>pfam01207 Dus Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria.

Probab=95.36 E-value=0.17 Score=27.12 Aligned_cols=74 Identities=18% Similarity=0.122 Sum_probs=55.4 Q ss_pred HHHHHHHHHHHCCCEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHH-CCCCEEE Q ss_conf 899998776508985762532035665206885243079999999987399717850478668899999997-6997999 Q gi|254781020|r 134 VQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLK-SGIRYFD 212 (337) Q Consensus 134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~pii~k~v~~~~~~~~~~~a~~-aGad~i~ 212 (337) T Consensus 140 ~~~~~~~l~~~G~~~itvH~Rt~~q~~~------g~a~w~~i~~~k~~~~ipvi~--NGdi~~~~d~~~~l~~tg~dgvM 211 (309) T pfam01207 140 AVEIARRVEDAGAQALTVHGRTRAQNYE------GPADWDAIKQVKQAVSIPVIA--NGDITDAEDAQRCLSYTGADGVM 211 (309) T ss_pred HHHHHHHHHHCCCCEEEEECCCHHHCCC------CCCCHHHHHHHHHHCCCCEEE--ECCCCCHHHHHHHHHHHCCCEEE T ss_conf 9999999984688879996763240267------865418999999858982898--08948899999998610999999 Q ss_pred ECC Q ss_conf 458 Q gi|254781020|r 213 IAG 215 (337) Q Consensus 213 v~~ 215 (337) T Consensus 212 igR 214 (309) T pfam01207 212 IGR 214 (309) T ss_pred ECH T ss_conf 848

HHsearch alignment for GI: 254781020 and conserved domain: pfam01207