BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus
Liberibacter asiaticus str. psy62]
         (324 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 324

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY
Sbjct: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL
Sbjct: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180
           QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL
Sbjct: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHL 180

Query: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240
           IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM
Sbjct: 181 IYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAM 240

Query: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300
           NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV
Sbjct: 241 NRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSV 300

Query: 301 NCHMHAKGIDIVPITPSHSTSLYR 324
           NCHMHAKGIDIVPITPSHSTSLYR
Sbjct: 301 NCHMHAKGIDIVPITPSHSTSLYR 324


>gi|254781018|ref|YP_003065431.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 337

 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 125/293 (42%), Gaps = 36/293 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS------------LGQ 59
           AP  ++L GE+  L+G +AL  AI   +   LT  +  LI I +S            LG 
Sbjct: 15  APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGH 74

Query: 60  YCGS-----------LDLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSS 106
                          +   + HP+   I+   N   P  SCG  L + S +    G GSS
Sbjct: 75  QIDQRHRDFIAKKIPITSVLTHPN-DLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSS 133

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           +AI  A++ AL ++  H+     E L      + ++Q   +GI  + +I  G I Y  P 
Sbjct: 134 SAIISALSLALSSIT-HQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPP 192

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
             I+    +     I +G   P +   + +S++E  + +       I++    ++    +
Sbjct: 193 QIIKNETLVGEWWAINTG--MPESSTGECVSFVEQHFSQ-----SSIWSEFNAVTNEMME 245

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSG 279
            ++ K+ +   +++   Q LLE++GV    + + +  +       ++KI+G+G
Sbjct: 246 NIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGG--SAKIAGAG 296


>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 869

 Score = 27.7 bits (60), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 3/27 (11%)

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYP 204
           +HL+Y+ +    A +LKKI YIEI+ P
Sbjct: 549 LHLLYARF---FAHILKKIGYIEIDEP 572


>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 438

 Score = 26.6 bits (57), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 204 PEINEINQKIYALMGKLSQISCQALRN 230
           PE  +I +KIYALM K  +     L N
Sbjct: 245 PEFRQIVEKIYALMTKKEEKRLNPLEN 271


>gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 106

 Score = 23.1 bits (48), Expect = 6.2,   Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 10/15 (66%)

Query: 85 PSCGFDLKVISQLDS 99
          P CGF  KV+  LDS
Sbjct: 29 PRCGFSGKVVQVLDS 43


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.322    0.137    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 201,210
Number of Sequences: 1233
Number of extensions: 7908
Number of successful extensions: 27
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 21
Number of HSP's gapped (non-prelim): 5
length of query: 324
length of database: 328,796
effective HSP length: 74
effective length of query: 250
effective length of database: 237,554
effective search space: 59388500
effective search space used: 59388500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 38 (19.2 bits)