RPSBLAST alignment of GI: 254781017 and protein with PDBid: 2cz9

>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Length = 350
 Score = 88.5 bits (218), Expect = 2e-18
 Identities = 56/317 (17%), Positives = 107/317 (33%), Gaps = 35/317 (11%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           I V +PG + L+GEH        +  AIN    +      + ++  +    +   SL+  
Sbjct: 2   IKVKSPGRVNLIGEHTDYTYGYVMPMAINLYTKIEAEKHGEVILYSEHFGEERKFSLNDL 61

Query: 68  MFHPSFSFIIMAINHI-----KPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQY 122
               S+   +  I  +         G   +V   L    GL SSA+  V I   L  L Y
Sbjct: 62  RKENSWIDYVKGIFWVLKESDYEVGGIKGRVSGNLPLGAGLSSSASFEVGILETLDKL-Y 120

Query: 123 HKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGG------LICYQMPKYSIEKIDFIF 176
           + +      +  A     +  G+  GI    ++  G       +      Y         
Sbjct: 121 NLKLDSLSKVLLAKKAENEFVGVPCGILDQFAVVFGREGNVIFLDTHTLDYEYIPFPKDV 180

Query: 177 PIHLIYSGYKTPT---------------AQVLKKISYIEIEYPEINEINQKIYALMGKLS 221
            I + Y+G +                   ++L K S  E+   E++++        G + 
Sbjct: 181 SILVFYTGVRRELASSEYAERKHIAEESLKILGKGSSKEVREGELSKLPPLHRKFFGYIV 240

Query: 222 QISCQALRNKNL-------KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASK 274
           + + + L  ++        +V          L +   VS  +L   V +  +      ++
Sbjct: 241 RENARVLEVRDALKEGNVEEVGKILTTAHWDLAKNYEVSCKELDFFVERALK-LGAYGAR 299

Query: 275 ISGSGLGDCVIALGKGD 291
           ++G+G G   IAL   +
Sbjct: 300 LTGAGFGGSAIALVDKE 316