RPSBLAST alignment for GI: 254781017 and conserved domain: COG2605

>gnl|CDD|32597 COG2605, COG2605, Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only]. Length = 333
 Score = 39.5 bits (92), Expect = 0.001
 Identities = 51/282 (18%), Positives = 101/282 (35%), Gaps = 42/282 (14%)

Query: 26  HGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKP 85
           HG A L   I+K + + +    D  I +     ++  S       P     +        
Sbjct: 26  HGGAVLNATIDKYIYVTIEKGFDDEIRVRYDRTEFVKSYLENEHKPLVVESLKRD----- 80

Query: 86  SCGFD----LKVISQLD--SQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIV 139
              F+    +++ +Q D     GLGSS+A  VA+  AL   +      P E+   A+ I 
Sbjct: 81  FLEFNGGTPIELHTQSDAPPGSGLGSSSAFVVALLNALHAWKGES-LGPYELAREAYEIE 139

Query: 140 LKVQGISSGI-DLAASIHGG-----------LICYQMPKYSIEKIDFIFPIHLIYSGYKT 187
            +   I  G  D  A+  GG           ++   +        +    + L Y+G   
Sbjct: 140 REDLKIVGGKQDQYAAAFGGFNFMEFRGNGEVVVNPLRINRERTAELEARLLLYYTGITR 199

Query: 188 PTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNK------NLKVLAQAMN 241
            +++V++          ++  +       +  L ++   A   K      ++    Q ++
Sbjct: 200 QSSEVIED---------QVRNVVDGDEETLEALHEMKALAYEMKDALVRNDIPEFGQILD 250

Query: 242 RQQGLLETL--GVSDSKLSEIVWKLREQPHIMASKISGSGLG 281
           R     + L   +S+  +  I ++L  +      K+SG+G G
Sbjct: 251 RGWEAKKKLSSRISNDAIDRI-YELALKNGAYGGKLSGAGGG 291