RPSBLAST alignment of GI: 254781017 and protein with PDBid: 2aj4

>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Length = 548
 Score = 38.8 bits (89), Expect = 0.002
 Identities = 13/65 (20%), Positives = 23/65 (35%), Gaps = 2/65 (3%)

Query: 224 SCQALRNKNLKVLAQAMNRQQGLLETL-GVSDSKLSEIVWKLREQPHIMASKISGSGLGD 282
           +         K     MN  Q   + L   S  ++ +I            S+++G+G G 
Sbjct: 434 ASFTADEDFFKQFGALMNESQASCDKLYECSCPEIDKICSIALS-NGSYGSRLTGAGWGG 492

Query: 283 CVIAL 287
           C + L
Sbjct: 493 CTVHL 497