RPSBLAST alignment for GI: 254781017 and conserved domain: PTZ00298

>gnl|CDD|140319 PTZ00298, PTZ00298, mevalonate kinase; Provisional. Length = 328
 Score = 64.1 bits (156), Expect = 4e-11
 Identities = 74/290 (25%), Positives = 128/290 (44%), Gaps = 30/290 (10%)

Query: 14  GSLVLMGEHGVLHGHAALVFAINKRVILYLTLRK--------DRLINIDSSLGQYCGSLD 65
           G ++L GEH V++G  A+V  I++     L L K        D+   +   + +      
Sbjct: 17  GKVILFGEHFVVYGAEAIVAGIDEYTECRLELTKGVPGLQVVDQRPAVPGYIVEKREEQR 76

Query: 66  LAMFHPSFSFIIMAINHIKPSC---GFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
            A  H       + + H+       G  + +   L    G+G+SA+  V+++ AL  L Y
Sbjct: 77  KA--HQ------LVLRHLNIDTSVDGLKMHLGGPLVPSSGIGASASDVVSLSRALSEL-Y 127

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQ--MPKYSIEKIDFIFPIHL 180
               + +E+  +A        G  SG D  A+ +GGLI Y+    K   ++I F  P++L
Sbjct: 128 QLNLTEEEVNLSAFVGEGGYHGTPSGADNTAATYGGLISYRRVNGKSVFKRIAFQQPLYL 187

Query: 181 IY--SGYKTPTAQVLKKISYIEIEYPE-INEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           +   +G    T +V+  +  ++   P   N + +   A + +  +    AL+  NL  + 
Sbjct: 188 VVCSTGITASTTKVVGDVRKLKENQPTWFNRLLENYNACVSEAKE----ALQKGNLFRVG 243

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
           + MN    L + L VS  +L  IV   R    + A K+SG+G G  V+AL
Sbjct: 244 ELMNANHDLCQKLTVSCRELDSIVQTCRTYGALGA-KMSGTGRGGLVVAL 292