RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254781022|ref|YP_003065435.1| hypothetical protein
CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62]
         (163 letters)



>gnl|CDD|183256 PRK11648, PRK11648, inner membrane protein; Provisional.
          Length = 195

 Score =  166 bits (422), Expect = 3e-42
 Identities = 72/161 (44%), Positives = 99/161 (61%), Gaps = 3/161 (1%)

Query: 1   MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKT 60
           MT EGH +F++A  I AKK          +W  ++ GA+L+CLLPDIDHP+SF+ +R K 
Sbjct: 1   MTAEGHLLFSIACAIFAKKAELTPVLAQGDWWHIIPGAILTCLLPDIDHPKSFLGQRLKW 60

Query: 61  LSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSE-LISYQGLQDALIIGYVSHLVADVL 119
           +S   +    HRGFTHS+LAV     L +   P    I    LQ A+++GY+SH++AD+L
Sbjct: 61  ISKPIARAFGHRGFTHSLLAVFALLALFYLKVPESWPIPADALQ-AMVLGYLSHILADML 119

Query: 120 TPTGIPLLWPYHWRFCLPILHP-NSPIGEIFFCVLFLIYAI 159
           TP G+PLLWP  WRF LPIL P      E F C+   ++A+
Sbjct: 120 TPAGVPLLWPCRWRFRLPILVPQKGNQLERFLCMALFVFAV 160


>gnl|CDD|116562 pfam07952, Toxin_trans, Clostridium neurotoxin, Translocation
           domain.  The Clostridium neurotoxin family is composed
           of tetanus neurotoxin and seven serotypes of botulinum
           neurotoxin. The structure of the botulinum neurotoxin
           reveals a four domain protein. The N-terminal catalytic
           domain (pfam01742), the central translocation domains
           and two receptor binding domains. Subsequent to cell
           surface binding and receptor mediated endocytosis of the
           neurotoxin, an acid induced conformational change in the
           neurotoxin translocation domain is believed to allow the
           domain to penetrate the endosome and from a pore,
           thereby facilitating the passage of the catalytic domain
           across the membrane into the cytosol. The structure of
           the translocation reveals a pair of helices that are 105
           Angstroms long and is structurally distinct from other
           pore forming toxins.
          Length = 318

 Score = 30.1 bits (68), Expect = 0.27
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 74  FTHSILAVILYKWLIHHFFPSELISY--QGLQDALIIGYVSHLVADVLT 120
            T S+   +L    ++ FF S+ I+   + +Q AL +G+V  ++ D  T
Sbjct: 20  LTSSVDDALLNSSKVYTFFSSDFINKVNKPVQAALFLGWVKQVIDDFTT 68


>gnl|CDD|184308 PRK13761, PRK13761, hypothetical protein; Provisional.
          Length = 248

 Score = 27.8 bits (63), Expect = 1.3
 Identities = 8/25 (32%), Positives = 13/25 (52%)

Query: 33  TVVLGALLSCLLPDIDHPRSFISKR 57
             VLG      +P +DH R+ +S+ 
Sbjct: 122 KEVLGTDEDARIPGLDHERAKVSED 146


>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional.
          Length = 793

 Score = 27.0 bits (59), Expect = 2.3
 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 111 VSHLVADVLTPTGIPLLWPYHWRFCLPILHP 141
           +S L   VL P  I L WP    FCL +LHP
Sbjct: 222 MSSLRHRVLPPQ-ILLNWPKEASFCLWLLHP 251


>gnl|CDD|179229 PRK01122, PRK01122, potassium-transporting ATPase subunit B;
           Provisional.
          Length = 679

 Score = 25.9 bits (58), Expect = 5.7
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 4/38 (10%)

Query: 8   IFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLP 45
           IF L    L       ++++       VL ALL CL+P
Sbjct: 228 IFLLVVATLP----PFAAYSGGALSITVLVALLVCLIP 261


>gnl|CDD|135467 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated.
          Length = 370

 Score = 25.6 bits (56), Expect = 6.4
 Identities = 11/21 (52%), Positives = 12/21 (57%)

Query: 114 LVADVLTPTGIPLLWPYHWRF 134
           LVAD    TG PL+W    RF
Sbjct: 147 LVADAAEITGTPLVWGTVLRF 167


>gnl|CDD|182385 PRK10333, PRK10333, 5-formyltetrahydrofolate cyclo-ligase family
           protein; Provisional.
          Length = 182

 Score = 25.3 bits (55), Expect = 7.1
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 8/47 (17%)

Query: 111 VSHLVADVLTPTG-------IPLLWPYHWRFCLPILHPNSPIGEIFF 150
           ++H VA  L+  G       I  LW    R  LP+LHP S  G + F
Sbjct: 33  MAHTVAVFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSA-GNLLF 78


>gnl|CDD|177745 PLN00137, PLN00137, NHAD transporter family protein; Provisional.
          Length = 424

 Score = 25.0 bits (55), Expect = 8.2
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 22  FLSSFTDAEWGTVVLGALLSCLLPDIDHPRSF 53
           FLSS  D    T+V+ +LL  L+P  ++ +  
Sbjct: 113 FLSSILDNLTTTIVMVSLLRKLVPPSEYRKLL 144


>gnl|CDD|116392 pfam07778, Mis6, Mis6.  Mis6 is an essential centromere connector
           protein acting during G1-S phase of the cell cycle. Mis6
           is thought to be required for recruiting CENP-A, the
           centromere- specific histone H3 variant, an important
           event for centromere function and chromosome segregation
           during mitosis.
          Length = 470

 Score = 25.2 bits (55), Expect = 8.6
 Identities = 24/120 (20%), Positives = 40/120 (33%), Gaps = 26/120 (21%)

Query: 6   HCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLT 65
             I  L  V L+ K           +   V   ++ CL P        + K    L    
Sbjct: 70  EEIDILLDVALSGK----------HFDNAVNTRIIKCLYPATKISEDSVVKAVSWL---- 115

Query: 66  SCISSHRGFTHSILAVILYKWLIH--HFFP-SELIS------YQGLQDALIIGYVSHLVA 116
            C+   +      + V+L +WLI    F    E ++      +  L D  +  Y+ HL+ 
Sbjct: 116 -CVGQLK--CSGNIQVLLLRWLIAVYDFLDHKEQLNQLYGVLFNFLDDDALRPYICHLLY 172


>gnl|CDD|180449 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase;
           Validated.
          Length = 538

 Score = 24.9 bits (55), Expect = 9.2
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%)

Query: 114 LVADVLTPTGIPLLWPYHWRFCLP 137
           LV DVL     PL  P+ +++C P
Sbjct: 194 LVVDVLI-ANDPLGGPHTYQYCDP 216


>gnl|CDD|185431 PTZ00077, PTZ00077, asparagine synthetase-like protein;
           Provisional.
          Length = 586

 Score = 25.1 bits (55), Expect = 9.2
 Identities = 10/39 (25%), Positives = 17/39 (43%), Gaps = 2/39 (5%)

Query: 86  WLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGI 124
               H  P+  I  + +++AL       L+ DV  P G+
Sbjct: 206 HDFDHPIPTGEIDLEEIREALEAAVRKRLMGDV--PFGL 242


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.331    0.145    0.478 

Gapped
Lambda     K      H
   0.267   0.0781    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 2,736,658
Number of extensions: 166537
Number of successful extensions: 418
Number of sequences better than 10.0: 1
Number of HSP's gapped: 415
Number of HSP's successfully gapped: 26
Length of query: 163
Length of database: 5,994,473
Length adjustment: 86
Effective length of query: 77
Effective length of database: 4,136,185
Effective search space: 318486245
Effective search space used: 318486245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 53 (24.1 bits)