RPSBLAST alignment for GI: 254781017 and conserved domain: PLN02677

>gnl|CDD|178281 PLN02677, PLN02677, mevalonate kinase. Length = 387
 Score = 54.8 bits (132), Expect = 3e-08
 Identities = 81/359 (22%), Positives = 141/359 (39%), Gaps = 103/359 (28%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHP 71
           APG ++L GEH V+HG  A+  AI+  +  Y++LR       D +L      L L     
Sbjct: 7   APGKIILAGEHAVVHGSTAVAAAID--LYTYVSLRFPPSAENDDTL-----KLQLKDLGL 59

Query: 72  SFSFIIMAINHIKP-----------SCGFD-LKVISQL---------------------- 97
            FS+ +  I    P           SC  + LK I+ L                      
Sbjct: 60  EFSWPLARIKEALPDLGTPCPSTPTSCSEETLKSIAALVEEQNIPEAKIWLSSGVSAFLW 119

Query: 98  ---------------DSQL----GLGSSAAITVAITAALLTLQYHKEPSPDEI-LTTAHA 137
                           S+L    GLGSSAA  VA++AALL          D I ++T   
Sbjct: 120 LYTSILGFNPATVVVTSELPLGSGLGSSAAFCVALSAALLAAS-------DSISVSTGGN 172

Query: 138 IVLKV-------------------QGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPI 178
               +                    G  SGID   S +G +I ++     + ++    P+
Sbjct: 173 GWSSLDETDLELVNKWAFEGEKIIHGKPSGIDNTVSTYGNMIKFK--SGELTRLQSNMPL 230

Query: 179 HLIYSGYKT--PTAQVLKKISYIEIEYPE--------INEINQKIYALMGKLSQISCQAL 228
            ++ +  +    T  ++  +S   + +P+        ++ I++++  ++ +       ++
Sbjct: 231 KMLITNTRVGRNTKALVAGVSERALRHPDAMKSVFNAVDSISEELATII-QSPAEDELSI 289

Query: 229 RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIAL 287
             K  K L + M   QGLL+ +GVS S +  ++       + + SK++G+G G CV+ L
Sbjct: 290 TEKEEK-LKELMEMNQGLLQCMGVSHSSIETVL--RTTLKYKLVSKLTGAGGGGCVLTL 345