>cd02812 PcrB_like PcrB_like proteins. One member of this family, a protein from Archaeoglobus fulgidus, has been characterized as a (S)-3-O-geranylgeranylglyceryl phosphate synthase (AfGGGPS). AfGGGPS catalyzes the formation of an ether linkage between sn-glycerol-1-phosphate (G1P) and geranylgeranyl diphosphate (GGPP), the committed step in archaeal lipid biosynthesis. Therefore, it has been proposed that PcrB-like proteins are either prenyltransferases or are involved in lipoteichoic acid biosynthesis although the exact function is still unknown.

Probab=96.77 E-value=0.0067 Score=35.45 Aligned_cols=45 Identities=16% Similarity=0.187 Sum_probs=37.2 Q ss_pred HHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCEEHHHHHHH Q ss_conf 899999852289879972988888999999983888523347999 Q gi|254781020|r 247 LSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFL 291 (337) Q Consensus 247 ~al~~~~~~~~~v~IiadGGIr~g~Dv~kAlalGAdaV~iGr~~l 291 (337) T Consensus 164 e~V~~vk~~l~~~~LivGGGIrs~e~a~~~~~AgAD~IVvGn~ie 208 (219) T cd02812 164 EVVRAVKKVLGDTPLIVGGGIRSGEQAKEMAEAGADTIVVGNIVE 208 (219) T ss_pred HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCEE T ss_conf 999999984679709992897999999999986999999887224

HHsearch alignment for GI: 254781020 and conserved domain: cd02812