RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (324 letters)



>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon
           Methanococcus jannaschii [TaxId: 2190]}
          Length = 180

 Score = 92.6 bits (229), Expect = 4e-20
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 16/180 (8%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
             + +  P  ++L GEH V++G+ A+  AI+    + +   ++  I ++ +       L+
Sbjct: 4   SHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLN 63

Query: 66  LAMF-------HPSFSFIIMAIN------HIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
           L             F + + AI       +I+P  GF + + S++    GLGSSA+IT+ 
Sbjct: 64  LNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIG 123

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI 172
              A+    Y+KE   DEI    + +  ++QG +S  D +   + G++  +  K+   KI
Sbjct: 124 TIKAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKF--RKI 180


>d1k47a1 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK)
           {Streptococcus pneumoniae r6 [TaxId: 171101]}
          Length = 194

 Score = 86.8 bits (214), Expect = 2e-18
 Identities = 27/170 (15%), Positives = 49/170 (28%), Gaps = 6/170 (3%)

Query: 8   ICVSAPGSLVLMGEHGVLH-GHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           I V   G L   GE+ +L  G  AL+  I   +   +       I  D          + 
Sbjct: 2   IAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLRPNP 61

Query: 67  A---MFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL--Q 121
               +               +    F L +  +++ +       +    +   +  L   
Sbjct: 62  DYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLAL 121

Query: 122 YHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEK 171
           Y+     + +     A++LK     S  DLA      L+ YQ        
Sbjct: 122 YNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVA 171


>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus
           norvegicus) [TaxId: 10116]}
          Length = 225

 Score = 84.9 bits (209), Expect = 8e-18
 Identities = 50/221 (22%), Positives = 76/221 (34%), Gaps = 58/221 (26%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + VSAPG ++L GEH V+HG  AL  A+N R  L L  + +  ++++          D+A
Sbjct: 6   LLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVA 65

Query: 68  MFHPS------------------------------------------FSFIIMAINHIKP 85
                                                              +      + 
Sbjct: 66  TLQLLDTGFLEQGDVPAPTLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQRT 125

Query: 86  SCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH--------------KEPSPDEI 131
               D+ V S+L    GLGSSAA +V + AALLT                   E     I
Sbjct: 126 LPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEEDLKSI 185

Query: 132 LTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI 172
              A+     + G  SG+D + S  GG + YQ  +  +  +
Sbjct: 186 NKWAYEGERVIHGNPSGVDNSVSTWGGALRYQ--QGKMSSL 224


>d1kvka2 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus
           norvegicus) [TaxId: 10116]}
          Length = 169

 Score = 68.1 bits (166), Expect = 1e-12
 Identities = 31/141 (21%), Positives = 52/141 (36%), Gaps = 6/141 (4%)

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEIEYPEINE----INQKIYALMGKLSQISCQALRNK 231
             I L  +     T  ++  +    I++PEI          I     ++      A   +
Sbjct: 5   LQILLTNTKVPRSTKALVAGVRSRLIKFPEIMAPLLTSIDAISLECERVLGEMAAAPVPE 64

Query: 232 NLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
              VL + M+  Q  L  LGV  + L ++        H + SK++G+G G C I L K  
Sbjct: 65  QYLVLEELMDMNQHHLNALGVGHASLDQLCQVTAA--HGLHSKLTGAGGGGCGITLLKPG 122

Query: 292 LNSLPYQSVNCHMHAKGIDIV 312
           L     ++    +   G D  
Sbjct: 123 LERAKVEAAKQALTGCGFDCW 143


>d1wuua1 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 215

 Score = 63.7 bits (154), Expect = 2e-11
 Identities = 38/166 (22%), Positives = 60/166 (36%), Gaps = 16/166 (9%)

Query: 8   ICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLA 67
           + VSAPG + L+GEH   +    L  A+    +L  + RKD L+++ ++         L 
Sbjct: 29  LAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQ 88

Query: 68  MFHPSFSFII--------------MAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAI 113
              P+    +              +      P  GF   V+S +    GL SSA++ VA 
Sbjct: 89  FPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVAT 148

Query: 114 TAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG 158
              L  L      +                G+  GI D   S+ G 
Sbjct: 149 YTFLQQL-CPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQ 193


>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus
           furiosus [TaxId: 2261]}
          Length = 176

 Score = 63.7 bits (154), Expect = 2e-11
 Identities = 39/174 (22%), Positives = 59/174 (33%), Gaps = 10/174 (5%)

Query: 10  VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMF 69
           V +PG + L+GEH        +  AI+   I+         +  +    +   +LD    
Sbjct: 2   VKSPGRVNLIGEHTDYTYGYVMPMAIDLYTIITAEKYDKVQLYSEHFNEEKTFTLDNLTK 61

Query: 70  HPSFSFIIMA-----INHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHK 124
             S+   +       I       G   K+   L    GL SSA+  V I   L  L Y+ 
Sbjct: 62  EGSWIDYVKGVLWVLIQEGYKIGGLKGKITGDLPLGAGLSSSASFEVGILEVLNQL-YNL 120

Query: 125 EPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG---LICYQMPKYSIEKIDF 174
              P +    A     +  G+  GI D  A + G    +I         E I F
Sbjct: 121 NIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPF 174


>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis
           [TaxId: 1358]}
          Length = 205

 Score = 61.4 bits (148), Expect = 9e-11
 Identities = 32/163 (19%), Positives = 63/163 (38%), Gaps = 14/163 (8%)

Query: 9   CVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSL---- 64
              +PG + L+GEH   +G      +I         LR+D+ + + S      G +    
Sbjct: 22  YFFSPGRINLIGEHTDYNGGYVFPASITIGTTGLARLREDKKVKLYSENFPKLGVIEFDL 81

Query: 65  --------DLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAA 116
                   +L   +     +++     +   GF+L +  ++ +  GL SSA++ + +   
Sbjct: 82  DEVEKKDGELWSNYVKGMIVMLKGAGYEIDKGFELLIKGEIPTASGLSSSASLELLVGVV 141

Query: 117 LLTLQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGG 158
           L  L ++      E++           G++SGI D  A   G 
Sbjct: 142 LDDL-FNLNVPRLELVQLGQKTENDYIGVNSGILDQFAIGFGE 183


>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon
           Methanococcus jannaschii [TaxId: 2190]}
          Length = 137

 Score = 54.6 bits (131), Expect = 1e-08
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 13/112 (11%)

Query: 180 LIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQA 239
           +     K  TA+++ +++ IE +     EI            ++  +AL+ KN +   + 
Sbjct: 16  VYAEKRKKKTAELVNEVAKIENKDEIFKEI-----------DKVIDEALKIKNKEDFGKL 64

Query: 240 MNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           M +   LL+ L +S  KL  IV           +K++G+G G CVI L   +
Sbjct: 65  MTKNHELLKKLNISTPKLDRIVDIGNR--FGFGAKLTGAGGGGCVIILVNEE 114


>d1k47a2 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK)
           {Streptococcus pneumoniae r6 [TaxId: 171101]}
          Length = 135

 Score = 50.1 bits (119), Expect = 2e-07
 Identities = 22/118 (18%), Positives = 39/118 (33%), Gaps = 11/118 (9%)

Query: 176 FPIHLI--YSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNL 233
                +  ++     ++ ++++I            INQ       +      +AL     
Sbjct: 4   LECDFLVGWTKEVAVSSHMVQQIK---------QNINQNFLTSSKETVVSLVEALEQGKS 54

Query: 234 KVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGD 291
           + + + +     LLE L            K   Q     +K SG+G GDC IAL    
Sbjct: 55  EKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDA 112


>d1wuua2 d.58.26.7 (A:217-392) Galactokinase {Human (Homo sapiens)
           [TaxId: 9606]}
          Length = 176

 Score = 46.6 bits (110), Expect = 3e-06
 Identities = 22/114 (19%), Positives = 44/114 (38%), Gaps = 11/114 (9%)

Query: 190 AQVLKKISYIEIEYPEINEINQKIYALMGK----------LSQISCQALRNKNLKVLAQA 239
           A+ L K S  E++  E+      +     +           +  +  ALR  + +   + 
Sbjct: 31  ARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRL 90

Query: 240 MNR-QQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           M    + L +   VS  +L ++V      P +  S+++G G G C + L +   
Sbjct: 91  MVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASA 144


>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon
           Methanococcus jannaschii [TaxId: 2190]}
          Length = 163

 Score = 46.6 bits (110), Expect = 3e-06
 Identities = 19/103 (18%), Positives = 37/103 (35%), Gaps = 5/103 (4%)

Query: 73  FSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEIL 132
                  I+      G  + +   + +  GLGSSAA +     A+  L +       +++
Sbjct: 61  GIVAKKMIDDFNIGKGVKITIKKGVKAGSGLGSSAASSAGTAYAINEL-FKLNLDKLKLV 119

Query: 133 TTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFI 175
             A    L   G     ++A +I GG         + E ++ +
Sbjct: 120 DYASYGELASSGAKHADNVAPAIFGGFTMVT----NYEPLEVL 158


>d1piea2 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis
           [TaxId: 1358]}
          Length = 183

 Score = 45.1 bits (106), Expect = 9e-06
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 217 MGKLSQISCQALRNKNLKVLAQAMNR-QQGLLETLGVSDSKLSEIVWKLREQPHIMASKI 275
               ++I+ +A    NL    + +N     L +   V+  +L  +    ++Q  ++ +++
Sbjct: 73  ENNRTKIAQKAFVAGNLTKFGELLNASHASLKDDYEVTGLELDTLAETAQKQAGVLGARM 132

Query: 276 SGSGLGDCVIALGKGDL 292
           +G+G G C IAL   D 
Sbjct: 133 TGAGFGGCAIALVAHDN 149


>d1s4ea2 d.58.26.7 (A:181-351) Galactokinase {Archaeon Pyrococcus
           furiosus [TaxId: 2261]}
          Length = 171

 Score = 34.7 bits (79), Expect = 0.011
 Identities = 17/92 (18%), Positives = 34/92 (36%), Gaps = 2/92 (2%)

Query: 202 EYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNR-QQGLLETLGVSDSKLSEI 260
           + P ++                   AL+  +++ + + +      L E   VS  +L   
Sbjct: 49  KLPPLHRKFFSYIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFF 108

Query: 261 VWKLREQPHIMASKISGSGLGDCVIALGKGDL 292
           V K   +     ++++G+G G   IAL   D 
Sbjct: 109 VKKAM-ELGAYGARLTGAGFGGSAIALVDKDK 139


>d1fi4a1 d.14.1.5 (A:3-190) Mevalonate 5-diphosphate decarboxylase
           {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 188

 Score = 28.8 bits (64), Expect = 0.61
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 16/119 (13%)

Query: 48  DRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLD--SQLGLGS 105
               +ID+   Q C   DL            ++  +     + L ++S+ +  +  GL S
Sbjct: 63  GEPHSIDNERTQNCLR-DLRQLRKEMESKDASLPTLS---QWKLHIVSENNFPTAAGLAS 118

Query: 106 SAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM 164
           SAA   A+ +A+  L Y    S  EI   A       +G  S      S+ GG + ++M
Sbjct: 119 SAAGFAALVSAIAKL-YQLPQSTSEISRIAR------KGSGSA---CRSLFGGYVAWEM 167


>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium
           album), strain limber [TaxId: 37998]}
          Length = 279

 Score = 28.9 bits (63), Expect = 0.63
 Identities = 19/87 (21%), Positives = 26/87 (29%), Gaps = 4/87 (4%)

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
            G+ D      SFS     ++   P        I      +   S A   VA  AA L +
Sbjct: 180 VGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYL-M 238

Query: 121 QYHKEPSPDE---ILTTAHAIVLKVQG 144
              K  +      I  TA+   L    
Sbjct: 239 TLGKTTAASACRYIADTANKGDLSNIP 265


>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1
           {Pseudoalteromonas sp. AS-11 [TaxId: 247492]}
          Length = 435

 Score = 27.7 bits (60), Expect = 1.5
 Identities = 11/38 (28%), Positives = 16/38 (42%), Gaps = 5/38 (13%)

Query: 105 SSAAITVAITAALLTLQYHKEPSPDEI----LTTAHAI 138
           S A   V+  A L+   YH E S  ++      TA  +
Sbjct: 369 SMATPHVSGVATLV-WSYHPECSASQVRAALNATADDL 405


>d1aqta2 b.93.1.1 (A:2-86) Epsilon subunit of F1F0-ATP synthase
          N-terminal domain {Escherichia coli [TaxId: 562]}
          Length = 85

 Score = 27.4 bits (61), Expect = 1.9
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 10 VSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLT 44
          +   GS    GE G+  GHA L+ AI   +I  + 
Sbjct: 22 IQVTGS---EGELGIYPGHAPLLTAIKPGMIRIVK 53


>d2jdih2 b.93.1.1 (H:17-101) Epsilon subunit of F1F0-ATP synthase
          N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
          Length = 85

 Score = 26.6 bits (59), Expect = 2.9
 Identities = 6/31 (19%), Positives = 11/31 (35%), Gaps = 3/31 (9%)

Query: 10 VSAPGSLVLMGEHGVLHGHAALVFAINKRVI 40
          V  P      G  G+L  H   +  +   ++
Sbjct: 20 VDVPTQ---TGAFGILAAHVPTLQVLRPGLV 47


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.322    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0499    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,167,201
Number of extensions: 52490
Number of successful extensions: 140
Number of sequences better than 10.0: 1
Number of HSP's gapped: 129
Number of HSP's successfully gapped: 24
Length of query: 324
Length of database: 2,407,596
Length adjustment: 85
Effective length of query: 239
Effective length of database: 1,240,546
Effective search space: 296490494
Effective search space used: 296490494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.7 bits)