + S +    GLGSSA+I+V ++ A               L    +     I 
Sbjct: 122 HAPASIYTLRSAIPIGAGLGSSASISVCLSTALQLQMGTLATPFEGMLSNETQLQLKRIN 181

Query: 133 TTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL------IYSGYK 186
             +    + + G  SG+D   +  G  + ++   YS+                 + +   
Sbjct: 182 NWSFVGEMCIHGNPSGVDNTVATGGRAVLFKRTDYSLPPEVTHLRNFPELPLLLVDTKQP 241

Query: 187 TPTAQVLKKISYIEIEYPE-----INEINQKIYALMGKLSQISCQALRNKN-LKVLAQAM 240
             TA+ L  +  +   +PE     ++ I++        +S     +      L  L + +
Sbjct: 242 RRTAEQLANVRNMLNAHPEITQSMLDTIDRITAEAHDVISDPDFTSFSGSPSLSRLGELI 301

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
               GLL +LGVS  KL   + +L +   I  +K++G+G G C I L K  + +   + +
Sbjct: 302 RINHGLLVSLGVSHPKLER-IRELIDHTGIGWTKLTGAGGGGCSITLLKPKVKANILEEL 360

Query: 301 NCHMHAKGIDIVPIT 315
           +  +  +G +    T
Sbjct: 361 DSKLRTEGFEKYQTT 375


>gi|225569302|ref|ZP_03778327.1| hypothetical protein CLOHYLEM_05384 [Clostridium hylemonae DSM
           15053]
 gi|225162101|gb|EEG74720.1| hypothetical protein CLOHYLEM_05384 [Clostridium hylemonae DSM
           15053]
          Length = 394

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/363 (16%), Positives = 117/363 (32%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           APG + L+GEH   +G      A+         +R+DR +   S      G ++      
Sbjct: 24  APGRVNLIGEHTDYNGGHVFPCALTIGTYGIARMREDRKLRFYSVNFDTMGVIETGLDEL 83

Query: 67  -----AMFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A      K S G DL +   + +  GL SSA++ V     L  
Sbjct: 84  LPSEAAGWTNYPKGVMWAFEERGYKLSHGLDLLIWGDIPNGSGLSSSASLEVLTGLILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------ICYQMPKY-- 167
           +        +  L   ++           +D  AS  G            + Y+      
Sbjct: 144 MYGFDVSMTEIALIGQYSENNFNGCNCGIMDQFASAMGKKDNAIFLDTNTLAYEYAPVVL 203

Query: 168 ---SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEY--------------------- 203
               I   +      L+ S Y     +  + +  ++                        
Sbjct: 204 TDARIVITNSKVKHSLVDSAYNDRRRESEEALMELKKVTDIKTLGDLTEQDFERYQSAIG 263

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E      K      + +  + +ALR+ ++++  + MN           VS  ++  +V 
Sbjct: 264 DETRRRRAKHAVYENRRTIRAVEALRSGDIELFGRLMNESHLSQRDDYEVSCKEIDLLVE 323

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTS 321
              E P ++ S+I+G G G C +++ K D      +++      + G +           
Sbjct: 324 LAWEVPGVIGSRITGGGFGGCTVSIVKRDAVDTFIETLGSGYRKQTGCEAEFYVVDIGDG 383

Query: 322 LYR 324
            +R
Sbjct: 384 AHR 386


>gi|323967353|gb|EGB62774.1| galactokinase [Escherichia coli M863]
 gi|327254439|gb|EGE66061.1| galactokinase [Escherichia coli STEC_7v]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRNVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|218549676|ref|YP_002383467.1| galactokinase [Escherichia fergusonii ATCC 35469]
 gi|226709564|sp|B7LK02|GAL1_ESCF3 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|218357217|emb|CAQ89852.1| galactokinase [Escherichia fergusonii ATCC 35469]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRNVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKNHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|320547761|ref|ZP_08042045.1| galactokinase [Streptococcus equinus ATCC 9812]
 gi|320447521|gb|EFW88280.1| galactokinase [Streptococcus equinus ATCC 9812]
          Length = 390

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 118/345 (34%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+L+   S+     G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDKLLRFYSANFDDLGIIEVSLDNL 83

Query: 67  -----AMFHPSFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +     K   GF+L V   + +  GL SSA++ + +      
Sbjct: 84  TFDKKDSWTNYPKGVIKFLQEAGHKIDSGFELYVNGNIPNGSGLSSSASLELLVGIVAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +  E    +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FDLEVERLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADKQAIYLDTNTLEYELVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +        + E++ + +       
Sbjct: 203 LGDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNQVLDIKTLGELDLQSFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  + 
Sbjct: 263 KDENRLKRARHAVWENQRTLQAKEALMAGELEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IA+   D      ++V      
Sbjct: 323 HTAWQQEGVLGARMTGAGFGGCGIAIVAKDKVDEFTKNVGQVYTE 367


>gi|260803413|ref|XP_002596584.1| hypothetical protein BRAFLDRAFT_219207 [Branchiostoma floridae]
 gi|229281843|gb|EEN52596.1| hypothetical protein BRAFLDRAFT_219207 [Branchiostoma floridae]
          Length = 384

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 76/373 (20%), Positives = 136/373 (36%), Gaps = 65/373 (17%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL-INIDSSLGQYCGSLD 65
           ++ VSAPG ++L GEH V++G  A+  +++ R  L + L  D   + ++        +  
Sbjct: 5   EVVVSAPGKVILFGEHAVVYGRKAIASSLDLRTHLEVHLLPDSTSVTLELPDIHLSKTWQ 64

Query: 66  LAMFHPS-------------------------------------FSFIIMAINHIKPSCG 88
           +A    +                                     F ++  +I+       
Sbjct: 65  MADLAAARPTGNPSPPSDQYLAALHRLAGTDADNTDARSLALLAFLYMYTSIHATARCPA 124

Query: 89  FDLKVISQLDSQLGLGSSAAITVAITAALLTLQY--------------HKEPSPDEILTT 134
                 SQL    GLGSSAA   A+ A LLT+                  +   + I + 
Sbjct: 125 GRFHASSQLPPGAGLGSSAAYCTALAAGLLTMCDVITRQEGKNGADTAWCKDDLEVINSW 184

Query: 135 AHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLK 194
           A      + G  SGID + S  GG I ++  + S  K      I L+ +     T  +++
Sbjct: 185 AFQGERLIHGNPSGIDNSVSTFGGAISFKSGEISAFKSVAQLKILLVNTKVPRSTKVLVQ 244

Query: 195 KISYIEIEYPEINE-----------INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQ 243
            +       P I E             +K+   +G  +    +  + K  +VL + ++  
Sbjct: 245 GVRDRYNRLPAIMEPVLNSIEEISCTCEKVLQELGSPTVEIKENTQGKYYQVLEELVDIC 304

Query: 244 QGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCH 303
           Q LL  +GV    L + V  +  +   + SK++G+G G C + L + D  +     V   
Sbjct: 305 QCLLNAIGVGHPSLDK-VSSITSKHG-LHSKLTGAGGGGCALVLLRPDTAADVIDKVTTE 362

Query: 304 MHAKGIDIVPITP 316
           +   G D+     
Sbjct: 363 LRDCGFDVWETAI 375


>gi|37680821|ref|NP_935430.1| galactokinase [Vibrio vulnificus YJ016]
 gi|61213545|sp|Q7MI80|GAL1_VIBVY RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|37199570|dbj|BAC95401.1| galactokinase [Vibrio vulnificus YJ016]
          Length = 386

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/350 (16%), Positives = 112/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D L+ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNLVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYAFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETESVSMPEEMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L      +V     A 
Sbjct: 315 TLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKATVAAKYQAA 364


>gi|331682180|ref|ZP_08382802.1| galactokinase [Escherichia coli H299]
 gi|331080604|gb|EGI51780.1| galactokinase [Escherichia coli H299]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  ATIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|218704077|ref|YP_002411596.1| galactokinase [Escherichia coli UMN026]
 gi|293404005|ref|ZP_06647999.1| galactokinase [Escherichia coli FVEC1412]
 gi|298379785|ref|ZP_06989390.1| galactokinase [Escherichia coli FVEC1302]
 gi|300898245|ref|ZP_07116596.1| galactokinase [Escherichia coli MS 198-1]
 gi|226709562|sp|B7N9Z9|GAL1_ECOLU RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|218431174|emb|CAR12050.1| galactokinase [Escherichia coli UMN026]
 gi|291428591|gb|EFF01616.1| galactokinase [Escherichia coli FVEC1412]
 gi|298279483|gb|EFI20991.1| galactokinase [Escherichia coli FVEC1302]
 gi|300358034|gb|EFJ73904.1| galactokinase [Escherichia coli MS 198-1]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/360 (16%), Positives = 118/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R D  + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDHKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|283833953|ref|ZP_06353694.1| galactokinase [Citrobacter youngae ATCC 29220]
 gi|291070626|gb|EFE08735.1| galactokinase [Citrobacter youngae ATCC 29220]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 61/360 (16%), Positives = 117/360 (32%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  IIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAARDDRKVRVIAADYDNQMDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIIAHDSQQWSNYVRGVVKHLQKRNNAFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPEGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSFETFSAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +L  + Q M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVITENARTVEAANALEKGDLLRMGQLMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 321 ATIGDKGGVRMTGGGFGGCIVALIPQDLVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|291537462|emb|CBL10574.1| galactokinase [Roseburia intestinalis M50/1]
          Length = 389

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 54/346 (15%), Positives = 120/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + ++GEH   +G      A+          R D+ +   S   +  G L+      
Sbjct: 25  APGRVNMIGEHTDYNGGHVFPCALTIGTYGVARKRNDKKLRFYSMNFEQLGVLESSVENL 84

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A     +K   G DL +   + +  GL SSA++   +T  +L 
Sbjct: 85  KPEKEADWTNYPKGVMWAFGEKGMKVEQGMDLVLFGNIPNGSGLSSSASVE-VLTGFILR 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
             +  + +  ++         K  G++ G +D  A   G                    +
Sbjct: 144 DMFGFDVTNQDLALIGQYSENKFNGVNCGIMDQFAIAMGKAGHAIFLDTATLKYEYAPIK 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM---- 217
           +    I          L  S Y    ++  K ++ ++       + ++ +  +       
Sbjct: 204 LENAKIVISCSNKKRGLGDSKYNERRSECEKALAELQKVVSIDALGDLTEAQFEEHKDAI 263

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL+N ++ +  + MN     L     V+  +L  +V
Sbjct: 264 EEEVCVRRAKHAVYENQRTIKAVEALKNNDVALFGKLMNESHVSLRDDYEVTGIELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +  +   ++ S+++G+G G C +++ K +      + V      K
Sbjct: 324 EEAWKIDGVIGSRMTGAGFGGCTVSIVKDEAVDTFIKEVGAAYEKK 369


>gi|229523689|ref|ZP_04413094.1| galactokinase [Vibrio cholerae bv. albensis VL426]
 gi|229337270|gb|EEO02287.1| galactokinase [Vibrio cholerae bv. albensis VL426]
          Length = 399

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/341 (17%), Positives = 103/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D  +    +D         L  
Sbjct: 37  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDSRVRLVAVDYDNDTDEFDLRE 96

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 97  EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 156

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 157 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 216

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                              +  
Sbjct: 217 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVA 276

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 277 KRARHVITENERTLHAAQALRKGNMTRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 336

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A 
Sbjct: 337 IGDQGGVRMTGGGFGGCVVALVHPTQVEAVQQAVVEHYEAA 377


>gi|301768991|ref|XP_002919896.1| PREDICTED: LOW QUALITY PROTEIN: galactokinase-like [Ailuropoda
           melanoleuca]
          Length = 391

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 61/342 (17%), Positives = 102/342 (29%), Gaps = 48/342 (14%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI--DSSLGQYCGSLDLA 67
           VSAPG + L+GEH   +    L  A+    +L  + R D L+++   S        L   
Sbjct: 31  VSAPGRVNLIGEHTDYNQGLVLPMALELVTVLVGSPRADGLVSLLTTSDDADEPRRLQFP 90

Query: 68  MFHP----------SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVAITA 115
           +               +++   I H    P  GF   V+S +    GL SSA++ VA   
Sbjct: 91  LPTAQRSLEPGTPRWANYVKGVIQHYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYT 150

Query: 116 ALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYSIEK 171
            L  L                       G+  GI           G  +           
Sbjct: 151 FLQQLCPDSGSIAAR-AQVCQRAEHSFAGVPCGIMDQLIALLGQKGHALLIDCRSLETSL 209

Query: 172 IDFIFPIHLIYSG------------YKTPTAQVLK-----KISYIEIEYPEINEINQKIY 214
           +    P   +               Y     Q  +         +     E  E  + + 
Sbjct: 210 VPLSEPKLAVLITNSNVRHSLGSSEYPLRRRQCEEVARALGKESLREVQLEELEAGRDLV 269

Query: 215 ALMGKL-----------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
           +  G             +  +  AL   + +   + M      L     VS  +L ++V 
Sbjct: 270 SKEGFRRARHVVGEIQRTAQAAAALSRGDYRAFGRLMVESHHSLRDDYEVSCPELDQLVE 329

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
                P +  S+++G G G C + L + D  S   Q +    
Sbjct: 330 AALSAPGVYGSRMTGGGFGGCTVTLLEADSTSQAMQHIQERY 371


>gi|296103319|ref|YP_003613465.1| galactokinase [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057778|gb|ADF62516.1| galactokinase [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 63/343 (18%), Positives = 118/343 (34%), Gaps = 45/343 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R D  + +   D        SLD
Sbjct: 22  VIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVIACAKRDDHKVRVIAADYGNEMDEFSLD 81

Query: 66  LAMF----HPSFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G DL +   +    GL SSA++ VA+    
Sbjct: 82  APIVIHDSQQWSNYVRGVVKHLQKRNKNFGGADLVISGNVPQGAGLSSSASLEVAVGTVF 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYS----- 168
             L YH      +I         +  G + G +D   S  G     +             
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKEHALLIDCRTLGTKAVP 200

Query: 169 ------IEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALM-- 217
                 +  I+  F   L+ S Y T   Q      + +        ++E N+  + L   
Sbjct: 201 LPKGAAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTLDEFNKVAHELDPV 260

Query: 218 -----------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                         +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALAKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                    +++G G G C++AL   DL      +V     AK
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALVPEDLVPAVQSAVEKQYEAK 363


>gi|153834038|ref|ZP_01986705.1| galactokinase [Vibrio harveyi HY01]
 gi|148869593|gb|EDL68583.1| galactokinase [Vibrio harveyi HY01]
          Length = 386

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/350 (16%), Positives = 113/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D L+ + S   G 
Sbjct: 16  LGYVPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNLVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQEITFQQDKMWANYIRGVVKCLLARGYQFSGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRANHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRREQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           ++E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VSELDELVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++A+    L      +V     A 
Sbjct: 315 TLVEMVKEVIGEQGGVRMTGGGFGGCIVAIVPPALVDEVKATVEAEYQAA 364


>gi|293414036|ref|ZP_06656685.1| galactokinase [Escherichia coli B185]
 gi|291434094|gb|EFF07067.1| galactokinase [Escherichia coli B185]
          Length = 382

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/360 (16%), Positives = 119/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGIVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|27365128|ref|NP_760656.1| galactokinase [Vibrio vulnificus CMCP6]
 gi|33301176|sp|Q8DBN9|GAL1_VIBVU RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|27361274|gb|AAO10183.1| galactokinase [Vibrio vulnificus CMCP6]
          Length = 386

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/350 (16%), Positives = 112/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D ++ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNIVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYSFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETESVSMPEEMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L      +V     A 
Sbjct: 315 TLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKATVAAKYQAA 364


>gi|291539989|emb|CBL13100.1| galactokinase [Roseburia intestinalis XB6B4]
          Length = 389

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 122/346 (35%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + ++GEH   +G      A+          R D+ +   S   +  G L+      
Sbjct: 25  APGRVNMIGEHTDYNGGHVFPCALTIGTYGVARKRNDKKLRFYSMNFEQLGVLESSVENL 84

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A     +K   G DL +   + +  GL SSA++   +T  +L 
Sbjct: 85  KPEKEADWTNYPKGVMWAFGEKGMKVEQGMDLVLFGNIPNGSGLSSSASVE-VLTGFILR 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
             +  + +  ++         K  G++ G +D  A   G                    +
Sbjct: 144 DMFGFDVTNQDLALIGQYSENKFNGVNCGIMDQFAIAMGKAGHAIFLDTATLKYEYAPIK 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI-------------EYPEINEIN 210
           +    I          L  S Y    ++  K ++ ++              ++ E  +  
Sbjct: 204 LENAKIVISCSNKKRGLGDSKYNERRSECEKALAELQKVVSIDALGDLTEVQFEEHKDAI 263

Query: 211 QKIYALM--------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           ++   +          + +  + +AL+N ++ +  + MN     L     V+  +L  +V
Sbjct: 264 KEEVCVRRAKHAVYENQRTIKAVEALKNNDVALFGKLMNESHVSLRDDYEVTGIELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +  +   ++ S+++G+G G C +++ K +      + V      K
Sbjct: 324 EEAWKIDGVIGSRMTGAGFGGCTVSIVKDEAVDTFIKEVGAAYEKK 369


>gi|317038103|ref|XP_001401587.2| mevalonate kinase [Aspergillus niger CBS 513.88]
          Length = 539

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 74/383 (19%), Positives = 140/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG AA+  AI+ R    +T   +  R I ++     +  + +
Sbjct: 96  FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYFLVTTLSKSQRTITLNLRDMDFNHTWN 155

Query: 66  LAMF----------------------HPSFSFIIMAINHIKPSCGFDLK----------- 92
           +                            +  +   +  I P    +++           
Sbjct: 156 IDDLPWDFFKQPSKKKYYYDLVTSLDEELYDSLKPCVEDISPKAPEEIRKKHKGSALAFL 215

Query: 93  -----------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S +    GLGSSA++    +AALL    TL    +  P   
Sbjct: 216 YLFCSLGSPQHPGAIYTLRSTIPMGAGLGSSASVCTCFSAALLLQIRTLAGPHDDQPPDE 275

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    L + G  SG+D   S  G  + ++   YS        P      
Sbjct: 276 AELQIERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRREDYSKPPKVIPLPNFPELP 335

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              + +     TA  + K+  ++ E+P + E     I++   +    +  +   ++  + 
Sbjct: 336 LLLVDTRQSRSTAVEVAKVGKLKKEHPLVTESILDAIDKVTVSAQSAIQGVEGDSIDKET 395

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ +   +    G L +LGVS  +L   + +L +  +I  +K++G+G G C I L + D 
Sbjct: 396 LEHIGTLVRVNHGFLVSLGVSHPRLER-IRELVDFANIGWTKLTGAGGGGCAITLLRPDA 454

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   + A+       T
Sbjct: 455 SVDALRELERKLAAENFSKYETT 477


>gi|134058497|emb|CAL00706.1| unnamed protein product [Aspergillus niger]
          Length = 448

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 74/383 (19%), Positives = 140/383 (36%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG AA+  AI+ R    +T   +  R I ++     +  + +
Sbjct: 5   FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYFLVTTLSKSQRTITLNLRDMDFNHTWN 64

Query: 66  LAMF----------------------HPSFSFIIMAINHIKPSCGFDLK----------- 92
           +                            +  +   +  I P    +++           
Sbjct: 65  IDDLPWDFFKQPSKKKYYYDLVTSLDEELYDSLKPCVEDISPKAPEEIRKKHKGSALAFL 124

Query: 93  -----------------VISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
                            + S +    GLGSSA++    +AALL    TL    +  P   
Sbjct: 125 YLFCSLGSPQHPGAIYTLRSTIPMGAGLGSSASVCTCFSAALLLQIRTLAGPHDDQPPDE 184

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL--- 180
                  I   A    L + G  SG+D   S  G  + ++   YS        P      
Sbjct: 185 AELQIERINRWAFVGELCIHGNPSGVDNTVSTGGKAVIFRREDYSKPPKVIPLPNFPELP 244

Query: 181 ---IYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
              + +     TA  + K+  ++ E+P + E     I++   +    +  +   ++  + 
Sbjct: 245 LLLVDTRQSRSTAVEVAKVGKLKKEHPLVTESILDAIDKVTVSAQSAIQGVEGDSIDKET 304

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L+ +   +    G L +LGVS  +L   + +L +  +I  +K++G+G G C I L + D 
Sbjct: 305 LEHIGTLVRVNHGFLVSLGVSHPRLER-IRELVDFANIGWTKLTGAGGGGCAITLLRPDA 363

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
           +    + +   + A+       T
Sbjct: 364 SVDALRELERKLAAENFSKYETT 386


>gi|227534348|ref|ZP_03964397.1| galactokinase [Lactobacillus paracasei subsp. paracasei ATCC 25302]
 gi|227187965|gb|EEI68032.1| galactokinase [Lactobacillus paracasei subsp. paracasei ATCC 25302]
          Length = 388

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/361 (16%), Positives = 126/361 (34%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI+      +   +D    + S+     G +D+     
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAISLGTYAAVGTNEDNAFRLYSANFPKVGIIDIPFSDL 83

Query: 68  ------MFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                 ++   F  +   +     +   G ++ +   L    GL SSA++ + +   L  
Sbjct: 84  FQDKRGLWTDYFQGMARVMKTAGANFTHGLNVYINGNLPDGAGLSSSASLEMLVGTILNN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
           L +     P E++     +     G++SG +D  A   G                 +  +
Sbjct: 144 L-FDGGFEPLELVQFGVKVENDYIGVNSGVMDQFAIEMGRANQATLLDTNTMKYEYLPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINE----- 208
           M    I  ++      L  S Y    ++  K ++ ++              E +E     
Sbjct: 203 MGDNVIVIMNTNKRRELADSKYNERRSECEKALAMLQKGIEVKSLGQLSEDEFDENTYLI 262

Query: 209 ----INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
               + ++        + +  + +AL++ +LK   + ++     L     V+  +L  +V
Sbjct: 263 YDPILIKRARHAVFENQRTLKASKALQDGDLKTFGKLVSASGVSLAFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+           +V      K G D        + 
Sbjct: 323 TNALKQRGVLGARMTGAGFGGCAIAIVNSADVEDFIDNVGKAYREKIGYDAHFYVADIAD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|240146233|ref|ZP_04744834.1| galactokinase [Roseburia intestinalis L1-82]
 gi|257201644|gb|EEU99928.1| galactokinase [Roseburia intestinalis L1-82]
          Length = 389

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 123/346 (35%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + ++GEH   +G      A+          R+D+ +   S   +  G L+      
Sbjct: 25  APGRVNMIGEHTDYNGGHVFPCALTIGTYGVARKREDKKLRFYSMNFEQLGVLESSVENL 84

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A     +K   G DL +   + +  GL SSA++   +T  +L 
Sbjct: 85  KPEKEADWTNYPKGVMWAFGEKGMKVEQGMDLVLFGNIPNGSGLSSSASVE-VLTGFILR 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
             +  + +  ++         K  G++ G +D  A   G                    +
Sbjct: 144 DMFGFDVTNQDLALIGQYSENKFNGVNCGIMDQFAIAMGKAGHAIFLDTATLKYEYAPIK 203

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI-------------EYPEINEIN 210
           +    I          L  S Y    ++  K ++ ++              ++ E  +  
Sbjct: 204 LENAKIVISCSNKKRGLGDSKYNERRSECEKALAELQKVVSIDALGDLTEVQFEEHKDAI 263

Query: 211 QKIYALM--------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
           ++   +          + +  + +AL+N ++ +  + MN     L     V+  +L  +V
Sbjct: 264 KEEVCVRRAKHAVYENQRTIKAVEALKNNDVALFGKLMNESHVSLRDDYEVTGIELDTLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +  +   ++ S+++G+G G C +++ K +      + V      K
Sbjct: 324 EEAWKIDGVIGSRMTGAGFGGCTVSIVKDEAVDTFIKEVGAAYEKK 369


>gi|148826536|ref|YP_001291289.1| galactokinase [Haemophilus influenzae PittEE]
 gi|229845870|ref|ZP_04465982.1| galactokinase [Haemophilus influenzae 7P49H1]
 gi|166216973|sp|A5UDQ5|GAL1_HAEIE RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|148716696|gb|ABQ98906.1| galactokinase [Haemophilus influenzae PittEE]
 gi|229810874|gb|EEP46591.1| galactokinase [Haemophilus influenzae 7P49H1]
          Length = 384

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 57/351 (16%), Positives = 118/351 (33%), Gaps = 47/351 (13%)

Query: 2   GQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYC 61
            + L +I V APG + ++GEH   +    +  AIN    +   +R D + N+ ++     
Sbjct: 15  HKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAISGAIRDDHIWNVYAADLDET 74

Query: 62  GSLDLAMF-----HPSFSFIIMAINHIKPS-----CGFDLKVISQLDSQLGLGSSAAITV 111
               L +      H   +++   +  I+        G +L +   +    GL SSAA+ V
Sbjct: 75  DEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEV 134

Query: 112 AITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS-- 168
           A+      L      S  +I         +  G + G +D   S  G      M      
Sbjct: 135 AVGKFCQQL-GDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSL 193

Query: 169 ------------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEY 203
                       +  ++   P  L+   Y T   Q  +              +   +   
Sbjct: 194 ETTPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAAKFFGVKALRDVSVEQFQKRE 253

Query: 204 PEINEINQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSK 256
            E+  ++         +   +       +AL+N +L  L + M      +     ++  +
Sbjct: 254 AELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQ 313

Query: 257 LSEIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           +  +V  ++        ++++G G G C++AL   D      + +  +   
Sbjct: 314 IDYLVELVQLVIGKSGGARMTGGGFGGCIVALAPHDKVDAVRKIIADNYEK 364


>gi|86516618|gb|ABC98001.1| GalK [Shigella boydii]
          Length = 382

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/360 (16%), Positives = 119/360 (33%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQIDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNNFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQRPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVTEQYEAKTGIKETFYVCKPSQGAG 380


>gi|68464835|ref|XP_723495.1| hypothetical protein CaO19.4809 [Candida albicans SC5314]
 gi|68465212|ref|XP_723305.1| hypothetical protein CaO19.12272 [Candida albicans SC5314]
 gi|46445332|gb|EAL04601.1| hypothetical protein CaO19.12272 [Candida albicans SC5314]
 gi|46445529|gb|EAL04797.1| hypothetical protein CaO19.4809 [Candida albicans SC5314]
          Length = 431

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 78/388 (20%), Positives = 134/388 (34%), Gaps = 79/388 (20%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQ 59
           M Q      V APG +++ GEH  ++G  A+  A++ R  L ++   D   I +     +
Sbjct: 1   MSQLP--FIVGAPGKVIIFGEHAAVYGKPAIAAALSLRCYLLVSPSSDSNTIRLQFPDIK 58

Query: 60  YCGSLDLAM--------------------------------------------FHPSFSF 75
              S ++                                              ++  F F
Sbjct: 59  LDHSWNIKDLPWEEIKPYLTYDSANKPQIPSELVPEIVDKLSSFLNGFDNKMHYYACFCF 118

Query: 76  IIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE--------- 125
           + + +N       G +  V S L    GLGSSA+ +V +++AL  +              
Sbjct: 119 LYLLMNLCDSKVSGMNFIVRSTLPIGAGLGSSASTSVCLSSALALMGGWINKPSLHENDK 178

Query: 126 ------PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPI 178
                 P  + I   +        G  SGID A +  GG + +Q      +  I      
Sbjct: 179 LDTADIPDLEFIDKWSLIGEKCFHGNPSGIDNAVATFGGAVMFQRTSTPEQPSIRTNMRN 238

Query: 179 HLIY------SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-- 230
                     +     TA ++  +  +     E N I+  I   +  LSQ + + + N  
Sbjct: 239 FPAIKLLLTNTKVPKSTADLVAGVGRL---NAEFNSISTSILTAIEHLSQEAYKVMMNPM 295

Query: 231 ---KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              +   VL + +N   GLL  LGVS   L   V  + ++  I A+K++G+G G C I L
Sbjct: 296 FGKEETNVLRKLVNINHGLLVALGVSHPALET-VKIIGDKHRIGATKLTGAGGGGCAITL 354

Query: 288 GKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
              D+      +        G +    +
Sbjct: 355 VNDDVEESVIHNAIKEFEDSGYESFETS 382


>gi|50978800|ref|NP_001003104.1| galactokinase [Canis lupus familiaris]
 gi|32363163|sp|Q9GKK4|GALK1_CANFA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|12003984|gb|AAG43832.1|AF213513_1 galactokinase [Canis lupus familiaris]
 gi|27462640|gb|AAO15527.1| galactokinase [Canis lupus familiaris]
 gi|30421122|gb|AAP31026.1| galactokinase [Canis lupus familiaris]
          Length = 392

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/345 (17%), Positives = 104/345 (30%), Gaps = 48/345 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI--DSSLGQYCGSL 64
           ++ VSAPG + L+GEH   +    L  A+    +L  + R D L+++   S        L
Sbjct: 29  ELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVLVGSPRADGLVSLLTTSEDADEPRRL 88

Query: 65  DLAMFHP----------SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
              +               +++   I H    P  GF   V+S +    GL SSA++ VA
Sbjct: 89  QFPLPTAQRSLEPGTPRWANYVKGVIQHYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVA 148

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----GGLICYQMPKYS 168
               L  L                       G+  GI           G  +        
Sbjct: 149 TYTFLQQLCPDSGSVAAR-AQVCQQAEHSFAGVPCGIMDQLIALLGQEGHALLIDCRSLE 207

Query: 169 IEKIDFIFPIHLIYSG------------YKTPTAQVLK-----KISYIEIEYPEINEINQ 211
              +    P   +               Y     Q  +         +     E  E  +
Sbjct: 208 TSLVPLSEPKLAVLITNSNVRHSLGSSEYPLRRRQCEEVARALGKESLREVQLEELEAGR 267

Query: 212 KIYALMGKL-----------SQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSE 259
           ++ +  G             +  +  AL   + +   + M      L     VS  +L +
Sbjct: 268 ELVSKEGFRRARHVVGEIRRTAQAAAALCRGDYRAFGRLMVESHHSLRDDYEVSCPELDQ 327

Query: 260 IVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM 304
           +V      P +  S+++G G G C + L +    S   Q +    
Sbjct: 328 LVEAALSAPGVYGSRMTGGGFGGCTVTLLEASFTSQVMQHIQEQY 372


>gi|225376668|ref|ZP_03753889.1| hypothetical protein ROSEINA2194_02310 [Roseburia inulinivorans DSM
           16841]
 gi|225211551|gb|EEG93905.1| hypothetical protein ROSEINA2194_02310 [Roseburia inulinivorans DSM
           16841]
          Length = 448

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 52/346 (15%), Positives = 121/346 (34%), Gaps = 51/346 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + ++GEH   +G      A+          R D+ +   S   +  G ++      
Sbjct: 84  APGRVNMIGEHTDYNGGHVFPCALTIGTYGVARKRNDKKLRFYSMNFEQLGVIESSVEGL 143

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A     +K   G DL +   + +  GL SSA++   +T  +L 
Sbjct: 144 KPEKEADWTNYPKGVMWAFGEKGMKVEQGMDLVLFGNIPNGSGLSSSASVE-VLTGYILK 202

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICYQ 163
             +  + +  ++         K  G++ G +D  A   G                    +
Sbjct: 203 DMFGFDVTNQDLALIGQFSENKFNGVNCGIMDQFAIAMGKAGHAIFLDTATLKYEYAPIK 262

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM---- 217
           +    I          L  S Y    ++    ++ ++   +   + ++ ++ +       
Sbjct: 263 LENAKIVISCSNKKRGLGDSKYNERRSECETALAELQKVVKIDSLGDLTEEQFEQYKDAI 322

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL+N ++ +  + MN     L     V+  +L  +V
Sbjct: 323 KDPVRVKRAKHAVYENQRTIKAVEALKNNDVALFGELMNASHVSLRDDYEVTGIELDTLV 382

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +  +   ++ S+++G+G G C +++ K +      + V      K
Sbjct: 383 EEAWKVDGVIGSRMTGAGFGGCTVSIVKDEAVDSFIEKVGAAYKDK 428


>gi|116494212|ref|YP_805946.1| galactokinase [Lactobacillus casei ATCC 334]
 gi|122264358|sp|Q03BB8|GAL1_LACC3 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|116104362|gb|ABJ69504.1| galactokinase [Lactobacillus casei ATCC 334]
          Length = 388

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/361 (16%), Positives = 126/361 (34%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI+      +   +D    + S+     G +D+     
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAISLGTYAAVGTNEDNAFRLYSANFPKVGIIDIPFSDL 83

Query: 68  ------MFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                 ++   F  +   +     +   G ++ +   L    GL SSA++ + +   L  
Sbjct: 84  FQDKRGLWTDYFQGMARVMKTAGANFTHGLNVYINGNLPDGAGLSSSASLEMLVGTILNN 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L +     P E++     +     G++SG+    +I  G                 +  +
Sbjct: 144 L-FDGGFEPLELVQFGVKVENDYIGVNSGVMDQFAIEMGRANQATLLDTNTMKYEYLPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINE----- 208
           M    I  ++      L  S Y    ++  K ++ ++              E +E     
Sbjct: 203 MGDNVIVIMNTNKRRELADSKYNERRSECEKALAMLQKGIEVKSLGQLSEDEFDENTYLI 262

Query: 209 ----INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
               + ++        + +  + +AL++ +LK   + ++     L     V+  +L  +V
Sbjct: 263 YDPILIKRARHAVFENQRTLKASKALQDGDLKTFGKLVSASGVSLAFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+           +V      K G D        + 
Sbjct: 323 TNALKQRGVLGARMTGAGFGGCAIAIVNSADVEDFIDNVGKAYREKIGYDAHFYVADIAD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|238020785|ref|ZP_04601211.1| hypothetical protein GCWU000324_00675 [Kingella oralis ATCC 51147]
 gi|237867765|gb|EEP68771.1| hypothetical protein GCWU000324_00675 [Kingella oralis ATCC 51147]
          Length = 381

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 63/364 (17%), Positives = 118/364 (32%), Gaps = 47/364 (12%)

Query: 5   LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL 64
            H   + APG + L+GEH   +    L  AI+    + +     R + + ++        
Sbjct: 17  PHTALIRAPGRVNLIGEHTDYNDGFVLPCAIDFATHVAIAPNGSRSVRVYAADYGERDEF 76

Query: 65  DLA--------MFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAIT 114
            L          +      +I A+     +   G D+ V   +    GL SSAA+ VAI 
Sbjct: 77  SLDTPIAPSDKQWANYIRGVIWALAEHGFRLPEGVDIAVSGNVPQGAGLSSSAALEVAIG 136

Query: 115 AALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASI----HGGLICYQMPKYS-- 168
            A +   +    S  EI         +  G + GI    +      G  +       +  
Sbjct: 137 KA-VQHVFRLPLSATEIAQIGQYAENRFVGCNCGIMDQLTSARGEAGHAVLIDCRSLNAQ 195

Query: 169 ---------IEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEY 203
                    I  I       L+ S Y T  AQ                 L +    +   
Sbjct: 196 AVPIPAGLAIMIIHSHVQRGLVGSEYNTRRAQCETAAAHFGVPALRDVSLAQFDAGKQGL 255

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
                   +      + +  + +A+R  ++  L++ M      +     ++   +  +V 
Sbjct: 256 DATAARRARYIIQENQRTLDAAEAMRRNDIPALSRLMAESHAGMRDEFEITHPAVDTLVE 315

Query: 263 KLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSH 318
              E       ++++G G G C++AL   DL       +  H   + G+  ++   TP  
Sbjct: 316 LASEIIGERGGARMTGGGFGGCIVALVPHDLVDAVKTHIAAHYQTRTGLQEEVFVCTPQA 375

Query: 319 STSL 322
             S+
Sbjct: 376 GVSV 379


>gi|157160232|ref|YP_001457550.1| galactokinase [Escherichia coli HS]
 gi|166989670|sp|A7ZY13|GAL1_ECOHS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|157065912|gb|ABV05167.1| galactokinase [Escherichia coli HS]
          Length = 382

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 127/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK +++ M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMSELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|313204603|ref|YP_004043260.1| galactokinase [Paludibacter propionicigenes WB4]
 gi|312443919|gb|ADQ80275.1| galactokinase [Paludibacter propionicigenes WB4]
          Length = 386

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/362 (16%), Positives = 119/362 (32%), Gaps = 50/362 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGS-------- 63
           +PG + L+GEH   +G +    A++    L L     ++IN  S       S        
Sbjct: 24  SPGRVNLIGEHTDYNGGSVFPCALSFGTYLLLAKNDKKVINFKSLNQPEIISLGFDQLTT 83

Query: 64  -LDLAMFHPSFSFIIMAINH-IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQ 121
            LD +  +     I   +   +  + G+D+ +   + +  GL SSAA+ V    A    Q
Sbjct: 84  PLDKSWVNYPLGVIAQFVKRGVAITEGYDILIWGNVPNGAGLSSSAALEVVTAYAFND-Q 142

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQMP 165
                +   +         +   ++ GI    +   G                 +  ++ 
Sbjct: 143 LETGFNRTVLAQIGQKSEHEFALVNCGIMDQFASANGAKDHAIHLNCDTLEFELVPVKLE 202

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALMG----- 218
              I   +   P  L    Y    A+    +  +    P   + E+ +  +  +      
Sbjct: 203 GVKILISNTHSPHKLDSGAYNQRVAECKLAVEQLNKVRPLKYLAELTEAEFKSIESAITD 262

Query: 219 --------------KLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWK 263
                         + +  + +AL+  +L +  Q MN     L     V+  +L  +  +
Sbjct: 263 PVAHKRARHVVGEVQRTSDAVKALKAGDLTLFGQLMNASHVSLRDDYEVTGPELDTMAAE 322

Query: 264 LREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHSTSL 322
             +   ++ S+++G G G C ++L K +      + V     AK GI             
Sbjct: 323 AWKIDGVIGSRMTGGGFGGCTVSLVKDEAIDTFIKEVGAAYEAKIGIKPEFYIAEIGNGA 382

Query: 323 YR 324
            +
Sbjct: 383 CK 384


>gi|150863997|ref|XP_001382664.2| mevalonate kinase [Scheffersomyces stipitis CBS 6054]
 gi|149385253|gb|ABN64635.2| mevalonate kinase [Scheffersomyces stipitis CBS 6054]
          Length = 432

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 77/377 (20%), Positives = 137/377 (36%), Gaps = 70/377 (18%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRL--------INIDSSLGQ 59
             VSAPG +++ GEH  ++G  A+  A++ R  L +T  +D          IN+  S  +
Sbjct: 5   FFVSAPGKVIIFGEHSAVYGKPAIAAALSLRAYLLVTPSQDPDTINLSFPDINLTHSWNK 64

Query: 60  YCGSLDLAMFHPSF---------SFIIMAINHIK-------------------------- 84
                D  + H +            +   ++ +                           
Sbjct: 65  NDIPWDSIVKHINLVDNLPQTSEELVPEIVDQLGSVLADLNSSLHYTACLCFLYLYTHLC 124

Query: 85  --PSCGFDLKVISQLDSQLGLGSSAAITVAITAA---------------LLTLQYHKEPS 127
                G    + S L    GLGSSA+  V + +A                  +   +   
Sbjct: 125 NQELAGMSFCIRSTLPIGAGLGSSASTAVCLASALAILGNRVTSASFLQTDKILKKENND 184

Query: 128 PDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMP----KYSIEKIDFIFPIHLI-- 181
            D I + +        G  SGID A + HGG + +Q      + S+      FP   +  
Sbjct: 185 LDFIDSWSLMGEKCFHGNPSGIDNAVATHGGAVMFQRMNNPAQPSVRTSMRNFPAIKLLL 244

Query: 182 -YSGYKTPTAQVLKKISYIEIEYPEI-NEINQKIYALMGKLSQISCQ-ALRNKNLKVLAQ 238
             +     TA ++  +  + +EYP+  N I + +  L     QI  +     +  K L +
Sbjct: 245 TNTKVPRSTADLVGGVGKLNVEYPKTSNSILEAMEHLSNTAYQIMVRPFFGAEERKKLRE 304

Query: 239 AMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQ 298
            +N   GLL  LGVS   L + V  + +   + ++K++G+G G C I L   D++     
Sbjct: 305 LVNINHGLLVALGVSHPSLEK-VKIITDTSKLGSTKLTGAGGGGCAITLVDEDVSEADIA 363

Query: 299 SVNCHMHAKGIDIVPIT 315
                +  +G +    +
Sbjct: 364 QGIAELEKEGYECFETS 380


>gi|254229347|ref|ZP_04922764.1| galactokinase [Vibrio sp. Ex25]
 gi|262393435|ref|YP_003285289.1| galactokinase [Vibrio sp. Ex25]
 gi|151938155|gb|EDN56996.1| galactokinase [Vibrio sp. Ex25]
 gi|262337029|gb|ACY50824.1| galactokinase [Vibrio sp. Ex25]
          Length = 386

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 55/350 (15%), Positives = 111/350 (31%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D ++ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNIVRVVSVDYGN 74

Query: 60  YCGSLDLAM---------FHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+           +       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  VVDEFDIIQAITFQQDKMWANYIRGVVKCLLARGYQFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            ++  ++E        +++G G G C++AL    L      +V     A 
Sbjct: 315 TLMEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKAAVEAKYQAA 364


>gi|153824854|ref|ZP_01977521.1| galactokinase [Vibrio cholerae MZO-2]
 gi|149741572|gb|EDM55602.1| galactokinase [Vibrio cholerae MZO-2]
          Length = 405

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/341 (17%), Positives = 105/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D L+    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDFLVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 VIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                           +  +  
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAEFDPVVA 282

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMTRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPTQVEAVQQAVAEHYEAA 383


>gi|15672386|ref|NP_266560.1| mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|281490946|ref|YP_003352926.1| mevalonate kinase [Lactococcus lactis subsp. lactis KF147]
 gi|12723278|gb|AAK04502.1|AE006277_2 mevalonate kinase [Lactococcus lactis subsp. lactis Il1403]
 gi|281374704|gb|ADA64224.1| Mevalonate kinase [Lactococcus lactis subsp. lactis KF147]
 gi|326405980|gb|ADZ63051.1| mevalonate kinase [Lactococcus lactis subsp. lactis CV56]
          Length = 310

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 69/304 (22%), Positives = 124/304 (40%), Gaps = 7/304 (2%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A   L+L+GEH V++G  A+   +   +  + +T  K     I+++  +    L    F 
Sbjct: 11  AHSKLILIGEHSVVYGQPAIALPVTILKTTVTITSSKYGQY-IENNEFRRRLDLMGDEFE 69

Query: 71  PSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                I+  ++    S   F L++ S +    GLG+SA++  AI  A       + P  D
Sbjct: 70  GIRQLIMRLLSKFHSSKMPFSLEIDSNIPQGRGLGASASLATAIIRAFYDFFDAELPQKD 129

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
            +     +      G SSGID+A       + + +   +IE  +      ++        
Sbjct: 130 LLFYANFS-ENITHGKSSGIDVATVNSEHPLWF-IKDSTIEPFELNLHGFIVIGDTGV-H 186

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
               + I+ +  +  E  E  Q     +G+L+  S   L    LK     MN+    L  
Sbjct: 187 GFTSQAINIVREKLVEEKEKTQDSINHLGQLATDSKDFLMTDKLKEFGHVMNKAHERLSD 246

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
           LGVS  +L  +V   R +   + +K++GSGLG  ++AL + + +++          AK  
Sbjct: 247 LGVSHPRLDNLVETAR-KNGALGAKLTGSGLGGVMVALAENEKDAIRISQRLLKNGAKNT 305

Query: 310 DIVP 313
            I  
Sbjct: 306 WIYS 309


>gi|153852986|ref|ZP_01994423.1| hypothetical protein DORLON_00408 [Dorea longicatena DSM 13814]
 gi|149754628|gb|EDM64559.1| hypothetical protein DORLON_00408 [Dorea longicatena DSM 13814]
          Length = 389

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/362 (16%), Positives = 118/362 (32%), Gaps = 53/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           APG + L+GEH   +G      A+       +  R+DR +   S   +  G ++      
Sbjct: 25  APGRVNLIGEHTDYNGGHVFPCALTMGTWAVVRNREDRKLGFFSLNFEKLGIIETSLDEL 84

Query: 66  ----LAMFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                A +      ++ A          G D+ +   + +  GL SSA++ V     L  
Sbjct: 85  IPSKNAGWTNYPKGVMWAFEKRGYELTHGMDILIYGNIPNGSGLSSSASLEVLTGLMLKD 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL----------ICYQMPKY- 167
               ++ S  ++            G + G +D  AS  G            + Y+     
Sbjct: 145 TFGFEDLSMIDLALIGQYSENNFNGCNCGIMDQFASAMGKKDHAIFLDTNTLKYEYAPVV 204

Query: 168 ----SIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---------------------- 201
                I  I+      L+ S Y     +    +  ++                       
Sbjct: 205 LENAKIVIINSKVKHSLVDSAYNDRRNECETALKELQKVTDIKTLGDLTEDGFEQYKDAI 264

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
           + P   +  +       + +  + +ALRN ++K+  Q MN     L     VS  ++  +
Sbjct: 265 KDPVRQKRAKHAVYE-NQRTIRAVEALRNNDVKLFGQLMNASHESLRYDYEVSCEEIDIL 323

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHS 319
           V   +  P ++ S+I+G G G C +++ +        + +      K G +         
Sbjct: 324 VDLAQAMPGVIGSRITGGGFGGCTVSIVEEGTVDKFIEEIGKTYKEKVGHEAEFYVVDIG 383

Query: 320 TS 321
             
Sbjct: 384 DG 385


>gi|86516662|gb|ABC98023.1| GalK [Shigella dysenteriae]
          Length = 382

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|301155758|emb|CBW15226.1| galactokinase [Haemophilus parainfluenzae T3T1]
          Length = 384

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/347 (17%), Positives = 118/347 (34%), Gaps = 47/347 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           ++ V APG + ++GEH   +    +  AIN    +  + R D + N+ ++      +  L
Sbjct: 20  ELTVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAIAGSKRADHIWNVYAADLDLEDTFSL 79

Query: 67  AMFHP-----SFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAITVAITAA 116
               P       +++   +  I+  C     G DL +   +    GL SSAA+ VA    
Sbjct: 80  DEDFPQSEQKWANYVRGVVKFIQERCPQFKQGADLVISGNVPHSSGLSSSAALEVATGKF 139

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGLICYQMPKYS------- 168
              L      +  EI         K  G + G +D   S  G      M           
Sbjct: 140 CQQLS-DLPLTHTEIALIGQKAENKFVGANCGNMDQLISALGQKDHLLMIDCRSLETQPT 198

Query: 169 -------IEKIDFIFPIHLIYSGYKTPTAQVLKK-------------ISYIEIEYPEINE 208
                  +  ++   P  L+   Y T   Q  K              +   +    E+  
Sbjct: 199 PVPKDVAVIIVNSNVPHDLVTGEYNTRRWQCEKAAEFFGVKALRDVSVEEFQKREAELTA 258

Query: 209 INQKIYALMGKLSQIS------CQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIV 261
           +N  +      +   +       +AL++ +L  L + M +    +     ++  ++  +V
Sbjct: 259 LNALVAKRARHVVTENQRVLDAVEALKHNDLTKLGELMGQSHESMRDDFEITVPQIDYLV 318

Query: 262 WKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
              +        ++++G G G C++AL   D      + +  +   +
Sbjct: 319 ELAQLVIGKTGGARMTGGGFGGCIVALAPHDKVEAVRKIIADNYEKQ 365


>gi|229008314|ref|ZP_04165808.1| Galactokinase [Bacillus mycoides Rock1-4]
 gi|228752944|gb|EEM02488.1| Galactokinase [Bacillus mycoides Rock1-4]
          Length = 387

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 63/361 (17%), Positives = 122/361 (33%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           APG + L+GEH   +G      AI        + R D LI   S      G        L
Sbjct: 18  APGRINLIGEHTDYNGGNVFPCAITFGTYALASKRDDALICAYSLNFAEKGVISFSLHEL 77

Query: 65  DLAMFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D    H   ++    I ++         G ++     + +  GL SSA+I +     +  
Sbjct: 78  DYKQEHDWANYPKGMIRYLIEAGYSIDSGINIMFYGNIPNGAGLSSSASIELVTGVTMEG 137

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICY----------------Q 163
           L +  E    E++     +     G++SGI    +I  G   Y                Q
Sbjct: 138 L-FQFELDRIELVKIGKKVENYFIGVNSGIMDQFAIGMGKARYGMLLNCQTLNFTYAPLQ 196

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI--EYPEINEINQKIYALM---- 217
           +  Y+I  ++      L  S Y     +  + ++ ++   +   + E+ +K++       
Sbjct: 197 LDNYNIIIMNTNKRRELTASKYNERRMECEQALAKLQEVIDISSLGELTEKMFEQYKHVI 256

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                             +  S + L+  N+K   + MN     L     V+  +L  +V
Sbjct: 257 KEDSLRKRAKHVVYENCRTLQSVKELKENNIKEFGRLMNESHCSLRDDYEVTGRELDTLV 316

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C I + + +       +V        G +          
Sbjct: 317 ESAWKQEGVIGARMTGAGFGGCAIVIVEKEYTDQFICNVGQKYRDTIGYEATFYVAEIGD 376

Query: 321 S 321
            
Sbjct: 377 G 377


>gi|157377152|ref|YP_001475752.1| galactokinase [Shewanella sediminis HAW-EB3]
 gi|157319526|gb|ABV38624.1| galactokinase [Shewanella sediminis HAW-EB3]
          Length = 388

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/340 (17%), Positives = 112/340 (32%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS----------LGQYC 61
           APG + L+GEH   +    L  AIN   I+ +  R+D +    S            GQ  
Sbjct: 26  APGRVNLIGEHTDYNDGFVLPAAINFHTIVAVKRREDDIYRAVSDAFPGEIKEWAFGQEG 85

Query: 62  GSLDLAMFHPSFSFIIMAINHIK-PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                  +         A+     P+ G D+ V+  +    GL SSAA+ +A   A+   
Sbjct: 86  VMTSEDGWVNYLKGFTAAMAASGLPAKGLDIAVVGNVPLGAGLSSSAALELAFGTAVNDC 145

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---GLICYQMPKYSIEKIDFIF 176
                 SP  +   A     +  G + G +D   S  G     +         E +    
Sbjct: 146 S-QLRLSPLAVAQMAQRGENQYVGCACGIMDQMISALGEQDHALLIDCEDLDSEPVHIPD 204

Query: 177 PIHLIYSGYKTPTAQVLKKISYIEIEYPEI---------------------NEINQKIYA 215
            + LI          V  + +    +  E+                     +E++   Y 
Sbjct: 205 SLSLIIVNSNVQRGLVDSEYNLRREQCEEVASHFGLDSLRHLELSQLEAAKSELSDVCYR 264

Query: 216 LMGKLSQISC------QALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
               +   +        AL   N+  L++ M +    +     ++  ++  +V  + +  
Sbjct: 265 RARHVLTENRRTQNASHALEAGNITTLSELMAQSHASMRDDFEITVPQIDTLVEIISDVI 324

Query: 269 HI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G CV+AL   DL     +++      +
Sbjct: 325 GTRGGVRMTGGGFGGCVVALVDHDLTDAVVEAIEAEYPKQ 364


>gi|229520619|ref|ZP_04410043.1| galactokinase [Vibrio cholerae TM 11079-80]
 gi|229342443|gb|EEO07437.1| galactokinase [Vibrio cholerae TM 11079-80]
          Length = 407

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 57/341 (16%), Positives = 103/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D  +    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDSRVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                              +  
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVA 282

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMTRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  +  A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPTQVEAVQQAVAENYEAA 383


>gi|225562386|gb|EEH10665.1| mevalonate kinase [Ajellomyces capsulatus G186AR]
          Length = 488

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 74/382 (19%), Positives = 137/382 (35%), Gaps = 76/382 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQY----- 60
             VSAPG +++ GEH V+HG  A+  AI+ R  L +T   +  R I ++    +      
Sbjct: 42  FMVSAPGKVIVFGEHAVVHGRRAIAAAISLRSYLLVTTLSKSHRTITLNFRDIELDHTWD 101

Query: 61  CGSLDLAMFHPSFS--------------------------------------------FI 76
             SL   +FH                                                F+
Sbjct: 102 IDSLPWDLFHHPSKKKFYHSSVTSLDTELLEAIQPHIADISIGKPDEVRKIHQSSATAFL 161

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAA------------LLTLQYH 123
            + ++   P     +  + S +    GLGSSA+I V ++AA               L   
Sbjct: 162 YLFLSLSSPQTHAAVYTLRSTIPIGAGLGSSASIAVCLSAALLLQIRILAGPHQDQLPEE 221

Query: 124 KEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIF------P 177
            E   + I   A    + + G  SG+D   S  G  + ++   YS              P
Sbjct: 222 AETQIERINKWAFVGEMCIHGNPSGVDNTVSAGGKAVIFRRGDYSKPPSVTPILDFPELP 281

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ S     T+  + K++     +P ++E     I+Q   +    +         ++ 
Sbjct: 282 LLLVNSRQPRSTSVEVAKVANFCKAHPAVSESILEAIDQVTESASNLIQSGRFDKSSSEA 341

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           +    +      GLL +LGVS  +L   + +L +      +K++G+G G C I L + ++
Sbjct: 342 IDHFGELFRINHGLLVSLGVSHPRLER-IRELVDHTGSGWTKLTGAGGGGCAITLLRTNI 400

Query: 293 NSLPYQSVNCHMHAKGIDIVPI 314
           +    + +   +  +G +    
Sbjct: 401 DPAALKRLEKTLDDEGFERYET 422


>gi|238878641|gb|EEQ42279.1| hypothetical protein CAWG_00483 [Candida albicans WO-1]
          Length = 431

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 78/388 (20%), Positives = 134/388 (34%), Gaps = 79/388 (20%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKD-RLINIDSSLGQ 59
           M Q      V APG +++ GEH  ++G  A+  A++ R  L ++   D   I +     +
Sbjct: 1   MSQLP--FIVGAPGKVIIFGEHAAVYGKPAIAAALSLRCYLLVSPSSDSNTIRLQFPDIK 58

Query: 60  YCGSLDLAM--------------------------------------------FHPSFSF 75
              S ++                                              ++  F F
Sbjct: 59  LDHSWNIKDLPWEEIKPYLTYDSANKPQIPSELVPEIVDKLSSFLNGFDNKMHYYACFCF 118

Query: 76  IIMAINHI-KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKE--------- 125
           + + +N       G +  V S L    GLGSSA+ +V +++AL  +              
Sbjct: 119 LYLLMNLCDSKVSGMNFIVRSTLPIGAGLGSSASTSVCLSSALALMGGWINKPSLHENDK 178

Query: 126 ------PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK-IDFIFPI 178
                 P  + I   +        G  SGID A +  GG + +Q      +  I      
Sbjct: 179 LDTADIPDLEFIDKWSLIGEKCFHGNPSGIDNAVATFGGAVMFQRTSTPEQPSIRTNMRN 238

Query: 179 HLIY------SGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRN-- 230
                     +     TA ++  +  +     E N I+  I   +  LSQ + + + N  
Sbjct: 239 FPAIKLLLTNTKVPKSTADLVAGVGRL---NAEFNSISTSILTAIEHLSQEAYKVMMNPM 295

Query: 231 ---KNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
              +   VL + +N   GLL  LGVS   L   V  + ++  I A+K++G+G G C I L
Sbjct: 296 FGKEETNVLRKLVNINHGLLVALGVSHPALET-VKIIGDKHRIGATKLTGAGGGGCAITL 354

Query: 288 GKGDLNSLPYQSVNCHMHAKGIDIVPIT 315
              D+      +        G +    +
Sbjct: 355 VNDDVEEFVIHNAIKEFEDSGYESFETS 382


>gi|154049|gb|AAA27113.1| galactokinase (galK) (EC 2.7.1.6) [Salmonella enterica subsp.
           enterica serovar Typhimurium]
          Length = 380

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 69/359 (19%), Positives = 122/359 (33%), Gaps = 48/359 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRTVRVIAADYDNQVDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ + S +    GL SSA++ VA+    
Sbjct: 82  APIVTHDSQQWSNYVRGVVKHLQLRNNAFGGVDMVI-SNVPQGAGLSSSASLEVAVGTVF 140

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQ 163
             L YH        L    A    V      +D   S  G                    
Sbjct: 141 QQL-YHLPLDAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLGAKAVSM 199

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYIEIEYPEIN 207
               ++  I+  F   L+ S Y T   Q                 L+  + +  E   + 
Sbjct: 200 PKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVSLEAFNAVASELDPVV 259

Query: 208 EINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
               +        +  +  AL   +L+ + Q M      +     ++  ++  +V  ++ 
Sbjct: 260 AKRVRHVLSENARTVEAASALEKGDLQRMGQLMAESHASMRDDFEITVPQIDTLVDIVKA 319

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                   +++G G G CV+AL   DL     Q+V     AK GI +   +  PS    
Sbjct: 320 TIGDRGGVRMTGGGFGGCVVALIPEDLVPAVRQAVAQQYEAKTGIKETFYVCKPSQGAG 378


>gi|86516648|gb|ABC98016.1| GalK [Shigella dysenteriae]
 gi|86516650|gb|ABC98017.1| GalK [Shigella dysenteriae]
          Length = 382

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 67/360 (18%), Positives = 123/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICY 162
             L YH      +I         +  G + GI                      G     
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGSKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALM-- 217
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDLI 260

Query: 218 -----------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                         +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|323339820|ref|ZP_08080089.1| mevalonate kinase [Lactobacillus ruminis ATCC 25644]
 gi|323092693|gb|EFZ35296.1| mevalonate kinase [Lactobacillus ruminis ATCC 25644]
          Length = 319

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 63/312 (20%), Positives = 124/312 (39%), Gaps = 6/312 (1%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           +   ++L+GEH V++G  A+   +   +    +  R+D  I I S       +   +   
Sbjct: 12  SHAKVILIGEHSVVYGRPAIAIPLKTIKATSTIKSREDGQIIIHSERFDGLLADAPSDMT 71

Query: 71  PSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDE 130
                I+ A+       G +  + S +    G+GSSA + VA+  AL +  +    S  E
Sbjct: 72  GIKKLILDAVRKQNYQKGLEATLKSMVPIARGMGSSACVAVALARALFSF-FSLHFSEKE 130

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           +L  A+   +      SG+D A       I     K     I+    + +  +G K  T+
Sbjct: 131 LLAAANIEEVATHTNPSGLDAATCASNTPIWMMAGKIKRIPINLDGCLLICDTGIKGQTS 190

Query: 191 QVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETL 250
           + +     ++       +    ++  + +L+  + + L   +L  L Q  +  Q +L+TL
Sbjct: 191 EAIAA---VKKRLGSDAKETNALFDKLQELTFAAKKQLAKNDLIGLGQTFDAAQSVLKTL 247

Query: 251 GVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGID 310
           GVS  +L E +   ++    + +K++G G G C I L K    +            +   
Sbjct: 248 GVSCDELDEYISVAKD-NGALGAKLTGGGRGGCFICLTKNAAQANELAQKLSLTGVRQTW 306

Query: 311 IVPITPSHSTSL 322
           I P+      ++
Sbjct: 307 IEPLAAKEEKNV 318


>gi|253581959|ref|ZP_04859183.1| galactokinase [Fusobacterium varium ATCC 27725]
 gi|251836308|gb|EES64845.1| galactokinase [Fusobacterium varium ATCC 27725]
          Length = 391

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 53/347 (15%), Positives = 116/347 (33%), Gaps = 52/347 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG--------- 62
           +PG + L+GEH   +G      A++      +  R+D+   + S   +  G         
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKAFRMYSKNFEKLGIKEFSLDKL 83

Query: 63  -SLDLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
            ++    +      +I        K   G D+     + +  GL SSA+I + +T+ +L 
Sbjct: 84  INIPSDNWANYPKGVIKTFIDAGYKIDKGLDILFFGNIPNGAGLSSSASIEL-LTSVILK 142

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG---------------GLICYQ 163
             +       E++  +        G++ G +D  A   G                    +
Sbjct: 143 ENFKLNIDMIEMVKLSQKAENNFIGVNCGIMDQFAIGMGKKDNAILLDCNTLEYHYAPVK 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------Y 203
           +   SI   +      L  S Y          +  +                       +
Sbjct: 203 LNGASIVIANTNKKRGLADSKYNERRNSCEAAVKVLNKNGIDIKNLGELSVKKFNEVKHF 262

Query: 204 PEINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
               E  ++        + ++ + + L   N+K   + MN+    L     V+  +L  +
Sbjct: 263 ITDKEQLKRATHAVTENERTKTAVEELNAGNVKAFGKLMNQSHISLRDDYEVTGFELDSL 322

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V    E   ++ ++++G+G G C +++ + +      +SV     +K
Sbjct: 323 VEAAWEAKGVIGARMTGAGFGGCTVSIVEDEFIDEFIKSVGEKYKSK 369


>gi|260853985|ref|YP_003227876.1| galactokinase [Escherichia coli O26:H11 str. 11368]
 gi|260866881|ref|YP_003233283.1| galactokinase [Escherichia coli O111:H- str. 11128]
 gi|257752634|dbj|BAI24136.1| galactokinase [Escherichia coli O26:H11 str. 11368]
 gi|257763237|dbj|BAI34732.1| galactokinase [Escherichia coli O111:H- str. 11128]
 gi|323153733|gb|EFZ39980.1| galactokinase [Escherichia coli EPECa14]
 gi|323180010|gb|EFZ65566.1| galactokinase [Escherichia coli 1180]
          Length = 382

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 67/359 (18%), Positives = 122/359 (33%), Gaps = 46/359 (12%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG--------------LICYQ 163
             L Y         L    A    V      +D   S  G                    
Sbjct: 142 QQLYYLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVSM 201

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGKL 220
               ++  I+  F   L+ S Y T   Q      + +        I E N   + L   +
Sbjct: 202 PKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPIV 261

Query: 221 SQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLRE 266
           ++                 AL   +LK + + M      +     ++  ++  +V  ++ 
Sbjct: 262 AKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVKA 321

Query: 267 QPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                   +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 322 VIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|191637547|ref|YP_001986713.1| Galactokinase (Galactose kinase) [Lactobacillus casei BL23]
 gi|229874582|sp|B3W7I5|GAL1_LACCB RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|190711849|emb|CAQ65855.1| Galactokinase (Galactose kinase) [Lactobacillus casei BL23]
 gi|195928077|gb|ACG55694.1| GalK [Lactobacillus casei]
 gi|327381593|gb|AEA53069.1| hypothetical protein LC2W_0735 [Lactobacillus casei LC2W]
 gi|327384759|gb|AEA56233.1| hypothetical protein LCBD_0735 [Lactobacillus casei BD-II]
          Length = 388

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 58/361 (16%), Positives = 127/361 (35%), Gaps = 52/361 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA---- 67
           APG + L+GEH   +G      AI+      +   +D    + S+     G +D+     
Sbjct: 24  APGRINLIGEHTDYNGGHVFPCAISLGTYAAVGTNEDNAFRLYSANFPKVGIIDIPFSDL 83

Query: 68  ------MFHPSFSFIIMAINHIKPS--CGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                 ++   F  +   +     +   G ++ +   L    GL SSA++ + +   L +
Sbjct: 84  FQDKRGLWTDYFQGMARVMKTAGANFTHGLNVYINGNLPDGAGLSSSASLEMLVGTILNS 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------------LICYQ 163
           L +     P E++     +     G++SG+    +I  G                 +  +
Sbjct: 144 L-FDGGFEPLELVQFGVKVENDYIGVNSGVMDQFAIEMGRANQATLLDTNTMKYEYLPVE 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI----------EYPEINE----- 208
           M    I  ++      L  S Y    ++  K ++ ++              E +E     
Sbjct: 203 MGDNVIVIMNTNKRRELADSKYNERRSECEKALAMLQKGIEVKSLGQLSEDEFDENTYLI 262

Query: 209 ----INQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
               + ++        + +  + +AL++ +LK   + ++     L     V+  +L  +V
Sbjct: 263 YDPILIKRARHAVFENQRTLKASKALQDGDLKTFGKLVSASGVSLAFDYEVTGIELDTLV 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GIDIVPITPSHST 320
               +Q  ++ ++++G+G G C IA+           +V      K G D        + 
Sbjct: 323 TNALKQRGVLGARMTGAGFGGCAIAIVNSADVEDFIDNVGKAYREKIGYDAHFYVADIAD 382

Query: 321 S 321
            
Sbjct: 383 G 383


>gi|24111974|ref|NP_706484.1| galactokinase [Shigella flexneri 2a str. 301]
 gi|30062087|ref|NP_836258.1| galactokinase [Shigella flexneri 2a str. 2457T]
 gi|74311275|ref|YP_309694.1| galactokinase [Shigella sonnei Ss046]
 gi|191168432|ref|ZP_03030221.1| galactokinase [Escherichia coli B7A]
 gi|256021174|ref|ZP_05435039.1| galactokinase [Shigella sp. D9]
 gi|300919941|ref|ZP_07136401.1| galactokinase [Escherichia coli MS 115-1]
 gi|300926155|ref|ZP_07141967.1| galactokinase [Escherichia coli MS 182-1]
 gi|301327949|ref|ZP_07221114.1| galactokinase [Escherichia coli MS 78-1]
 gi|309797080|ref|ZP_07691479.1| galactokinase [Escherichia coli MS 145-7]
 gi|332282401|ref|ZP_08394814.1| galactokinase [Shigella sp. D9]
 gi|38604761|sp|Q83M01|GAL1_SHIFL RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|123617711|sp|Q3Z453|GAL1_SHISS RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|24050785|gb|AAN42191.1| galactokinase [Shigella flexneri 2a str. 301]
 gi|30040331|gb|AAP16064.1| galactokinase [Shigella flexneri 2a str. 2457T]
 gi|73854752|gb|AAZ87459.1| galactokinase [Shigella sonnei Ss046]
 gi|86516616|gb|ABC98000.1| GalK [Shigella boydii]
 gi|86516620|gb|ABC98002.1| GalK [Shigella boydii]
 gi|86516646|gb|ABC98015.1| GalK [Shigella dysenteriae]
 gi|86516654|gb|ABC98019.1| GalK [Shigella dysenteriae]
 gi|86516656|gb|ABC98020.1| GalK [Shigella dysenteriae]
 gi|86516660|gb|ABC98022.1| GalK [Shigella dysenteriae]
 gi|86516666|gb|ABC98025.1| GalK [Shigella dysenteriae]
 gi|86516670|gb|ABC98027.1| GalK [Shigella flexneri]
 gi|86516672|gb|ABC98028.1| GalK [Shigella flexneri]
 gi|86516674|gb|ABC98029.1| GalK [Shigella flexneri]
 gi|86516682|gb|ABC98033.1| GalK [Shigella flexneri]
 gi|86516684|gb|ABC98034.1| GalK [Shigella flexneri]
 gi|86516686|gb|ABC98035.1| GalK [Shigella flexneri]
 gi|190901520|gb|EDV61280.1| galactokinase [Escherichia coli B7A]
 gi|281599934|gb|ADA72918.1| Galactokinase [Shigella flexneri 2002017]
 gi|300412998|gb|EFJ96308.1| galactokinase [Escherichia coli MS 115-1]
 gi|300417790|gb|EFK01101.1| galactokinase [Escherichia coli MS 182-1]
 gi|300845514|gb|EFK73274.1| galactokinase [Escherichia coli MS 78-1]
 gi|308119363|gb|EFO56625.1| galactokinase [Escherichia coli MS 145-7]
 gi|313649607|gb|EFS14031.1| galactokinase [Shigella flexneri 2a str. 2457T]
 gi|320175571|gb|EFW50666.1| Galactokinase [Shigella dysenteriae CDC 74-1112]
 gi|320183992|gb|EFW58816.1| Galactokinase [Shigella flexneri CDC 796-83]
 gi|323163833|gb|EFZ49644.1| galactokinase [Shigella sonnei 53G]
 gi|332104753|gb|EGJ08099.1| galactokinase [Shigella sp. D9]
 gi|332760881|gb|EGJ91169.1| galactokinase [Shigella flexneri 4343-70]
 gi|332761124|gb|EGJ91410.1| galactokinase [Shigella flexneri 2747-71]
 gi|332763930|gb|EGJ94168.1| galactokinase [Shigella flexneri K-671]
 gi|332768151|gb|EGJ98336.1| galactokinase [Shigella flexneri 2930-71]
 gi|333007339|gb|EGK26819.1| galactokinase [Shigella flexneri VA-6]
 gi|333007949|gb|EGK27425.1| galactokinase [Shigella flexneri K-218]
 gi|333021517|gb|EGK40767.1| galactokinase [Shigella flexneri K-304]
          Length = 382

 Score =  162 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|294669303|ref|ZP_06734382.1| galactokinase [Neisseria elongata subsp. glycolytica ATCC 29315]
 gi|291308713|gb|EFE49956.1| galactokinase [Neisseria elongata subsp. glycolytica ATCC 29315]
          Length = 381

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 58/363 (15%), Positives = 110/363 (30%), Gaps = 45/363 (12%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           +  V APG + L+GEH   +    L  AI+              + + ++         L
Sbjct: 16  EFTVRAPGRVNLIGEHTDYNDGFVLPCAIDFATCAAAAKNGTDTVRVYAADYGESDEFSL 75

Query: 67  A--------MFHPSFSFIIMAINH--IKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
           A         +      ++ A+       S G D+ V   +    GL SSAA+ VA+   
Sbjct: 76  AQAIESSGKQWADYIRGVVWALREHGFSFSDGLDIAVSGNVPQGAGLSSSAALEVAVAQV 135

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKID 173
             T        P       +A    V      +D  AS  G     +           I 
Sbjct: 136 FQTAFDLPADKPMLAKIGQYAENRFVGCQCGIMDQLASACGQRDHALLIDCRSLHTAPIP 195

Query: 174 FI---------------------------FPIHLIYSGYKTPTAQVLKKISYIEIEYPEI 206
                                              + G K      L++    +    E 
Sbjct: 196 VPDTLSVMIIHSHVQRGLVGSEYNTRRQQCETAAAHFGVKALRDLTLEQFEAGKTGLDET 255

Query: 207 NEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVWKLR 265
                +      + +  + +ALR  ++  L++ M      +     ++   +  +V  + 
Sbjct: 256 AARRARYVIEENRRTLDAAEALRRNDVPALSRLMAESHAGMRDGFEITHPAVDTLVELVH 315

Query: 266 EQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI--DIVPITPSHSTS 321
           E        +++G G G C++AL    L     Q +  +  A+ G+  ++   T     S
Sbjct: 316 EIIGEQGGVRMTGGGFGGCIVALLPHHLVEPVKQHLAANYQARTGLKEEVFVCTAHEGVS 375

Query: 322 LYR 324
           + +
Sbjct: 376 VAK 378


>gi|295134673|ref|YP_003585349.1| galactokinase [Zunongwangia profunda SM-A87]
 gi|294982688|gb|ADF53153.1| galactokinase [Zunongwangia profunda SM-A87]
          Length = 387

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/367 (18%), Positives = 121/367 (32%), Gaps = 51/367 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK-DRLINIDS-------SLGQ 59
           + V++PG + L+GEH   +    +  AI+K++       + D    + S           
Sbjct: 21  VKVASPGRINLIGEHTDYNNGFVMPTAIDKKIYFEFKENETDSTCRVYSATYNAYLEFDL 80

Query: 60  YCGSLDLAMFHPSFSFIIMAINHIKPS-CGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
           +  S+    +      +   IN +     GFD  + S L +  G+ SSAA+     AA L
Sbjct: 81  HHLSISDKSWENYILGVANEINLLGKKLKGFDCIIKSDLSTGAGISSSAALECG-FAAGL 139

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG---------------LICY 162
              +    S  EI   +        G   G +D  AS+                   I  
Sbjct: 140 NALFDLGLSKLEITQLSQRAEHNFVGNKCGIMDQYASVMSKQDHIILLDCESLHAEYIPA 199

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ----------- 211
                 +  ++     +L  S Y T   +    +  I+ +YPE+  +             
Sbjct: 200 DFKSCKLLLLNTNVSHNLADSEYNTRRQECEAAVDIIQKQYPEVKSLRDVNLDMLEEFKE 259

Query: 212 ----------KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
                     +           +  A++   L      M      L+    VS  +L  +
Sbjct: 260 QLQGKQYQRSRYVIEENNRVMKATTAIKAGELSEFGDLMYGSHDGLQHNYEVSCPELDFL 319

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK---GIDIVPITPS 317
           V   R + +I  S++ G G G C I L + D               K    +D + ++PS
Sbjct: 320 VEFSRPKEYIYGSRMMGGGFGGCTINLIEADKIEEYIAEAAEAYFKKFDIKLDTIAVSPS 379

Query: 318 HSTSLYR 324
             T + +
Sbjct: 380 EGTIVEK 386


>gi|86516668|gb|ABC98026.1| GalK [Shigella flexneri]
          Length = 382

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|86516680|gb|ABC98032.1| GalK [Shigella flexneri]
          Length = 382

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|90020744|ref|YP_526571.1| galactokinase [Saccharophagus degradans 2-40]
 gi|89950344|gb|ABD80359.1| galactokinase [Saccharophagus degradans 2-40]
          Length = 385

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/348 (19%), Positives = 124/348 (35%), Gaps = 45/348 (12%)

Query: 4   CLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINID-------SS 56
            LH++   APG + L+GEH   +    L  AI++   L +  R+D LI +        +S
Sbjct: 18  ALHEVLFHAPGRVNLIGEHTDYNNGFVLPCAIDRGTYLAIKTREDNLIRVVAGNLSNAAS 77

Query: 57  LGQYCGSLDLAMFHPSFSFIIMA----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
                  ++    +    +I       +       G D+ V+  +    GL SSA+ +V 
Sbjct: 78  EWPASLPVEHDKNNAWADYIRGVTEQLLKQGHTLKGMDIAVLGNVPQGAGLSSSASFSVG 137

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHG----------GLIC 161
              A   +      SP E+     A   +  G + G +D   S  G          G   
Sbjct: 138 FATACNAIN-TLGLSPTEVALCCQAAENEFAGCNCGIMDQLISAAGEAGHALLINCGDYS 196

Query: 162 YQMPKYS----IEKIDFIFPIHLIYSGYKTPTAQVLKKISYI--------------EIEY 203
           Y+         I  ID      L+ S Y T   Q  +    +              E + 
Sbjct: 197 YEPYAIPEDLAIMIIDSKVKRGLVDSEYNTRRKQCEEAALIMGVSSLRDATLSLLAESKN 256

Query: 204 PEINEINQKIYALM--GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
              +E+ ++   ++   + +  + +AL NKN  +L + M      +     V+ S++  +
Sbjct: 257 KMTDEVFRRAKHVITENQRTIDAAEALANKNYTLLNKLMAESHISMRDDFEVTTSQIDLL 316

Query: 261 VWKLREQ-PHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           V  + E   +    +++G G G CV+AL           ++       
Sbjct: 317 VDLVGEHLDNDGGVRMTGGGFGGCVVALVPKVKAEAISNAILKPYKEA 364


>gi|22126922|ref|NP_670345.1| galactokinase [Yersinia pestis KIM 10]
 gi|45440857|ref|NP_992396.1| galactokinase [Yersinia pestis biovar Microtus str. 91001]
 gi|108807041|ref|YP_650957.1| galactokinase [Yersinia pestis Antiqua]
 gi|108813023|ref|YP_648790.1| galactokinase [Yersinia pestis Nepal516]
 gi|145599827|ref|YP_001163903.1| galactokinase [Yersinia pestis Pestoides F]
 gi|149366866|ref|ZP_01888900.1| galactokinase [Yersinia pestis CA88-4125]
 gi|153948037|ref|YP_001401820.1| galactokinase [Yersinia pseudotuberculosis IP 31758]
 gi|162421746|ref|YP_001605931.1| galactokinase [Yersinia pestis Angola]
 gi|165924472|ref|ZP_02220304.1| galactokinase [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938285|ref|ZP_02226843.1| galactokinase [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011621|ref|ZP_02232519.1| galactokinase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211591|ref|ZP_02237626.1| galactokinase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400166|ref|ZP_02305679.1| galactokinase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419438|ref|ZP_02311191.1| galactokinase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423953|ref|ZP_02315706.1| galactokinase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167469851|ref|ZP_02334555.1| galactokinase [Yersinia pestis FV-1]
 gi|170025167|ref|YP_001721672.1| galactokinase [Yersinia pseudotuberculosis YPIII]
 gi|218928302|ref|YP_002346177.1| galactokinase [Yersinia pestis CO92]
 gi|229841075|ref|ZP_04461234.1| galactokinase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843179|ref|ZP_04463325.1| galactokinase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229894013|ref|ZP_04509199.1| galactokinase [Yersinia pestis Pestoides A]
 gi|229903463|ref|ZP_04518576.1| galactokinase [Yersinia pestis Nepal516]
 gi|270487242|ref|ZP_06204316.1| galactokinase [Yersinia pestis KIM D27]
 gi|294503141|ref|YP_003567203.1| galactokinase [Yersinia pestis Z176003]
 gi|24211719|sp|Q8ZGY3|GAL1_YERPE RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|123072883|sp|Q1C960|GAL1_YERPA RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|123073228|sp|Q1CFP0|GAL1_YERPN RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|166217638|sp|A4TNR8|GAL1_YERPP RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|166989674|sp|A7FKP2|GAL1_YERP3 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889793|sp|A9R3B5|GAL1_YERPG RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|229889794|sp|B1JST8|GAL1_YERPY RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|21959960|gb|AAM86596.1|AE013905_12 galactokinase [Yersinia pestis KIM 10]
 gi|45435715|gb|AAS61273.1| galactokinase [Yersinia pestis biovar Microtus str. 91001]
 gi|108776671|gb|ABG19190.1| galactokinase [Yersinia pestis Nepal516]
 gi|108778954|gb|ABG13012.1| galactokinase [Yersinia pestis Antiqua]
 gi|115346913|emb|CAL19802.1| galactokinase [Yersinia pestis CO92]
 gi|145211523|gb|ABP40930.1| galactokinase [Yersinia pestis Pestoides F]
 gi|149291240|gb|EDM41315.1| galactokinase [Yersinia pestis CA88-4125]
 gi|152959532|gb|ABS46993.1| galactokinase [Yersinia pseudotuberculosis IP 31758]
 gi|162354561|gb|ABX88509.1| galactokinase [Yersinia pestis Angola]
 gi|165913663|gb|EDR32282.1| galactokinase [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923532|gb|EDR40664.1| galactokinase [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989569|gb|EDR41870.1| galactokinase [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207362|gb|EDR51842.1| galactokinase [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962179|gb|EDR58200.1| galactokinase [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050115|gb|EDR61523.1| galactokinase [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056802|gb|EDR66565.1| galactokinase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169751701|gb|ACA69219.1| galactokinase [Yersinia pseudotuberculosis YPIII]
 gi|229679233|gb|EEO75336.1| galactokinase [Yersinia pestis Nepal516]
 gi|229689526|gb|EEO81587.1| galactokinase [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697441|gb|EEO87488.1| galactokinase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229703898|gb|EEO90911.1| galactokinase [Yersinia pestis Pestoides A]
 gi|262361177|gb|ACY57898.1| galactokinase [Yersinia pestis D106004]
 gi|262365266|gb|ACY61823.1| galactokinase [Yersinia pestis D182038]
 gi|270335746|gb|EFA46523.1| galactokinase [Yersinia pestis KIM D27]
 gi|294353600|gb|ADE63941.1| galactokinase [Yersinia pestis Z176003]
 gi|320014275|gb|ADV97846.1| galactokinase [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 383

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 66/344 (19%), Positives = 115/344 (33%), Gaps = 45/344 (13%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSL 64
           I + APG + L+GEH   +    L  AIN   ++    R DR I +   D    Q   SL
Sbjct: 21  ITIKAPGRVNLIGEHTDYNDGFVLPCAINYETVISCGKRDDRQIRVIAADYENQQDIFSL 80

Query: 65  DLAM----FHPSFSFIIMAINHIK----PSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
           D  +     +    ++   + H++       G DL +   +    GL SSA++ VA+  A
Sbjct: 81  DAPIVPHPEYRWADYVRGVVKHLQMRNADFGGADLVICGNVPQGAGLSSSASLEVAVGQA 140

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKI 172
           L +L Y    S  E+         +  G + G +D   S  G     +           +
Sbjct: 141 LQSL-YQLPLSGVELALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRTLETRAV 199

Query: 173 DFIFPIHLIYSG-----------YKTPTAQVLKK----------------ISYIEIEYPE 205
                + ++              Y T   Q                       I+ E   
Sbjct: 200 PMPENMAVVIINSNIQRGLVDSEYNTRRQQCEAAARFFGVKALRDVEPSLFFSIQDELDP 259

Query: 206 INEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKL 264
           +     +        +  +  AL   NLK++ Q M      +     ++   +  +V  +
Sbjct: 260 VVAKRARHVISENARTLAAADALAAGNLKLMGQLMQESHISMRDDFEITVPPIDRLVEIV 319

Query: 265 REQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
           +         +++G G G C+IAL   +L      +V     A 
Sbjct: 320 KSVIGDQGGVRMTGGGFGGCIIALMPLELVEQVRTTVAQEYPAH 363


>gi|163802348|ref|ZP_02196242.1| galactokinase [Vibrio sp. AND4]
 gi|159173877|gb|EDP58691.1| galactokinase [Vibrio sp. AND4]
          Length = 386

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 57/350 (16%), Positives = 113/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D L+ + S   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAVKREDNLVRVVSVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQEITFQQDKMWANYIRGVVKCLLARGYQFSGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQRAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRREQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           ++E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VSELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++A+    L      +V     A 
Sbjct: 315 TLVEMVKEVIGEQGGVRMTGGGFGGCIVAIVPPALVDEVKATVEAKYQAA 364


>gi|187732980|ref|YP_001879407.1| galactokinase [Shigella boydii CDC 3083-94]
 gi|229889789|sp|B2TUY8|GAL1_SHIB3 RecName: Full=Galactokinase; AltName: Full=Galactose kinase
 gi|86516610|gb|ABC97997.1| GalK [Shigella boydii]
 gi|86516628|gb|ABC98006.1| GalK [Shigella boydii]
 gi|86516640|gb|ABC98012.1| GalK [Shigella boydii]
 gi|187429972|gb|ACD09246.1| galactokinase [Shigella boydii CDC 3083-94]
          Length = 382

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/361 (18%), Positives = 124/361 (34%), Gaps = 50/361 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHSLLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI----TPSHST 320
                    +++G G G C++AL   +L     Q+V     AK I I        PS   
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAK-IGIKETFYVCKPSQGA 379

Query: 321 S 321
            
Sbjct: 380 G 380


>gi|227431715|ref|ZP_03913745.1| galactokinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352539|gb|EEJ42735.1| galactokinase [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 390

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/363 (17%), Positives = 118/363 (32%), Gaps = 50/363 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCG-------SL 64
           +PG + L+GEH   +G      AI          R D  I + S      G        L
Sbjct: 25  SPGRINLIGEHTDYNGGHVFPAAITYGTYGVARKRDDDRILVYSVNFDEKGVVQLDYKKL 84

Query: 65  DLAMFHPSFSFIIMAINHIKP-----SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
           D        +++   I  +         GFDL V   + +  GL SSA++ + +   L  
Sbjct: 85  DFDENDGWTNYVKGVIVKLIEQGYVLDTGFDLLVEGNIPNGAGLSSSASLELLVGVVLED 144

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL---------------ICYQM 164
           L          +              +  +D  A   G                 +   +
Sbjct: 145 LFDLDVSRLSLVKIGQKVENEYFGLNTGIMDQFAIGFGQEQKAILLDTNTLTYELVPIVL 204

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------Y 203
            +Y+I  ++      L  S Y    AQ    +  ++ E                     +
Sbjct: 205 GEYAIVIMNTNKRRELGDSKYNERRAQCETALKLLQTELNINSLGELTDEEFDDNVALIH 264

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVW 262
            E      +      + +  + +AL + +L+   Q MN     L+    V+  +L  +V 
Sbjct: 265 DETLVKRARHAVYENQRTLKAKKALSDGDLQTFGQLMNDSHASLKADYEVTGLELDTLVL 324

Query: 263 KLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHSTS 321
             ++QP ++ ++++G+G G C IAL K    S     V + +M+  G             
Sbjct: 325 SAQKQPGVLGARMTGAGFGGCAIALVKETAISNFENKVYDDYMNVVGYAPEFYVAHVGNG 384

Query: 322 LYR 324
             +
Sbjct: 385 TTK 387


>gi|300123655|emb|CBK24927.2| unnamed protein product [Blastocystis hominis]
          Length = 878

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 59/367 (16%), Positives = 116/367 (31%), Gaps = 53/367 (14%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSL------GQYC 61
           I   APG +  +GEH           AI+    +        +  + S+        +  
Sbjct: 432 IYSFAPGRVNFIGEHTDYCEGFVCPLAIHLGTAIVGKKAPGNVCRVVSASKDGIEEFKGD 491

Query: 62  GSLDLAMFHPSFSFI----IMAINHIKP-SCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
            SL         +++       I        GFD+ ++S +    GL SSA++ VA++  
Sbjct: 492 SSLVRDESGSWINYVSGVVYEFITRFNIQEIGFDMAIVSNVPLGGGLSSSASLEVAVSVF 551

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIH----------------GGLI 160
           L  L      +P++      A       +  GI                       G L+
Sbjct: 552 LEQLLNQA-ITPEDRALLCQAAEHNFAHMPCGIMDQFISSCGVRGNLLLIDCRANKGELV 610

Query: 161 CYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYA----- 215
               P  SI   +      L  S Y     Q  + ++ ++  +PE+  +           
Sbjct: 611 PLSDPSVSIVVCNSNKKHQLSGSEYPDRVRQCKEALALLQKHFPEVKALRDATVEQVESI 670

Query: 216 ----------------LMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLS 258
                              +      QAL  ++   + + + +    L     VS  +L 
Sbjct: 671 REEMDNTTYRRAIHVVSECQRCLDCKQALEKRDYDAVGRLLLQSHASLRDNFEVSTPELD 730

Query: 259 EIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GID--IVPIT 315
            +V     Q  +  ++++G G G C++   + D      +++      + GI+      +
Sbjct: 731 LLVEIAMGQDGVFGARMTGGGFGGCIVCFVESDKAEKVMKALEKEYKERTGIECSAFVTS 790

Query: 316 PSHSTSL 322
           PS    +
Sbjct: 791 PSQGARV 797


>gi|262192358|ref|ZP_06050512.1| galactokinase [Vibrio cholerae CT 5369-93]
 gi|262031784|gb|EEY50368.1| galactokinase [Vibrio cholerae CT 5369-93]
          Length = 386

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 59/341 (17%), Positives = 105/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D L+    +D         L  
Sbjct: 24  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDFLVRLVAVDYDNDTDEFDLRE 83

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 84  EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 143

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 144 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 203

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                              +  
Sbjct: 204 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVA 263

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 264 KRARHVITENERTLHAAQALREGNMPRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 323

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A+
Sbjct: 324 IGDQGGVRMTGGGFGGCVVALVHPTQVEAVQQAVAEHYEAE 364


>gi|149189739|ref|ZP_01868020.1| galactokinase [Vibrio shilonii AK1]
 gi|148836388|gb|EDL53344.1| galactokinase [Vibrio shilonii AK1]
          Length = 385

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 59/350 (16%), Positives = 112/350 (32%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     +   APG + L+GEH   +    L  AIN + ++    R D L+ + S     
Sbjct: 16  LGYKPTHVI-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKRDDNLVRVVSVDYQD 74

Query: 60  YCGSLDL---------AMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+      ++  +        G D+ V   +    GL SSAA+
Sbjct: 75  ATDEFDITQEITFQQDKMWANYIRGVVKFLMARGYQIGGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG----------- 158
            V I     TL   +    +  L    A    V      +D   S  G            
Sbjct: 135 EVVIGQTFKTLYNLEITQAEVALNGQQAENEFVGCNCGIMDQLISAEGKENHALLIDCRS 194

Query: 159 ---LICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQV----------------LKKISYI 199
                       ++  I+      L+ S Y T   Q                 +++ +  
Sbjct: 195 LETQAVSMPEDMAVVIINSNKKRGLVDSEYNTRREQCEEAARIFGVKALRDVTIEQFNDR 254

Query: 200 EIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
             E  E+     +        +  + +AL   ++K + + M +    +     ++  ++ 
Sbjct: 255 VSELDEMVAKRARHVITENDRTVEAAKALSTGDMKRMGELMAQSHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            IV  ++         +++G G G CV++L    L      ++     A 
Sbjct: 315 TIVDIVKAVIGDQGGVRMTGGGFGGCVVSLIPPTLVEAVTTAIAEQYEAA 364


>gi|288904419|ref|YP_003429640.1| galactokinase [Streptococcus gallolyticus UCN34]
 gi|325977416|ref|YP_004287132.1| galactokinase [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
 gi|288731144|emb|CBI12690.1| galactokinase [Streptococcus gallolyticus UCN34]
 gi|325177344|emb|CBZ47388.1| galK [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 390

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 117/345 (33%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI          R D+ +   S+     G +++ +   
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQTLRFYSANFADLGIIEVDLANL 83

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +       + GFDL V   + +  GL SSA++ + +      
Sbjct: 84  VFDKKDSWTNYPKGVIKFLQEAGHTINTGFDLYVNGNIPNGSGLSSSASLELLVGIVAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +       +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FDLNLDRLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADKQAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +        + E++ + +       
Sbjct: 203 LGDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNQVLDIKTLGELDLQAFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  + 
Sbjct: 263 KDANRLKRARHAVWENQRTLQAKEALIAGELEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IA+   D      Q+V      
Sbjct: 323 HTAWQQEGVLGARMTGAGFGGCGIAIVAKDKVDEFTQNVGKVYTE 367


>gi|306832688|ref|ZP_07465825.1| galactokinase [Streptococcus bovis ATCC 700338]
 gi|304425144|gb|EFM28273.1| galactokinase [Streptococcus bovis ATCC 700338]
          Length = 390

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 116/345 (33%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL----- 66
           +PG + L+GEH   +G      AI          R D+ +   S+     G +++     
Sbjct: 24  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQTLRFYSANFADLGIIEVDLANL 83

Query: 67  -----AMFHPSFSFIIMAINHIK--PSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +       + GFDL V   + +  GL SSA++ + +      
Sbjct: 84  VFDKKDNWTNYPKGVIKFLQEAGYTINTGFDLYVNGNIPNGSGLSSSASLELLVGIVAEE 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +       +++        +  G++SGI    +I  G                 +   
Sbjct: 144 L-FDLNLDRLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADKQAIYLDTNTLEYDLVPLD 202

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +        + E++ + +       
Sbjct: 203 LGDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNQVLDIKTLGELDLQAFDEYSYLI 262

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  + 
Sbjct: 263 KDANRLKRARHAVWENQRTLQAKEALIAGELEKFGRLVNASHVSLEHDYEVTGIELDTLA 322

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IA+   D      Q+V      
Sbjct: 323 HTAWQQEGVLGARMTGAGFGGCGIAIVAKDKVDEFTQNVGKVYTE 367


>gi|306830452|ref|ZP_07463622.1| galactokinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|304427477|gb|EFM30579.1| galactokinase [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 406

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/345 (16%), Positives = 117/345 (33%), Gaps = 51/345 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM--- 68
           +PG + L+GEH   +G      AI          R D+ +   S+     G +++ +   
Sbjct: 40  SPGRINLIGEHTDYNGGHVFPAAITLGTYGAARKRDDQTLRFYSANFADLGIIEVDLANL 99

Query: 69  -------FHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I  +       + GFDL V   + +  GL SSA++ + +      
Sbjct: 100 VFDKKDSWTNYPKGVIKFLQEAGHTINTGFDLYVNGNIPNGSGLSSSASLELLVGIVAEE 159

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL----------------ICYQ 163
           L +       +++        +  G++SGI    +I  G                 +   
Sbjct: 160 L-FDLNLDRLDLVKIGKQTENEFIGVNSGIMDQFAIGMGADKQAIYLDTNTLEYDLVPLD 218

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYP--EINEINQKIYALM---- 217
           +    I  ++      L  S Y    A+  K +  +        + E++ + +       
Sbjct: 219 LGDNVIVIMNTNKRRELADSKYNERRAECEKAVEELNQVLDIKTLGELDLQAFDEYSYLI 278

Query: 218 ---------------GKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
                           + +  + +AL    L+   + +N     LE    V+  +L  + 
Sbjct: 279 KDANRLKRARHAVWENQRTLQAKEALIAGELEKFGRLVNASHVSLEHDYEVTGIELDTLA 338

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
               +Q  ++ ++++G+G G C IA+   D      Q+V      
Sbjct: 339 HTAWQQEGVLGARMTGAGFGGCGIAIVAKDKVDEFTQNVGKVYTE 383


>gi|229529372|ref|ZP_04418762.1| galactokinase [Vibrio cholerae 12129(1)]
 gi|229333146|gb|EEN98632.1| galactokinase [Vibrio cholerae 12129(1)]
          Length = 405

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 58/341 (17%), Positives = 103/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D  +    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVATAKREDSRVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                              +  
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVA 282

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMTRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPKQVEAVQQAVAEHYEAA 383


>gi|302672195|ref|YP_003832155.1| galactokinase GalK [Butyrivibrio proteoclasticus B316]
 gi|302396668|gb|ADL35573.1| galactokinase GalK [Butyrivibrio proteoclasticus B316]
          Length = 393

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 57/362 (15%), Positives = 119/362 (32%), Gaps = 53/362 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-----------SLGQY 60
           APG + L+GEH   +G      A+       +  R DR++   S           +L   
Sbjct: 29  APGRVNLIGEHTDYNGGHVFPCALTIGTYAAVAKRDDRVVQFYSVNQDRFGVYGVNLDDI 88

Query: 61  CGSLDLAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
               D A +      +I A     +K   GFD+ +   + +  GL SSA++ V     L 
Sbjct: 89  DTINDQAGWTNYPIGVIWAFAGRGMKLDKGFDMVINGNIPNGSGLSSSASLEVLTGFILR 148

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQ 163
            L      + D  L   ++           +D  AS  G                    +
Sbjct: 149 DLYGFDVTNQDIALIGQYSENNYNGCNCGIMDQFASAMGKENNAIFLDTADLSYEYAPIK 208

Query: 164 MPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---------------------- 201
           +    I   +      L  S Y    +   + ++ ++                       
Sbjct: 209 LDGAKIVIANTNKKHKLTDSQYNARRSMCEEALAILQKTVDIKGLGDLSIEEFEAHKDVL 268

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEI 260
             P++ +  +       + +  + +AL+  +++   + M +    L     V+  +L  +
Sbjct: 269 TDPDMQKKAKHAVYE-NQRTIEAVKALKAGDIEHFGELMRQSHESLRDDYDVTGVELDTL 327

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV-NCHMHAKGIDIVPITPSHS 319
             +  + P ++ S+++G G G C +++ K +      + V   ++   G +    T    
Sbjct: 328 AEEAWKIPGVIGSRMTGGGFGGCTVSIVKDEAVEDFKRIVGENYLKKIGYEATFYTVEIG 387

Query: 320 TS 321
             
Sbjct: 388 GG 389


>gi|86516612|gb|ABC97998.1| GalK [Shigella boydii]
 gi|86516632|gb|ABC98008.1| GalK [Shigella boydii]
 gi|86516636|gb|ABC98010.1| GalK [Shigella boydii]
 gi|86516658|gb|ABC98021.1| GalK [Shigella dysenteriae]
          Length = 382

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 59/361 (16%), Positives = 117/361 (32%), Gaps = 50/361 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEKID 173
             L YH      +I         +  G + G +D   S  G     +         + + 
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 174 FIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQ---------------------- 211
               + ++          V  + +    +        Q                      
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 212 -----KIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
                +        +  +  AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPI----TPSHST 320
                    +++G G G C++AL   +L     Q+V     AK I I        PS   
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAK-IGIKETFYVCKPSQGA 379

Query: 321 S 321
            
Sbjct: 380 G 380


>gi|328474289|gb|EGF45094.1| galactokinase [Vibrio parahaemolyticus 10329]
          Length = 386

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 56/350 (16%), Positives = 111/350 (31%), Gaps = 44/350 (12%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDS-SLGQ 59
           +G     I   APG + L+GEH   +    L  AIN + ++    R+D ++ + +   G 
Sbjct: 16  LGYAPSHII-QAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDNIVRVVAVDYGN 74

Query: 60  YCGSLDL---------AMFHPSFSF-IIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAI 109
                D+          M+       +   +       G D+ V   +    GL SSAA+
Sbjct: 75  AVDEFDITQAITFQQDKMWANYIRGVVKCLLARGYQFTGADISVSGNVPQGAGLSSSAAL 134

Query: 110 TVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPK 166
            V I      L   +    +  L    A    V      +D   S  G     +      
Sbjct: 135 EVVIGQTFKVLFNLEISQAEIALNGQQAENEFVGCNCGIMDQMISAEGRENHAMLLDCRS 194

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE---------------------YPE 205
              E +     + ++          V  + +    +                       +
Sbjct: 195 LETEAVSMPEDMAVVIINSNKKRGLVDSEYNTRRQQCEEAARIFGVKALRDVTIEQFNEK 254

Query: 206 INEINQKIYALMGK------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLS 258
           + E+++ +             +  + QALR  ++K + + M      +     ++  ++ 
Sbjct: 255 VAELDEMVAKRARHVITENDRTVEAAQALRAHDMKRMGELMAESHASMRDDFEITVKEID 314

Query: 259 EIVWKLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
            +V  ++E        +++G G G C++AL    L       V     A 
Sbjct: 315 TLVEIVKEVIGDQGGVRMTGGGFGGCIVALVPPALVDDVKAEVEAKYQAA 364


>gi|116511264|ref|YP_808480.1| mevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
 gi|116106918|gb|ABJ72058.1| mevalonate kinase [Lactococcus lactis subsp. cremoris SK11]
          Length = 310

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 70/304 (23%), Positives = 125/304 (41%), Gaps = 7/304 (2%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAIN-KRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFH 70
           A   L+L+GEH V++G  A+   +   +  + +T  K     I+++  +    L    F 
Sbjct: 11  AHSKLILIGEHSVVYGQPAIALPVTILKTTVTITSSKYGQY-IENNEFRRRLDLMGDEFE 69

Query: 71  PSFSFIIMAINHIKPSC-GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPD 129
                I+  ++    S   F L++ S +    GLG+SA++  AI  A       + P  D
Sbjct: 70  GIRQLIMRLLDKFHSSKMPFSLEIDSNIPQGRGLGASASLATAIIRAFYDFFDAELPQKD 129

Query: 130 EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPT 189
            +     +      G SSGID+A       + + +   +IE  +      ++        
Sbjct: 130 LLFYANFS-ENITHGKSSGIDVATVNSEHPLWF-IKDSTIEPFELNLHGFIVIGDTGV-H 186

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET 249
               + I+ +  +  E NE  Q     +G+L+  S   L    LK     MN+    L  
Sbjct: 187 GFTSQAINIVREKLVEENEKTQNSINDLGQLATDSKAFLMTDKLKEFGHVMNKAHERLSE 246

Query: 250 LGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGI 309
           LGVS  +L  +V   R +   + +K++GSGLG  ++AL + + +++          AK  
Sbjct: 247 LGVSHPRLDNLVDTAR-KNGALGAKLTGSGLGGVMVALAENEKDAIRISQRLLKNGAKNT 305

Query: 310 DIVP 313
            I  
Sbjct: 306 WIYS 309


>gi|86516676|gb|ABC98030.1| GalK [Shigella flexneri]
 gi|86516678|gb|ABC98031.1| GalK [Shigella flexneri]
          Length = 382

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 126/360 (35%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SL+
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLN 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPH-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGNKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|2501753|gb|AAC48872.1| galactokinase [Cloning vector pAL-Z]
 gi|2501800|gb|AAC53713.1| galactokinase [Cloning vector pAL-F]
          Length = 382

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 69/360 (19%), Positives = 124/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+     +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVDHGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQ-------------ALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                 AL   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQRVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|256846662|ref|ZP_05552118.1| galactokinase [Fusobacterium sp. 3_1_36A2]
 gi|294784371|ref|ZP_06749662.1| galactokinase [Fusobacterium sp. 3_1_27]
 gi|256717882|gb|EEU31439.1| galactokinase [Fusobacterium sp. 3_1_36A2]
 gi|294487943|gb|EFG35298.1| galactokinase [Fusobacterium sp. 3_1_27]
          Length = 390

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 54/364 (14%), Positives = 119/364 (32%), Gaps = 51/364 (14%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD------ 65
           +PG + L+GEH   +G      A++      +  R+D++  + S   +  G ++      
Sbjct: 24  SPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKREDKIFRMYSKNFENLGIIEFNLDNL 83

Query: 66  ----LAMFHPSFSFIIMAI--NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                  +      +I      + K   GFD+  +  + +  GL SSA+I V     L  
Sbjct: 84  VYDKKDDWANYPKGVIKTFLDRNYKIDSGFDVLFLGNIPNGAGLSSSASIEVLTAVILKD 143

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG---------------LICYQM 164
           L        + +     A    +   S  +D  A   G                 +  ++
Sbjct: 144 LFKLDVDMIEMVKMCQVAENKFIGVNSGIMDQFAVGMGKKDNAILLDCNTLKFEYVPVKL 203

Query: 165 PKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--------------------YP 204
              SI   +      L  S Y    +   + +  +                       Y 
Sbjct: 204 KNMSIIIANTNKKRGLADSKYNERRSSCEEAVKILNKNGINIKYLGELTVAEFEKIKHYI 263

Query: 205 EINEINQKIYAL--MGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIV 261
              E  ++        + ++I+ + L+  ++    + MN+    L     V+  +L  +V
Sbjct: 264 TDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGKLMNKSHISLRDDYEVTGLELDSLV 323

Query: 262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHM-HAKGIDIVPITPSHST 320
               E+   + S+++G+G G C +++ +        +++        G++      +   
Sbjct: 324 EAAWEEKGTVGSRMTGAGFGGCTVSIVENAYVDSFIKNIGKKYREKTGLEASFYIANIGD 383

Query: 321 SLYR 324
              R
Sbjct: 384 GAGR 387


>gi|15641603|ref|NP_231235.1| galactokinase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121588041|ref|ZP_01677791.1| galactokinase [Vibrio cholerae 2740-80]
 gi|121728431|ref|ZP_01681458.1| galactokinase [Vibrio cholerae V52]
 gi|147673567|ref|YP_001217143.1| galactokinase [Vibrio cholerae O395]
 gi|153818144|ref|ZP_01970811.1| galactokinase [Vibrio cholerae NCTC 8457]
 gi|153823749|ref|ZP_01976416.1| galactokinase [Vibrio cholerae B33]
 gi|227081748|ref|YP_002810299.1| galactokinase [Vibrio cholerae M66-2]
 gi|229508460|ref|ZP_04397963.1| galactokinase [Vibrio cholerae BX 330286]
 gi|229511468|ref|ZP_04400947.1| galactokinase [Vibrio cholerae B33]
 gi|229518608|ref|ZP_04408051.1| galactokinase [Vibrio cholerae RC9]
 gi|229607867|ref|YP_002878515.1| galactokinase [Vibrio cholerae MJ-1236]
 gi|254848713|ref|ZP_05238063.1| galactokinase [Vibrio cholerae MO10]
 gi|298498322|ref|ZP_07008129.1| galactokinase [Vibrio cholerae MAK 757]
 gi|9656105|gb|AAF94749.1| galactokinase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547692|gb|EAX57786.1| galactokinase [Vibrio cholerae 2740-80]
 gi|121629304|gb|EAX61738.1| galactokinase [Vibrio cholerae V52]
 gi|126511330|gb|EAZ73924.1| galactokinase [Vibrio cholerae NCTC 8457]
 gi|126518731|gb|EAZ75954.1| galactokinase [Vibrio cholerae B33]
 gi|146315450|gb|ABQ19989.1| galactokinase [Vibrio cholerae O395]
 gi|227009636|gb|ACP05848.1| galactokinase [Vibrio cholerae M66-2]
 gi|227013505|gb|ACP09715.1| galactokinase [Vibrio cholerae O395]
 gi|229343297|gb|EEO08272.1| galactokinase [Vibrio cholerae RC9]
 gi|229351433|gb|EEO16374.1| galactokinase [Vibrio cholerae B33]
 gi|229354414|gb|EEO19337.1| galactokinase [Vibrio cholerae BX 330286]
 gi|229370522|gb|ACQ60945.1| galactokinase [Vibrio cholerae MJ-1236]
 gi|254844418|gb|EET22832.1| galactokinase [Vibrio cholerae MO10]
 gi|297542655|gb|EFH78705.1| galactokinase [Vibrio cholerae MAK 757]
          Length = 405

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 59/341 (17%), Positives = 104/341 (30%), Gaps = 43/341 (12%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSL-- 64
           V APG + L+GEH   +    L  AIN + ++    R+D L+    +D         L  
Sbjct: 43  VQAPGRVNLIGEHTDYNDGFVLPCAINYQTVVAAAKREDFLVRLVAVDYDNDTDEFDLRE 102

Query: 65  -----DLAMFHPSFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                   M+      +I  +        G D+ V   +    GL SSAA+ V I     
Sbjct: 103 EIAFQPKKMWSNYIRGVIKCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFK 162

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHG---GLICYQMPKYSIEKIDFI 175
            L   K    +  L    A    V      +D   S  G     +         E +   
Sbjct: 163 ELYQLKISQAEIALNGQQAENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMP 222

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIE---------------------------YPEINE 208
             + ++          V  + +    +                              +  
Sbjct: 223 EQMAVVILNSNKKRGLVESEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVA 282

Query: 209 INQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQ 267
              +      + +  + QALR  N+  L + M      +     ++  ++  +V  ++  
Sbjct: 283 KRARHVITENERTLHAAQALREGNMPRLGELMAASHASMRDDFEITVKEIDTLVEIVQSV 342

Query: 268 PHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                  +++G G G CV+AL          Q+V  H  A 
Sbjct: 343 IGDQGGVRMTGGGFGGCVVALVHPKQVEAVQQAVAEHYEAA 383


>gi|307257039|ref|ZP_07538815.1| Galactokinase [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864523|gb|EFM96430.1| Galactokinase [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 384

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 118/346 (34%), Gaps = 49/346 (14%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM 68
            V APG + ++GEH   +    +  AIN  + +  + R D +  + +         DL+ 
Sbjct: 22  TVFAPGRVNIIGEHTDYNDGFVMPCAINYGMAVSFSKRDDSVWRVYAIDIDEQDEFDLSR 81

Query: 69  -----FHPSFSFIIMAINHIKPSC-----GFDLKVISQLDSQLGLGSSAAITVAITAALL 118
                 H   +++   + +I+  C     G DL + S +    GL SSAA+ ++I     
Sbjct: 82  PIEPSEHKWANYVRGVVKYIQEKCPEFKQGADLAMTSDVPMSSGLSSSAALEISIGK-TA 140

Query: 119 TLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGGL---ICYQMPKYSIEK--- 171
            +      S  EI         K  G + G +D   S  G     I        I     
Sbjct: 141 QVLGDLPLSLAEIALIGQQAENKFVGANCGNMDQLTSALGQKDQVIMIDCRSLDITPTPV 200

Query: 172 --------IDFIFPIHLIYSGYKTPTAQV--------------------LKKISYIEIEY 203
                   I+      L+   Y +   +                     +++ + ++ + 
Sbjct: 201 PHGYSIAIINSNVKHDLVTGEYNSRRQECEFAARFFGVKALRDVTSERFIERAAELQAQN 260

Query: 204 PEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLET-LGVSDSKLSEIVW 262
               +  + I +   +    + +AL+  ++  L Q M      +     ++  ++  +V 
Sbjct: 261 ELAYKRAKHIISE-NQRVLEAVEALKANDMVKLGQLMAGSHDSMRDDFEITIPEIDYLVE 319

Query: 263 KLREQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
             +        ++++G G G C++ L   +      Q +  +   +
Sbjct: 320 LAQMAIGKNGGARMTGGGFGGCIVCLVPDEKVEHLRQVIAENYEKQ 365


>gi|255936237|ref|XP_002559145.1| Pc13g07140 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583765|emb|CAP91783.1| Pc13g07140 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 449

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 76/383 (19%), Positives = 135/383 (35%), Gaps = 76/383 (19%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTL--RKDRLINIDSSLGQYCGSLD 65
             VSAPG +++ GEH V+HG AA+  AI+ R  L +T   +  R I ++     +  + D
Sbjct: 5   FMVSAPGKVIVFGEHAVVHGKAAMAAAISLRSYLLVTTLSKSQRTITLNFRDLGFSHTWD 64

Query: 66  -----LAMFHPSFS--------------------------------------------FI 76
                   FH                                                F+
Sbjct: 65  IDTLPWDKFHEPSKKKFYYSLVTELDPELVEAIEPHLQGVSKGLPEEQRKIHIRSASSFL 124

Query: 77  IMAINHIKPSCGFDL-KVISQLDSQLGLGSSAAITVAITAALL----TLQYHKEPSPD-- 129
            + ++   P     +  + S + +  GLGSSA++ V ++ ALL    TL       P   
Sbjct: 125 YLFLSLGSPQSPGAIYTLRSTIPTGAGLGSSASVCVCLSTALLLQIRTLSGPHPDQPPEE 184

Query: 130 ------EILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIE------KIDFIFP 177
                  I   A    L + G  SG+D   +  G  + ++    S              P
Sbjct: 185 AETQIERINRWAFVGELCIHGNPSGVDNTVAAGGKAVIFRRDDSSKTRTVISLPTFPELP 244

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINE-----INQKIYALMGKLSQISCQALRNKN 232
           + L+ +     T   + K+  +   +P + E     I+    +    +   S + +    
Sbjct: 245 LLLVNTQQARSTKTEVSKVGALRDAHPIVTESILNGIDHVTCSAQRLIEDPSFEGISETT 304

Query: 233 LKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           L      +    G L +LGVS  +L   + +L +   I  +K++G+G G C I L + + 
Sbjct: 305 LAHFGTLIRINHGFLVSLGVSHPRLER-IRELVDYADIGWTKLTGAGGGGCAITLLRPNA 363

Query: 293 NSLPYQSVNCHMHAKGIDIVPIT 315
            +   Q +      +G     +T
Sbjct: 364 KAEVKQDLEQKFDKEGFTTYEVT 386


>gi|324114325|gb|EGC08294.1| galactokinase [Escherichia fergusonii B253]
          Length = 382

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 125/360 (34%), Gaps = 48/360 (13%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI---DSSLGQYCGSLD 65
            + APG + L+GEH   +    L  AI+ + ++    R DR + +   D        SLD
Sbjct: 22  TIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRNVRVMAADYENQLDEFSLD 81

Query: 66  LAMFHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAAL 117
             +         +++   + H++       G D+ +   +    GL SSA++ VA+   L
Sbjct: 82  APIVAHENYQWANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVL 141

Query: 118 LTLQYHKEPSPDEILTTAHAIVLKVQGISSG-IDLAASIHGG--------------LICY 162
             L YH      +I         +  G + G +D   S  G                   
Sbjct: 142 QQL-YHLPLDGTQIALNGQEAENQFVGCNCGIMDQLISALGKKNHALLIDCRSLGTKAVS 200

Query: 163 QMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEI---EYPEINEINQKIYALMGK 219
                ++  I+  F   L+ S Y T   Q      + +        I E N   + L   
Sbjct: 201 MPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPI 260

Query: 220 LSQISCQA-------------LRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLR 265
           +++                  L   +LK + + M      +     ++  ++  +V  ++
Sbjct: 261 VAKRVRHILTENARTVEAASVLEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVK 320

Query: 266 EQPHI-MASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK-GI-DIVPI-TPSHSTS 321
                    +++G G G C++AL   +L     Q+V     AK GI +   +  PS    
Sbjct: 321 AVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAG 380


>gi|329295959|ref|ZP_08253295.1| galactokinase [Plautia stali symbiont]
          Length = 382

 Score =  162 bits (410), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 59/340 (17%), Positives = 115/340 (33%), Gaps = 45/340 (13%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLIN---IDSSLGQYCGSLDLAM 68
           APG + L+GEH   +    L  AI+ + ++    R DR +    +D    Q   SLD  +
Sbjct: 25  APGRVNLIGEHTDYNDGFVLPCAIDYQTVIACARRDDRQVRVVAVDYDNQQDSFSLDAPI 84

Query: 69  FHP----SFSFIIMAINHIKPSC----GFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
                    +++   + H++       G D+ +   +    GL SSA++ VA+      L
Sbjct: 85  EPLSEPMWANYVRGVVKHLQQRDASFGGVDMVISGNVPQGAGLSSSASLEVAVGTVFQQL 144

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLA---------------ASIHGGLICYQMP 165
            Y  +     I         +  G + GI                      G        
Sbjct: 145 -YQLKLDGAAIAVNGQEAENQFVGCNCGIMDQLISALGQQDHAMLLDCRTLGTRAVSMPE 203

Query: 166 KYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIE--YPEINEINQKIYALMGK---- 219
             ++  I+  F  +L+ S Y T   Q      +   +       E  +            
Sbjct: 204 DVAVVIINSNFRRNLVSSEYNTRREQCETGARFFNKKALRDVTLEEFEAAAHQPDPLVAK 263

Query: 220 ----------LSQISCQALRNKNLKVLAQAMNRQQGLLE-TLGVSDSKLSEIVWKLREQP 268
                      +  +  AL N +L+ + + M      +     ++ + + ++V  ++ + 
Sbjct: 264 RVRHVITENARTLEAADALSNGDLQRMGELMAASHASMRDDFEITVAPIDQLVEIVKVEI 323

Query: 269 H-IMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAK 307
                 +++G G G C++AL   DL      +V     A+
Sbjct: 324 GPRGGVRMTGGGFGGCIVALMPTDLVDQVKTAVAQQYEAQ 363


>gi|297701803|ref|XP_002827888.1| PREDICTED: galactokinase-like [Pongo abelii]
          Length = 551

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 65/365 (17%), Positives = 116/365 (31%), Gaps = 49/365 (13%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINI--DSSLGQYCGSL 64
           ++ VSAPG + L+GEH   +    L  A+    +L  + RKD L+++   S        L
Sbjct: 188 ELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRL 247

Query: 65  DLAMFHP----------SFSFIIMAINHI--KPSCGFDLKVISQLDSQLGLGSSAAITVA 112
              +               +++   I +    P  GF   V+S +    GL SSA++ VA
Sbjct: 248 QFPLPTALRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVA 307

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGL------------- 159
               L  L                A           +D   S+ G               
Sbjct: 308 TYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLET 367

Query: 160 --ICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLK-----KISYIEIEYPEINEINQK 212
             +    PK ++   +      L  S Y     Q  +         +     E  E  + 
Sbjct: 368 SLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQ